F051079

General Info

Members Datasets Scaffolds Average Seq Length
108 46 108 281

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_276009_c1|nmdc:mga09592_276009_c1_38_982
Length 314
Sequence MLTDTHCHLDFNKFDEDREAVIQRALEAGVRRILIPALDWESGVAAIKLAESHPNIFAAVGFHPTDLDKWNEKSVEDLQSLATTSYVTLSRAKGLVRDKRDSSVASLPHTVSASFRENDRINKVVAIGEIGLDYYWVKEPEKRAQQCEVLKQQLQLAQDMNKPTIIHMREENDAWFGQASVDLLEILAEWHESLHAQKHPLAERPGVLHSFNGNLDTAQKAIALNFYIGVTGPVTYKNAEEKRQIIRQLPLEQILIETDSPFLTPVPHRGKRNEPAFVAYIADKIAEIHNTTREQVARVTSQNANRLFGWEANF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
29 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
30 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
31 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
32 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
33 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
34 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
35 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
36 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
37 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
38 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
39 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
40 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
41 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
42 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
43 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
44 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
45 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
46 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1443035 2162886007 Unclassified 3682
2 SwRhRL2b_contig_494012 2162886007 Bacteria 10076
3 JGI25406J46586_10014250 3300003203 Bacteria 3386
4 JGI25406J46586_10044351 3300003203 Bacteria 1540
5 Ga0065704_10000443 3300005289 Bacteria 21010
6 Ga0065704_10137449 3300005289 Bacteria 1555
7 Ga0065707_10082128 3300005295 Bacteria 21253
8 Ga0065707_10085469 3300005295 Bacteria 6132
9 Ga0065707_10092170 3300005295 Bacteria 3814
10 Ga0065707_10126287 3300005295 Bacteria 2006
11 Ga0070706_100107484 3300005467 Bacteria 2595
12 Ga0070706_100332395 3300005467 Bacteria 1417
13 Ga0070707_100229185 3300005468 Unclassified 1809
14 Ga0070698_100011867 3300005471 Bacteria 9242
15 Ga0070698_100230534 3300005471 Bacteria 1785
16 Ga0070699_100001393 3300005518 Bacteria 22220
17 Ga0070699_100007965 3300005518 Bacteria 9200
18 Ga0070697_100284041 3300005536 Bacteria 1420
19 Ga0070695_100384419 3300005545 Unclassified 1060
20 Ga0068858_100287932 3300005842 Bacteria 1565
21 Ga0068862_100024227 3300005844 Bacteria 5091
22 Ga0068862_100223710 3300005844 Unclassified 1705
23 Ga0081539_10002751 3300005985 Bacteria 23695
24 Ga0081539_10025017 3300005985 Unclassified 3857
25 Ga0075428_100050497 3300006844 Unclassified 4561
26 Ga0075428_100075783 3300006844 Bacteria 3673
27 Ga0075430_100121466 3300006846 Bacteria 2178
28 Ga0075431_100058902 3300006847 Bacteria 3963
29 Ga0075433_10050462 3300006852 Bacteria 3622
30 Ga0075433_10388486 3300006852 Unclassified 1232
31 Ga0075429_100002777 3300006880 Bacteria 14800
32 Ga0075429_100012208 3300006880 Bacteria 7447
33 Ga0075429_100247847 3300006880 Bacteria 1560
34 Ga0075429_100388422 3300006880 Unclassified 1222
35 Ga0105247_10154751 3300009101 Unclassified 1514
36 Ga0114129_10007321 3300009147 Bacteria 15707
37 Ga0114129_10014438 3300009147 Bacteria 11256
38 Ga0114129_10114771 3300009147 Unclassified 3713
39 Ga0114129_10116221 3300009147 Bacteria 3686
40 Ga0114129_10128817 3300009147 Bacteria 3478
41 Ga0105241_10307135 3300009174 Bacteria 1363
42 Ga0105249_10199409 3300009553 Unclassified 1958
43 Ga0105249_10590761 3300009553 Bacteria 1164
44 Ga0105246_10179253 3300011119 Bacteria 1630
45 Ga0207684_10178717 3300025910 Bacteria 1830
46 Ga0207712_10183707 3300025961 Unclassified 1645
47 Ga0207708_10064918 3300026075 Bacteria 2790
48 Ga0207674_10074904 3300026116 Bacteria 3396
49 Ga0209968_1005857 3300027526 Bacteria 1848
50 Ga0307407_10234783 3300031903 Bacteria 1248
51 Ga0307412_10197541 3300031911 Unclassified 1525
52 Ga0307409_100377920 3300031995 Bacteria 1346
53 Ga0307415_100160775 3300032126 Bacteria 1741
54 Ga0451577_0005632 3300042876 Bacteria 12727
55 Ga0451577_0007092 3300042876 Bacteria 11051
56 Ga0451577_0013772 3300042876 Bacteria 7558
57 Ga0451577_0052739 3300042876 Bacteria 3632
58 Ga0451577_0205381 3300042876 Bacteria 1779
59 Ga0451577_0409096 3300042876 Bacteria 1231
60 Ga0451577_0583499 3300042876 Unclassified 1015
61 Ga0453683_0000916 3300044673 Bacteria 28160
62 Ga0453683_0015323 3300044673 Bacteria 4965
63 Ga0453683_0063583 3300044673 Unclassified 2307
64 Ga0453683_0259154 3300044673 Unclassified 1109
65 Ga0453684_0000344 3300044712 Bacteria 192860
66 Ga0453684_0001633 3300044712 Bacteria 61052
67 Ga0453684_0003255 3300044712 Bacteria 37120
68 Ga0453684_0005739 3300044712 Bacteria 24257
69 Ga0453684_0012564 3300044712 Bacteria 13939
70 Ga0453684_0023341 3300044712 Bacteria 9120
71 Ga0453684_0032694 3300044712 Bacteria 7271
72 Ga0453684_0037765 3300044712 Bacteria 6623
73 Ga0453684_0068552 3300044712 Bacteria 4504
74 Ga0453684_0082541 3300044712 Bacteria 4003
75 Ga0453684_0174092 3300044712 Unclassified 2533
76 Ga0453684_0205549 3300044712 Bacteria 2292
77 Ga0453684_0330180 3300044712 Bacteria 1725
78 Ga0453684_0377294 3300044712 Unclassified 1593
79 Ga0453684_0676897 3300044712 Unclassified 1123
80 Ga0453684_0743458 3300044712 Bacteria 1062
81 Ga0453684_0760938 3300044712 Bacteria 1048
82 Ga0451576_0038717 3300045051 Bacteria 5046
83 Ga0451576_0061475 3300045051 Bacteria 3916
84 Ga0451576_0079161 3300045051 Bacteria 3420
85 Ga0451576_0140010 3300045051 Bacteria 2523
86 Ga0451576_0141700 3300045051 Bacteria 2506
87 Ga0501040_0226816 3300049576 Bacteria 1330
88 Ga0501075_0033569 3300049591 Bacteria 3818
89 Ga0501076_0208823 3300049592 Unclassified 1595
90 Ga0501081_0038163 3300049743 Bacteria 3280
91 nmdc:mga05p37_114721_c1 3300050507 Unclassified 3312
92 nmdc:mga05p37_116223_c2 3300050507 Unclassified 2241
93 nmdc:mga05p37_17099_c1 3300050507 Bacteria 8749
94 nmdc:mga05p37_346277_c1 3300050507 Unclassified 1751
95 nmdc:mga05p37_79886_c1 3300050507 Bacteria 4027
96 nmdc:mga05p37_8598_c1 3300050507 Bacteria 12072
97 nmdc:mga09592_103053_c1 3300050508 Bacteria 2445
98 nmdc:mga09592_115699_c1 3300050508 Bacteria 2301
99 nmdc:mga09592_175119_c1 3300050508 Bacteria 1855
100 nmdc:mga09592_276009_c1 3300050508 Unclassified 1458
101 nmdc:mga09592_4971_c1 3300050508 Bacteria 10774
102 nmdc:mga09592_50276_c1 3300050508 Bacteria 3516
103 nmdc:mga09592_555628_c1 3300050508 Bacteria 986
104 nmdc:mga0qj67_99063_c1 3300050509 Bacteria 2348
105 nmdc:mga06r32_60764_c1 3300050510 Bacteria 3637
106 nmdc:mga0a205_25089_c1 3300050515 Bacteria 5676
107 nmdc:mga0a205_368067_c1 3300050515 Unclassified 1303
108 Ga0501084_0080656 3300054114 Bacteria 2729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0032694 Ga0453684_0032694_3799_4668 268
2 3300042876 Ga0451577_0005632 Ga0451577_0005632_10333_11151 270
3 3300042876 Ga0451577_0007092 Ga0451577_0007092_621_1439 270
4 3300042876 Ga0451577_0205381 Ga0451577_0205381_615_1436 270
5 3300042876 Ga0451577_0583499 Ga0451577_0583499_100_921 270
6 3300044673 Ga0453683_0000916 Ga0453683_0000916_13809_14630 270
7 3300044673 Ga0453683_0015323 Ga0453683_0015323_343_1164 270
8 3300044673 Ga0453683_0259154 Ga0453683_0259154_194_1015 270
9 3300044712 Ga0453684_0000344 Ga0453684_0000344_67767_68588 270
10 3300044712 Ga0453684_0001633 Ga0453684_0001633_33044_33865 270
11 3300044712 Ga0453684_0003255 Ga0453684_0003255_305_1126 270
12 3300044712 Ga0453684_0005739 Ga0453684_0005739_11436_12257 270
13 3300044712 Ga0453684_0012564 Ga0453684_0012564_1647_2465 270
14 3300044712 Ga0453684_0023341 Ga0453684_0023341_5434_6255 270
15 3300044712 Ga0453684_0037765 Ga0453684_0037765_1431_2249 270
16 3300044712 Ga0453684_0174092 Ga0453684_0174092_1184_2005 270
17 3300044712 Ga0453684_0205549 Ga0453684_0205549_1117_1938 270
18 3300044712 Ga0453684_0377294 Ga0453684_0377294_209_1030 270
19 3300044712 Ga0453684_0676897 Ga0453684_0676897_16_834 270
20 3300044712 Ga0453684_0743458 Ga0453684_0743458_206_1027 270
21 3300044712 Ga0453684_0760938 Ga0453684_0760938_80_898 270
22 3300045051 Ga0451576_0038717 Ga0451576_0038717_1067_1888 270
23 3300045051 Ga0451576_0079161 Ga0451576_0079161_959_1777 270
24 3300045051 Ga0451576_0141700 Ga0451576_0141700_1603_2421 270
25 2162886007 SwRhRL2b_contig_1443035 SwRhRL2b_0255.00000310 273
26 2162886007 SwRhRL2b_contig_494012 SwRhRL2b_0846.00006210 273
27 3300003203 JGI25406J46586_10014250 JGI25406J46586_100142504 273
28 3300003203 JGI25406J46586_10044351 JGI25406J46586_100443512 273
29 3300005289 Ga0065704_10000443 Ga0065704_1000044318 273
30 3300005289 Ga0065704_10137449 Ga0065704_101374492 273
31 3300005295 Ga0065707_10082128 Ga0065707_1008212818 273
32 3300005295 Ga0065707_10085469 Ga0065707_100854695 273
33 3300005295 Ga0065707_10092170 Ga0065707_100921704 273
34 3300005295 Ga0065707_10126287 Ga0065707_101262871 273
35 3300005467 Ga0070706_100107484 Ga0070706_1001074842 273
36 3300005467 Ga0070706_100332395 Ga0070706_1003323951 273
37 3300005468 Ga0070707_100229185 Ga0070707_1002291852 273
38 3300005471 Ga0070698_100011867 Ga0070698_1000118677 273
39 3300005471 Ga0070698_100230534 Ga0070698_1002305342 273
40 3300005518 Ga0070699_100001393 Ga0070699_10000139324 273
41 3300005518 Ga0070699_100007965 Ga0070699_1000079659 273
42 3300005536 Ga0070697_100284041 Ga0070697_1002840412 273
43 3300005545 Ga0070695_100384419 Ga0070695_1003844191 273
44 3300005842 Ga0068858_100287932 Ga0068858_1002879322 273
45 3300005844 Ga0068862_100024227 Ga0068862_1000242272 273
46 3300005844 Ga0068862_100223710 Ga0068862_1002237102 273
47 3300005985 Ga0081539_10002751 Ga0081539_100027515 273
48 3300005985 Ga0081539_10025017 Ga0081539_100250174 273
49 3300006844 Ga0075428_100050497 Ga0075428_1000504972 273
50 3300006844 Ga0075428_100075783 Ga0075428_1000757835 273
51 3300006846 Ga0075430_100121466 Ga0075430_1001214661 273
52 3300006847 Ga0075431_100058902 Ga0075431_1000589024 273
53 3300006852 Ga0075433_10050462 Ga0075433_100504622 273
54 3300006852 Ga0075433_10388486 Ga0075433_103884862 273
55 3300006880 Ga0075429_100002777 Ga0075429_1000027775 273
56 3300006880 Ga0075429_100012208 Ga0075429_1000122082 273
57 3300006880 Ga0075429_100247847 Ga0075429_1002478472 273
58 3300006880 Ga0075429_100388422 Ga0075429_1003884221 273
59 3300009101 Ga0105247_10154751 Ga0105247_101547511 273
60 3300009147 Ga0114129_10007321 Ga0114129_100073216 273
61 3300009147 Ga0114129_10014438 Ga0114129_100144387 273
62 3300009147 Ga0114129_10114771 Ga0114129_101147714 273
63 3300009147 Ga0114129_10116221 Ga0114129_101162212 273
64 3300009147 Ga0114129_10128817 Ga0114129_101288173 273
65 3300009174 Ga0105241_10307135 Ga0105241_103071352 273
66 3300009553 Ga0105249_10199409 Ga0105249_101994092 273
67 3300009553 Ga0105249_10590761 Ga0105249_105907611 273
68 3300011119 Ga0105246_10179253 Ga0105246_101792532 273
69 3300025910 Ga0207684_10178717 Ga0207684_101787173 273
70 3300025961 Ga0207712_10183707 Ga0207712_101837072 273
71 3300026075 Ga0207708_10064918 Ga0207708_100649182 273
72 3300026116 Ga0207674_10074904 Ga0207674_100749045 273
73 3300027526 Ga0209968_1005857 Ga0209968_10058572 273
74 3300031903 Ga0307407_10234783 Ga0307407_102347831 273
75 3300031911 Ga0307412_10197541 Ga0307412_101975412 273
76 3300031995 Ga0307409_100377920 Ga0307409_1003779202 273
77 3300032126 Ga0307415_100160775 Ga0307415_1001607752 273
78 3300042876 Ga0451577_0013772 Ga0451577_0013772_892_1803 273
79 3300042876 Ga0451577_0052739 Ga0451577_0052739_342_1220 273
80 3300042876 Ga0451577_0409096 Ga0451577_0409096_71_901 273
81 3300044673 Ga0453683_0063583 Ga0453683_0063583_163_1017 273
82 3300044712 Ga0453684_0068552 Ga0453684_0068552_3252_4130 273
83 3300044712 Ga0453684_0082541 Ga0453684_0082541_1751_2683 273
84 3300044712 Ga0453684_0330180 Ga0453684_0330180_594_1421 273
85 3300045051 Ga0451576_0061475 Ga0451576_0061475_1662_2540 273
86 3300045051 Ga0451576_0140010 Ga0451576_0140010_297_1118 273
87 3300049576 Ga0501040_0226816 Ga0501040_0226816_89_925 273
88 3300049591 Ga0501075_0033569 Ga0501075_0033569_2079_2915 273
89 3300049592 Ga0501076_0208823 Ga0501076_0208823_744_1577 273
90 3300049743 Ga0501081_0038163 Ga0501081_0038163_1269_2105 273
91 3300050507 nmdc:mga05p37_114721_c1 nmdc:mga05p37_114721_c1_1773_2594 273
92 3300050507 nmdc:mga05p37_116223_c2 nmdc:mga05p37_116223_c2_274_1137 273
93 3300050507 nmdc:mga05p37_17099_c1 nmdc:mga05p37_17099_c1_273_1106 273
94 3300050507 nmdc:mga05p37_346277_c1 nmdc:mga05p37_346277_c1_517_1437 273
95 3300050507 nmdc:mga05p37_79886_c1 nmdc:mga05p37_79886_c1_1464_2324 273
96 3300050507 nmdc:mga05p37_8598_c1 nmdc:mga05p37_8598_c1_6698_7576 273
97 3300050508 nmdc:mga09592_103053_c1 nmdc:mga09592_103053_c1_693_1571 273
98 3300050508 nmdc:mga09592_115699_c1 nmdc:mga09592_115699_c1_966_1799 273
99 3300050508 nmdc:mga09592_175119_c1 nmdc:mga09592_175119_c1_450_1310 273
100 3300050508 nmdc:mga09592_276009_c1 nmdc:mga09592_276009_c1_38_982 273
101 3300050508 nmdc:mga09592_4971_c1 nmdc:mga09592_4971_c1_8809_9642 273
102 3300050508 nmdc:mga09592_50276_c1 nmdc:mga09592_50276_c1_768_1649 273
103 3300050508 nmdc:mga09592_555628_c1 nmdc:mga09592_555628_c1_131_964 273
104 3300050509 nmdc:mga0qj67_99063_c1 nmdc:mga0qj67_99063_c1_127_1008 273
105 3300050510 nmdc:mga06r32_60764_c1 nmdc:mga06r32_60764_c1_972_1853 273
106 3300050515 nmdc:mga0a205_25089_c1 nmdc:mga0a205_25089_c1_3691_4596 273
107 3300050515 nmdc:mga0a205_368067_c1 nmdc:mga0a205_368067_c1_234_1055 273
108 3300054114 Ga0501084_0080656 Ga0501084_0080656_1452_2288 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

3

92

0.96

PF01026

TatD_DNase

TatD related DNase

100

309

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6o-assembly1.cif.gz_A crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution 0.9482 2 269
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9429 2 269
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9356 2 269
1zzm-assembly1.cif.gz_A crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution 0.9334 2 270
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9211 2 270
ID Description Score Start End Superfamily
1j6oA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9475 2 269 3.20.20.140
af_P39408_1_259_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9426 2 271 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9397 2 269 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9323 2 269 3.20.20.140
af_P0AFQ7_2_265_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9231 1 271 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A3D0RR16-F1-model_v4 Hydrolase TatD 0.9971 1 157 GO:0005829
GO:0016788
AF-A0A399ZDX0-F1-model_v4 Hydrolase TatD 0.9859 2 271 GO:0004536
GO:0005829
GO:0046872
AF-A0A7C3LNG8-F1-model_v4 TatD family deoxyribonuclease 0.985 2 273 GO:0004536
GO:0046872
AF-A0A3D0RR16-F1-model_v4 Hydrolase TatD 0.9784 1 157 GO:0005829
GO:0016788
AF-A0A7C3LNG8-F1-model_v4 TatD family deoxyribonuclease 0.9778 2 273 GO:0004536
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.79 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map