F056658

General Info

Members Datasets Scaffolds Average Seq Length
109 86 218 272

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2971410472|2971414608
Length 299
Sequence YEQLTWDYFEIKMGRGCEKGDVQKMSKPLKPIHRSRARIFLGIKAYRLKRYVAWFFDGRKYASHKQTEILPHLASTHRTPLLRQLKDVDMWLQHNKIINLRLATKQLNGVMIQPGETFSYWRLIGKTTRRKGYIDGMVLFHGKVKTGVGGGLCQLSNLIYWMTLHTPLTVTERYRHSYDVFPDAGRSQPFGSGATCYYNYLDLQIGNETQDAYQLVIYVSDTHLIGEWRALTPTLHSYEMYEKNHRITREYWGGYVRHNEIHRRVRNREGQLVRDEWVTDNHAIMMYEPLLRAGDSDNS

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
6 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
7 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
10 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
13 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
14 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
15 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
18 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
19 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
20 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
21 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
22 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
23 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
24 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
25 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
26 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
27 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
28 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
29 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
30 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
31 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
32 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
33 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
34 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
35 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
36 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
37 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
38 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
39 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
40 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
41 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
42 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
43 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
44 2643221729 Bacillus sp. Root11 Isolate Unclassified
45 2643221730 Bacillus sp. Root131 Isolate Unclassified
46 2671180694 Paenibacillus sp. A3 Isolate Unclassified
47 2684622632 Bacillus cereus 905 Isolate Unclassified
48 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
49 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
50 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
51 2818991441 Niallia circulans 3243 Isolate Rhizosphere
52 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
53 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
54 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
55 2857472729 Cohnella sp. R-74144 Isolate Unclassified
56 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
57 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
58 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
59 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
60 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
61 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
62 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
63 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
64 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
65 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
66 2938917290 Bacillus sp. CR71 Isolate Unclassified
67 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
68 2965761152 Bacillus sp. COPE52 Isolate Unclassified
69 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
70 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
71 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
72 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
73 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
74 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
75 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
76 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
77 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
78 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
79 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
80 8022792930 Bacillus sp. Xin Isolate Rhizosphere
81 8023444577 Bacillus sp. BH32 Isolate Unclassified
82 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
83 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
84 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
85 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
86 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 53.21
Metatranscriptomes 0
Isolates 46.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.51
Nodule 1.83
Rhizoplane 1.83
Rhizosphere 43.12
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1003260 3300002987 Bacteria 5815
2 JGI25159J45721_1007689 3300002987 Bacteria 3055
3 JGI25159J45721_1007760 3300002987 Bacteria 3034
4 JGI25151J46595_10001238 3300003187 Bacteria 18180
5 JGI25151J46595_10014048 3300003187 Bacteria 3583
6 JGI25151J46595_10014122 3300003187 Bacteria 3572
7 JGI25151J46595_10016130 3300003187 Bacteria 3273
8 Ga0055538_1000544 3300003751 Bacteria 13171
9 Ga0055532_1000803 3300003758 Bacteria 10827
10 Ga0105251_10045614 3300009011 Bacteria 2112
11 Ga0105244_10006725 3300009036 Bacteria 7397
12 Ga0105244_10041863 3300009036 Bacteria 2372
13 Ga0105244_10049196 3300009036 Bacteria 2155
14 Ga0105244_10072342 3300009036 Bacteria 1718
15 Ga0105244_10085817 3300009036 Bacteria 1553
16 Ga0105244_10126530 3300009036 Bacteria 1235
17 Ga0105250_10002364 3300009092 Bacteria 9530
18 Ga0105250_10024362 3300009092 Bacteria 2438
19 Ga0105246_10000229 3300011119 Bacteria 28651
20 Ga0157380_10606250 3300014326 Bacteria 1084
21 Ga0209784_100222 3300025224 Bacteria 38313
22 Ga0209147_100225 3300025229 Bacteria 56834
23 Ga0209130_1002560 3300025284 Bacteria 8876
24 Ga0209675_1006985 3300025291 Bacteria 4416
25 Ga0209675_1020383 3300025291 Bacteria 1798
26 Ga0209025_1001896 3300025294 Bacteria 24396
27 Ga0209025_1006016 3300025294 Bacteria 9626
28 Ga0209025_1009885 3300025294 Bacteria 6563
29 Ga0207696_1002345 3300025711 Bacteria 9365
30 Ga0207696_1028000 3300025711 Bacteria 1733
31 Ga0207655_1001885 3300025728 Bacteria 18010
32 Ga0207655_1008659 3300025728 Bacteria 6423
33 Ga0207655_1033412 3300025728 Bacteria 2332
34 Ga0265334_10012463 3300028573 Bacteria 3572
35 Ga0237817_10032 3300030083 Bacteria 48966
36 Ga0307513_10292429 3300031456 Bacteria 1400
37 Ga0237819_00106 3300038705 Bacteria 30821
38 Ga0451833_0749918 3300041491 Unclassified 1761
39 Ga0451577_0000007 3300042876 Bacteria 694123
40 Ga0453684_0000094 3300044712 Bacteria 382117
41 Ga0453684_0000552 3300044712 Bacteria 141495
42 Ga0466967_0016340 3300045976 Bacteria 5850
43 Ga0495670_0167115 3300046691 Bacteria 1158
44 Ga0495649_0075060 3300046694 Bacteria 1811
45 Ga0496110_0010905 3300048913 Bacteria 7411
46 Ga0496116_0004322 3300048919 Bacteria 13592
47 Ga0496116_0004686 3300048919 Bacteria 12931
48 Ga0496116_0009803 3300048919 Bacteria 8119
49 Ga0496118_0141512 3300048921 Bacteria 1524
50 Ga0496121_0271211 3300048924 Bacteria 1166
51 Ga0496122_0014027 3300048925 Bacteria 7782
52 Ga0496122_0038600 3300048925 Bacteria 3822
53 Ga0496122_0094173 3300048925 Bacteria 2029
54 Ga0496123_0022127 3300048926 Bacteria 4911
55 Ga0496124_0002307 3300048927 Bacteria 25186
56 Ga0496124_0056945 3300048927 Bacteria 3295
57 Ga0496125_0010942 3300048928 Bacteria 9118
58 nmdc:mga07m45_18049_c1 3300050496 Bacteria 3800
59 2971414608 2971410472 Bacteria 8311090
60 2511177026 2510917027 Bacteria 5287437
61 2512636304 2512564013 Bacteria 6286191
62 2512735706 2512564039 Bacteria 8739048
63 2524189702 2524023129 Bacteria 6762600
64 2587742954 2585428059 Bacteria 8696589
65 2601638101 2600255286 Bacteria 5390125
66 2644424971 2643221676 Bacteria 8119172
67 2644702059 2643221729 Bacteria 6621700
68 2644710976 2643221730 Bacteria 6523787
69 2673819785 2671180694 Bacteria 7506943
70 2685150944 2684622632 Bacteria 5380049
71 2698322310 2695420987 Bacteria 6152737
72 2721506197 2718218445 Bacteria 5113413
73 2738838904 2738541299 Bacteria 4020721
74 2819568271 2818991441 Bacteria 5062707
75 2819580023 2818991443 Bacteria 6598732
76 2857455517 2857453340 Bacteria 8090534
77 2857461051 2857460504 Bacteria 5194327
78 2857478542 2857472729 Bacteria 6568124
79 2864737051 2864733723 Bacteria 6770668
80 2865005368 2865002811 Bacteria 6333767
81 2881637750 2881636855 Bacteria 5205297
82 2898908256 2898907183 Bacteria 4067722
83 2915599227 2915597211 Bacteria 6475886
84 2915608838 2915606848 Bacteria 6032732
85 2928512949 2928510474 Bacteria 4815308
86 2929184377 2929183550 Bacteria 6377511
87 2929236641 2929233124 Bacteria 5948380
88 2938655438 2938649242 Bacteria 7118381
89 2938920562 2938917290 Bacteria 5914775
90 2947429669 2947426588 Bacteria 5357194
91 2965764188 2965761152 Bacteria 5806513
92 2968559477 2968558590 Bacteria 6956864
93 2971404174 2971403814 Bacteria 7370929
94 2971516138 2971511577 Bacteria 5404012
95 2979086619 2979083700 Bacteria 5894929
96 2988231231 2988225383 Bacteria 7221625
97 2996634664 2996632988 Bacteria 6921523
98 3006975449 3006973921 Bacteria 4423788
99 3006992468 3006988479 Bacteria 4767936
100 8007372352 8007371054 Bacteria 4849201
101 8007377802 8007375930 Bacteria 4080554
102 8022622976 8022621104 Bacteria 5241040
103 8022795678 8022792930 Bacteria 5693794
104 8023445948 8023444577 Bacteria 5661597
105 8054800488 8054795415 Bacteria 9785225
106 8055633198 8055632911 Bacteria 5283357
107 8056533433 8056533031 Bacteria 8964429
108 8057584661 8057582654 Bacteria 5218944
109 8057733695 8057733483 Bacteria 6578323
110 JGI25159J45721_1003260
111 JGI25159J45721_1007689
112 JGI25159J45721_1007760
113 JGI25151J46595_10001238
114 JGI25151J46595_10014048
115 JGI25151J46595_10014122
116 JGI25151J46595_10016130
117 Ga0055538_1000544
118 Ga0055532_1000803
119 Ga0105251_10045614
120 Ga0105244_10006725
121 Ga0105244_10041863
122 Ga0105244_10049196
123 Ga0105244_10072342
124 Ga0105244_10085817
125 Ga0105244_10126530
126 Ga0105250_10002364
127 Ga0105250_10024362
128 Ga0105246_10000229
129 Ga0157380_10606250
130 Ga0209784_100222
131 Ga0209147_100225
132 Ga0209130_1002560
133 Ga0209675_1006985
134 Ga0209675_1020383
135 Ga0209025_1001896
136 Ga0209025_1006016
137 Ga0209025_1009885
138 Ga0207696_1002345
139 Ga0207696_1028000
140 Ga0207655_1001885
141 Ga0207655_1008659
142 Ga0207655_1033412
143 Ga0265334_10012463
144 Ga0237817_10032
145 Ga0307513_10292429
146 Ga0237819_00106
147 Ga0451833_0749918
148 Ga0451577_0000007
149 Ga0453684_0000094
150 Ga0453684_0000552
151 Ga0466967_0016340
152 Ga0495670_0167115
153 Ga0495649_0075060
154 Ga0496110_0010905
155 Ga0496116_0004322
156 Ga0496116_0004686
157 Ga0496116_0009803
158 Ga0496118_0141512
159 Ga0496121_0271211
160 Ga0496122_0014027
161 Ga0496122_0038600
162 Ga0496122_0094173
163 Ga0496123_0022127
164 Ga0496124_0002307
165 Ga0496124_0056945
166 Ga0496125_0010942
167 nmdc:mga07m45_18049_c1
168 2971414608
169 2511177026
170 2512636304
171 2512735706
172 2524189702
173 2587742954
174 2601638101
175 2644424971
176 2644702059
177 2644710976
178 2673819785
179 2685150944
180 2698322310
181 2721506197
182 2738838904
183 2819568271
184 2819580023
185 2857455517
186 2857461051
187 2857478542
188 2864737051
189 2865005368
190 2881637750
191 2898908256
192 2915599227
193 2915608838
194 2928512949
195 2929184377
196 2929236641
197 2938655438
198 2938920562
199 2947429669
200 2965764188
201 2968559477
202 2971404174
203 2971516138
204 2979086619
205 2988231231
206 2996634664
207 3006975449
208 3006992468
209 8007372352
210 8007377802
211 8022622976
212 8022795678
213 8023445948
214 8054800488
215 8055633198
216 8056533433
217 8057584661
218 8057733695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04294

VanW

VanW like protein

95

229

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uv2-assembly2.cif.gz_O structure of the curli transport lipoprotein csgg in a non-lipidated, pre-pore conformation 0.6838 208 261
4uv2-assembly2.cif.gz_M structure of the curli transport lipoprotein csgg in a non-lipidated, pre-pore conformation 0.6791 208 261
5bka-assembly2.cif.gz_E 2.1 angstrom structure of actvi-orfa from streptomyces coelicolor 0.6417 213 261
5bka-assembly2.cif.gz_F 2.1 angstrom structure of actvi-orfa from streptomyces coelicolor 0.6325 213 261
1ue1-assembly1.cif.gz_A-2 crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis 0.6306 213 260
ID Description Score Start End Superfamily
af_G2HK10_116_242_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.8141 186 207 3.80.10.10
4kqdB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6662 184 207 3.30.450.20
af_Q9VRL8_115_183_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6579 217 244 3.30.160.20
af_A0A0R0GAI4_122_194_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6334 235 260 3.30.420.10
af_Q9VJ95_90_378_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6282 212 262 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A4U3B041-F1-model_v4 deleted 0.9364 1 159
AF-A0A358U869-F1-model_v4 Vancomycin resistance protein 0.9323 17 275
AF-A0A4U3B041-F1-model_v4 deleted 0.9306 1 159
AF-R9CAJ8-F1-model_v4 Vancomycin B-type resistance protein 0.925 8 269
AF-V6T3C8-F1-model_v4 deleted 0.9249 6 227

Map