F059794

General Info

Members Datasets Scaffolds Average Seq Length
110 40 218 603

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10114209|Ga0307508_101142091
Length 633
Sequence VALNDMHAEAVAGIVDRVAARYRREPNNMLQILREVQEACDWITPEAIDRLQAVLGVPRTKIEGVAGFYSFLYTQPRGKYRILFSDNVTDNMQGNRALMERLCGNLWVEPGKISEDGLLSIDKTSCTGMCDQGPGLLVNNIAITRLTAARIDEIAELVRNKVPLAEWPAEFFRVEDNIRKADIMLGAQLQPGDALRAAHARVPSDGLLSSNMRSWREGLPSGIGGPAAMLDEIKRANLRGRGGAGFMTGLKWEACRNAPLKAGQQRFVVCNADEGEPGTFKDRVLLTSYADLVFEGMTAAAYAIGARRGFLYLRGEYRYLLEPLNAVLERRRKEKILGADILGIPGADFDIEIHLGAGAYVCGEESALIESLEGKRGTPRNRPPFPVTNGYLDQPTIVNNVETFAAAALIALNGGEWYASVGTRQSAGTKILSVSGDCERPGLYEYPFGVTIRQVLADCGAQDVQAVQVSGPSGICISPDEFERTISFEDIPTAGAFTIFNNSRDMFEVARNYVHFFQHESCGFCTPCRVGTSLLKNLMDKLHNGCGSPYDFAEIEKMNQLLQSMSHCGLGHTACNPVLDTIAKFRPAYERRMAQKDFVPAFDLDQALAAARQMTGRDDPGAHIIKEEFGEDA

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
3 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
4 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
5 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
6 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
7 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
8 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
9 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
10 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
11 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
12 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
13 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
14 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
15 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
16 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
17 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
18 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
19 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
20 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
21 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
24 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
25 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
26 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
27 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
28 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
29 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
30 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
31 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
32 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
33 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
34 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
35 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
36 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
37 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
38 2547132512 Azospira oryzae 6a3 Isolate Unclassified
39 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
40 2894510363 Methylomonas sp. Kb3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.64
Metatranscriptomes 2.73
Isolates 3.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10114209 3300031616 Bacteria 2301
2 Ga0213872_10032692 3300021361 Bacteria 2384
3 Ga0213871_10001578 3300021441 Bacteria 3877
4 Ga0265324_10000205 3300029957 Bacteria 45035
5 Ga0265324_10010469 3300029957 Bacteria 3574
6 Ga0265332_10000016 3300031238 Bacteria 229887
7 Ga0265332_10000714 3300031238 Bacteria 21027
8 Ga0265328_10000073 3300031239 Bacteria 53715
9 Ga0265328_10000093 3300031239 Bacteria 45008
10 Ga0265328_10001427 3300031239 Bacteria 10997
11 Ga0265328_10006327 3300031239 Bacteria 5025
12 Ga0265320_10000891 3300031240 Bacteria 22474
13 Ga0265325_10002315 3300031241 Bacteria 12922
14 Ga0265329_10002395 3300031242 Bacteria 8507
15 Ga0265329_10010991 3300031242 Bacteria 3304
16 Ga0265331_10000005 3300031250 Bacteria 465192
17 Ga0265331_10000314 3300031250 Bacteria 52982
18 Ga0265331_10002638 3300031250 Bacteria 12022
19 Ga0265331_10004726 3300031250 Bacteria 8427
20 Ga0265331_10006765 3300031250 Bacteria 6719
21 Ga0265331_10008303 3300031250 Bacteria 5917
22 Ga0265327_10000213 3300031251 Bacteria 121151
23 Ga0265327_10000881 3300031251 Bacteria 44377
24 Ga0265327_10003315 3300031251 Bacteria 15583
25 Ga0265327_10005782 3300031251 Bacteria 10175
26 Ga0265327_10012079 3300031251 Bacteria 5865
27 Ga0265327_10016441 3300031251 Bacteria 4699
28 Ga0265327_10030275 3300031251 Bacteria 3063
29 Ga0265316_10000378 3300031344 Bacteria 50609
30 Ga0265316_10001619 3300031344 Bacteria 24014
31 Ga0265316_10051888 3300031344 Bacteria 3220
32 Ga0265316_10055012 3300031344 Bacteria 3115
33 Ga0265313_10000245 3300031595 Bacteria 59085
34 Ga0265313_10005128 3300031595 Bacteria 9755
35 Ga0316579_10020104 3300031691 Bacteria 2956
36 Ga0265314_10005537 3300031711 Bacteria 11364
37 Ga0265314_10057709 3300031711 Bacteria 2664
38 Ga0265314_10061167 3300031711 Bacteria 2566
39 Ga0316576_10001822 3300031727 Bacteria 11829
40 Ga0316576_10011831 3300031727 Bacteria 5738
41 Ga0316576_10034626 3300031727 Bacteria 3600
42 Ga0316576_10056960 3300031727 Bacteria 2856
43 Ga0316578_10004518 3300031728 Bacteria 6583
44 Ga0316578_10013794 3300031728 Bacteria 4296
45 Ga0316578_10024784 3300031728 Bacteria 3368
46 Ga0316578_10037276 3300031728 Bacteria 2800
47 Ga0316577_10020227 3300031733 Bacteria 3690
48 Ga0316577_10035914 3300031733 Bacteria 2770
49 Ga0316583_10002668 3300032133 Bacteria 6234
50 Ga0316583_10016394 3300032133 Bacteria 2666
51 Ga0316580_10017023 3300032139 Bacteria 2233
52 Ga0316593_10001168 3300032168 Bacteria 5600
53 Ga0316593_10010858 3300032168 Bacteria 2628
54 Ga0316588_1002776 3300033528 Bacteria 3095
55 Ga0316574_0019377 3300035398 Bacteria 4012
56 Ga0316574_0045136 3300035398 Bacteria 2728
57 Ga0316582_0025731 3300036647 Bacteria 3537
58 Ga0316582_0039832 3300036647 Bacteria 2928
59 Ga0316582_0041978 3300036647 Bacteria 2863
60 Ga0316582_0051380 3300036647 Bacteria 2615
61 Ga0316582_0111632 3300036647 Bacteria 1820
62 Ga0316584_0000874 3300036712 Bacteria 17108
63 Ga0316584_0000917 3300036712 Bacteria 16795
64 Ga0316584_0004805 3300036712 Bacteria 8973
65 Ga0316584_0025070 3300036712 Bacteria 4371
66 Ga0316581_0003267 3300037588 Bacteria 4017
67 Ga0400486_03830 3300038742 Bacteria 2575
68 Ga0436360_0226122 3300039438 Bacteria 5412
69 Ga0436360_1348858 3300039438 Bacteria 3581
70 Ga0436361_0360172 3300039447 Bacteria 47640
71 Ga0451577_0000002 3300042876 Bacteria 1731375
72 Ga0451577_0000071 3300042876 Bacteria 238560
73 Ga0451577_0000114 3300042876 Bacteria 175957
74 Ga0451577_0000284 3300042876 Bacteria 98326
75 Ga0451577_0010609 3300042876 Bacteria 8785
76 Ga0451577_0026240 3300042876 Bacteria 5277
77 Ga0451577_0090004 3300042876 Bacteria 2739
78 Ga0453683_0032779 3300044673 Bacteria 3276
79 Ga0453683_0049925 3300044673 Bacteria 2622
80 Ga0453684_0000102 3300044712 Bacteria 366870
81 Ga0453684_0000149 3300044712 Bacteria 307732
82 Ga0453684_0000163 3300044712 Bacteria 296196
83 Ga0453684_0000331 3300044712 Bacteria 197952
84 Ga0453684_0000606 3300044712 Bacteria 132056
85 Ga0453684_0000778 3300044712 Bacteria 109956
86 Ga0453684_0003977 3300044712 Bacteria 32287
87 Ga0453684_0004720 3300044712 Bacteria 28190
88 Ga0453684_0011958 3300044712 Bacteria 14440
89 Ga0453684_0028854 3300044712 Bacteria 7899
90 Ga0453684_0033972 3300044712 Bacteria 7092
91 Ga0453684_0043373 3300044712 Bacteria 6046
92 Ga0453684_0074158 3300044712 Bacteria 4286
93 Ga0453684_0113987 3300044712 Bacteria 3278
94 Ga0453684_0135909 3300044712 Bacteria 2944
95 Ga0453684_0202725 3300044712 Bacteria 2311
96 Ga0451576_0000013 3300045051 Bacteria 665120
97 Ga0451576_0000184 3300045051 Bacteria 157166
98 Ga0451576_0002793 3300045051 Bacteria 25197
99 Ga0451576_0005965 3300045051 Bacteria 15088
100 Ga0451576_0007560 3300045051 Bacteria 12953
101 Ga0451576_0022950 3300045051 Bacteria 6762
102 Ga0451576_0047451 3300045051 Bacteria 4515
103 Ga0501198_000042 3300049649 Bacteria 45595
104 Ga0501222_000016 3300049662 Bacteria 80046
105 Ga0501280_000225 3300049776 Bacteria 14243
106 2526212924 2526164512 Bacteria 4025691
107 2548847499 2547132512 Bacteria 3416496
108 2891634817 2891633521 Bacteria 4602265
109 2894510672 2894510363 Bacteria 5121143
110 Ga0307508_10114209
111 Ga0213872_10032692
112 Ga0213871_10001578
113 Ga0265324_10000205
114 Ga0265324_10010469
115 Ga0265332_10000016
116 Ga0265332_10000714
117 Ga0265328_10000073
118 Ga0265328_10000093
119 Ga0265328_10001427
120 Ga0265328_10006327
121 Ga0265320_10000891
122 Ga0265325_10002315
123 Ga0265329_10002395
124 Ga0265329_10010991
125 Ga0265331_10000005
126 Ga0265331_10000314
127 Ga0265331_10002638
128 Ga0265331_10004726
129 Ga0265331_10006765
130 Ga0265331_10008303
131 Ga0265327_10000213
132 Ga0265327_10000881
133 Ga0265327_10003315
134 Ga0265327_10005782
135 Ga0265327_10012079
136 Ga0265327_10016441
137 Ga0265327_10030275
138 Ga0265316_10000378
139 Ga0265316_10001619
140 Ga0265316_10051888
141 Ga0265316_10055012
142 Ga0265313_10000245
143 Ga0265313_10005128
144 Ga0316579_10020104
145 Ga0265314_10005537
146 Ga0265314_10057709
147 Ga0265314_10061167
148 Ga0316576_10001822
149 Ga0316576_10011831
150 Ga0316576_10034626
151 Ga0316576_10056960
152 Ga0316578_10004518
153 Ga0316578_10013794
154 Ga0316578_10024784
155 Ga0316578_10037276
156 Ga0316577_10020227
157 Ga0316577_10035914
158 Ga0316583_10002668
159 Ga0316583_10016394
160 Ga0316580_10017023
161 Ga0316593_10001168
162 Ga0316593_10010858
163 Ga0316588_1002776
164 Ga0316574_0019377
165 Ga0316574_0045136
166 Ga0316582_0025731
167 Ga0316582_0039832
168 Ga0316582_0041978
169 Ga0316582_0051380
170 Ga0316582_0111632
171 Ga0316584_0000874
172 Ga0316584_0000917
173 Ga0316584_0004805
174 Ga0316584_0025070
175 Ga0316581_0003267
176 Ga0400486_03830
177 Ga0436360_0226122
178 Ga0436360_1348858
179 Ga0436361_0360172
180 Ga0451577_0000002
181 Ga0451577_0000071
182 Ga0451577_0000114
183 Ga0451577_0000284
184 Ga0451577_0010609
185 Ga0451577_0026240
186 Ga0451577_0090004
187 Ga0453683_0032779
188 Ga0453683_0049925
189 Ga0453684_0000102
190 Ga0453684_0000149
191 Ga0453684_0000163
192 Ga0453684_0000331
193 Ga0453684_0000606
194 Ga0453684_0000778
195 Ga0453684_0003977
196 Ga0453684_0004720
197 Ga0453684_0011958
198 Ga0453684_0028854
199 Ga0453684_0033972
200 Ga0453684_0043373
201 Ga0453684_0074158
202 Ga0453684_0113987
203 Ga0453684_0135909
204 Ga0453684_0202725
205 Ga0451576_0000013
206 Ga0451576_0000184
207 Ga0451576_0002793
208 Ga0451576_0005965
209 Ga0451576_0007560
210 Ga0451576_0022950
211 Ga0451576_0047451
212 Ga0501198_000042
213 Ga0501222_000016
214 Ga0501280_000225
215 2526212924
216 2548847499
217 2891634817
218 2894510672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

15

159

0.98

PF10589

NADH_4Fe-4S

NADH-ubiquinone oxidoreductase-F iron-sulfur binding region

508

592

0.98

PF01512

Complex1_51K

Respiratory-chain NADH dehydrogenase 51 Kd subunit

233

409

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t30-assembly1.cif.gz_G structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/nad(h) bound state 0.9627 194 571
8a5e-assembly1.cif.gz_B cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state 0.9562 208 571
5gup-assembly1.cif.gz_B cryo-em structure of mammalian respiratory supercomplex i1iii2iv1 0.9468 195 571
6g2j-assembly1.cif.gz_F mouse mitochondrial complex i in the active state 0.946 197 569
7ard-assembly1.cif.gz_F cryo-em structure of polytomella complex-i (complete composition) 0.9455 197 570
ID Description Score Start End Superfamily
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9569 70 150 3.40.30.10
3i9v201 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9419 19 70 1.10.10.1590
3iamB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9418 19 70 1.10.10.1590
2fugA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit 0.9374 218 395 3.40.50.11540
af_O94500_78_261_3.40.50.11540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit 0.9372 218 395 3.40.50.11540
ID Description Score Start End GO Terms
AF-A0A3D3NGC9-F1-model_v4 NADP oxidoreductase 0.9946 374 486 GO:0046872
GO:0048038
GO:0051536
AF-A0A3D3NGC9-F1-model_v4 NADP oxidoreductase 0.9774 374 486 GO:0046872
GO:0048038
GO:0051536
AF-A0A661F0F4-F1-model_v4 NADH-quinone oxidoreductase subunit F (NADH dehydrogenase I subunit F) (NDH-1 subunit F) 0.9746 7 521 GO:0008137
GO:0010181
GO:0046872
GO:0048038
GO:0051539
AF-A0A497BKJ0-F1-model_v4 NADH-quinone oxidoreductase subunit F 0.9733 230 570 GO:0046872
GO:0051539
AF-A0A3B9JAR5-F1-model_v4 NADP oxidoreductase 0.9726 230 428 GO:0008137
GO:0010181
GO:0046872
GO:0048038
GO:0051539

Map