F049616

General Info

Members Datasets Scaffolds Average Seq Length
108 94 216 160

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101723838|Ga0307416_1017238382
Length 179
Sequence MPHPVDVTFPSDREVRVTRVFDAPRELIFEAHTEAGLVRRWMLGPDGWTMPICDIDLRVGGQYRYVWRNDADGSEFGFRGEYHEIVAPGRIVHTERPDGPEGDAVEAALCTLVLTEQGGRTTLTHTMRFATPELRDQVVATGMTDGMATSYDRLETILEGARGVPTVAAGRPPAVAHGG

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
61 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
62 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
63 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
68 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
72 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
73 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
74 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
75 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
76 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
77 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
78 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
79 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
80 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
83 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
84 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
85 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
86 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
87 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
91 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
94 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.63
Nodule 0
Rhizoplane 0
Rhizosphere 87.96
Stem 0
Stem Tuber 0
Unclassified 10.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_101723838 3300032002 Bacteria 731
2 rootL2_10013128 3300003322 Bacteria 7307
3 Ga0070683_100036061 3300005329 Unclassified 4524
4 Ga0070670_101065404 3300005331 Bacteria 736
5 Ga0068869_100657333 3300005334 Bacteria 890
6 Ga0070691_10025229 3300005341 Bacteria 2768
7 Ga0070667_100191649 3300005367 Bacteria 1811
8 Ga0070701_10063815 3300005438 Bacteria 1950
9 Ga0070711_100061173 3300005439 Bacteria 2621
10 Ga0070708_100431993 3300005445 Bacteria 1242
11 Ga0070681_10192551 3300005458 Bacteria 1959
12 Ga0070698_100460703 3300005471 Unclassified 1207
13 Ga0070693_100607768 3300005547 Bacteria 790
14 Ga0068855_100797616 3300005563 Bacteria 1004
15 Ga0068857_101309651 3300005577 Unclassified 703
16 Ga0068859_101029230 3300005617 Unclassified 905
17 Ga0068860_100001146 3300005843 Bacteria 29082
18 Ga0081455_10000045 3300005937 Bacteria 128603
19 Ga0075368_10069526 3300006042 Bacteria 1420
20 Ga0075363_100038451 3300006048 Bacteria 2516
21 Ga0075428_100661536 3300006844 Bacteria 1114
22 Ga0075430_100003469 3300006846 Bacteria 13195
23 Ga0075433_10351170 3300006852 Bacteria 1303
24 Ga0075434_100037602 3300006871 Bacteria 4792
25 Ga0075434_100047555 3300006871 Bacteria 4257
26 Ga0075434_100920456 3300006871 Bacteria 889
27 Ga0075435_100286171 3300007076 Unclassified 1407
28 Ga0099794_10069635 3300007265 Unclassified 1721
29 Ga0111539_10048789 3300009094 Bacteria 5052
30 Ga0111539_11079675 3300009094 Bacteria 933
31 Ga0105245_10137754 3300009098 Bacteria 2295
32 Ga0105248_10791709 3300009177 Bacteria 1070
33 Ga0105237_10803095 3300009545 Bacteria 948
34 Ga0105239_12038250 3300010375 Bacteria 666
35 Ga0157371_10005588 3300013102 Bacteria 10562
36 Ga0157369_11120687 3300013105 Bacteria 804
37 Ga0157380_10125870 3300014326 Bacteria 2178
38 Ga0157377_10000222 3300014745 Bacteria 29706
39 Ga0157377_10331786 3300014745 Bacteria 1014
40 Ga0157379_10092155 3300014968 Bacteria 2718
41 Ga0213876_10032258 3300021384 Bacteria 2763
42 Ga0213875_10063897 3300021388 Bacteria 1720
43 Ga0207643_10055433 3300025908 Bacteria 2254
44 Ga0207650_10260911 3300025925 Bacteria 1405
45 Ga0207650_10278922 3300025925 Bacteria 1360
46 Ga0207650_11105848 3300025925 Unclassified 674
47 Ga0207687_10084926 3300025927 Bacteria 2295
48 Ga0207711_10743685 3300025941 Bacteria 914
49 Ga0207689_10157651 3300025942 Bacteria 1871
50 Ga0207658_10017472 3300025986 Bacteria 4944
51 Ga0209588_1001869 3300027671 Bacteria 5626
52 Ga0209588_1027800 3300027671 Unclassified 1800
53 Ga0209813_10211740 3300027866 Bacteria 722
54 Ga0268265_10109729 3300028380 Bacteria 2250
55 Ga0268265_10791761 3300028380 Bacteria 923
56 Ga0268264_10000155 3300028381 Bacteria 156029
57 Ga0265319_1104610 3300028563 Unclassified 887
58 Ga0265332_10082895 3300031238 Bacteria 1359
59 Ga0265320_10226839 3300031240 Unclassified 831
60 Ga0265331_10146013 3300031250 Bacteria 1075
61 Ga0265314_10006736 3300031711 Bacteria 10086
62 Ga0265314_10334166 3300031711 Bacteria 839
63 Ga0307410_11014633 3300031852 Bacteria 716
64 Ga0395899_0112809 3300037312 Bacteria 1953
65 Ga0395900_0116486 3300037418 Bacteria 2742
66 Ga0395905_0027791 3300037471 Bacteria 5333
67 Ga0436364_0986227 3300037853 Bacteria 6862
68 Ga0436365_0051488 3300039437 Bacteria 2873
69 Ga0436361_0587867 3300039447 Bacteria 1774
70 Ga0439438_047429 3300041405 Bacteria 1101
71 Ga0451841_0999689 3300041498 Bacteria 629
72 Ga0451843_1684149 3300041509 Unclassified 651
73 Ga0466964_0015389 3300044706 Bacteria 2911
74 Ga0453684_0454117 3300044712 Bacteria 1426
75 Ga0466967_0033325 3300045976 Bacteria 4358
76 Ga0495611_0007650 3300046648 Bacteria 4587
77 Ga0495681_0198166 3300047470 Bacteria 816
78 Ga0501034_0064361 3300049571 Bacteria 3681
79 Ga0501047_0095539 3300049581 Bacteria 2851
80 Ga0501067_0004008 3300049583 Bacteria 8128
81 Ga0501068_0017457 3300049584 Bacteria 4151
82 Ga0501069_0024799 3300049585 Bacteria 3274
83 Ga0501070_0194827 3300049586 Bacteria 1664
84 Ga0501070_0985834 3300049586 Bacteria 654
85 Ga0501071_0005253 3300049587 Bacteria 8301
86 Ga0501072_0091027 3300049588 Bacteria 2421
87 Ga0501073_0007442 3300049589 Bacteria 8139
88 Ga0501074_0068788 3300049590 Bacteria 2545
89 Ga0501077_0011606 3300049593 Bacteria 5506
90 Ga0501079_0058312 3300049741 Bacteria 2979
91 Ga0501080_0010445 3300049742 Bacteria 8499
92 Ga0501081_0866398 3300049743 Bacteria 681
93 Ga0501083_0104574 3300049744 Bacteria 1865
94 Ga0501083_0249783 3300049744 Bacteria 1155
95 Ga0501044_1017838 3300049823 Bacteria 700
96 nmdc:mga03n38_198420_c1 3300050490 Bacteria 1037
97 nmdc:mga06z11_118553_c1 3300050494 Bacteria 1474
98 nmdc:mga0qj67_147541_c1 3300050509 Bacteria 1907
99 nmdc:mga0qj67_324994_c1 3300050509 Bacteria 1245
100 nmdc:mga06r32_593191_c1 3300050510 Bacteria 1079
101 nmdc:mga0n895_1333897_c1 3300050512 Bacteria 687
102 nmdc:mga0n895_315516_c1 3300050512 Bacteria 1584
103 nmdc:mga0n895_63187_c1 3300050512 Bacteria 3661
104 nmdc:mga0rr50_133984_c1 3300050513 Bacteria 1987
105 nmdc:mga0a205_340294_c1 3300050515 Bacteria 1369
106 Ga0501084_1240437 3300054114 Bacteria 625
107 Ga0501082_0036144 3300060353 Bacteria 4256
108 2870790659 2870782633 Bacteria 9624083
109 Ga0307416_101723838
110 rootL2_10013128
111 Ga0070683_100036061
112 Ga0070670_101065404
113 Ga0068869_100657333
114 Ga0070691_10025229
115 Ga0070667_100191649
116 Ga0070701_10063815
117 Ga0070711_100061173
118 Ga0070708_100431993
119 Ga0070681_10192551
120 Ga0070698_100460703
121 Ga0070693_100607768
122 Ga0068855_100797616
123 Ga0068857_101309651
124 Ga0068859_101029230
125 Ga0068860_100001146
126 Ga0081455_10000045
127 Ga0075368_10069526
128 Ga0075363_100038451
129 Ga0075428_100661536
130 Ga0075430_100003469
131 Ga0075433_10351170
132 Ga0075434_100037602
133 Ga0075434_100047555
134 Ga0075434_100920456
135 Ga0075435_100286171
136 Ga0099794_10069635
137 Ga0111539_10048789
138 Ga0111539_11079675
139 Ga0105245_10137754
140 Ga0105248_10791709
141 Ga0105237_10803095
142 Ga0105239_12038250
143 Ga0157371_10005588
144 Ga0157369_11120687
145 Ga0157380_10125870
146 Ga0157377_10000222
147 Ga0157377_10331786
148 Ga0157379_10092155
149 Ga0213876_10032258
150 Ga0213875_10063897
151 Ga0207643_10055433
152 Ga0207650_10260911
153 Ga0207650_10278922
154 Ga0207650_11105848
155 Ga0207687_10084926
156 Ga0207711_10743685
157 Ga0207689_10157651
158 Ga0207658_10017472
159 Ga0209588_1001869
160 Ga0209588_1027800
161 Ga0209813_10211740
162 Ga0268265_10109729
163 Ga0268265_10791761
164 Ga0268264_10000155
165 Ga0265319_1104610
166 Ga0265332_10082895
167 Ga0265320_10226839
168 Ga0265331_10146013
169 Ga0265314_10006736
170 Ga0265314_10334166
171 Ga0307410_11014633
172 Ga0395899_0112809
173 Ga0395900_0116486
174 Ga0395905_0027791
175 Ga0436364_0986227
176 Ga0436365_0051488
177 Ga0436361_0587867
178 Ga0439438_047429
179 Ga0451841_0999689
180 Ga0451843_1684149
181 Ga0466964_0015389
182 Ga0453684_0454117
183 Ga0466967_0033325
184 Ga0495611_0007650
185 Ga0495681_0198166
186 Ga0501034_0064361
187 Ga0501047_0095539
188 Ga0501067_0004008
189 Ga0501068_0017457
190 Ga0501069_0024799
191 Ga0501070_0194827
192 Ga0501070_0985834
193 Ga0501071_0005253
194 Ga0501072_0091027
195 Ga0501073_0007442
196 Ga0501074_0068788
197 Ga0501077_0011606
198 Ga0501079_0058312
199 Ga0501080_0010445
200 Ga0501081_0866398
201 Ga0501083_0104574
202 Ga0501083_0249783
203 Ga0501044_1017838
204 nmdc:mga03n38_198420_c1
205 nmdc:mga06z11_118553_c1
206 nmdc:mga0qj67_147541_c1
207 nmdc:mga0qj67_324994_c1
208 nmdc:mga06r32_593191_c1
209 nmdc:mga0n895_1333897_c1
210 nmdc:mga0n895_315516_c1
211 nmdc:mga0n895_63187_c1
212 nmdc:mga0rr50_133984_c1
213 nmdc:mga0a205_340294_c1
214 Ga0501084_1240437
215 Ga0501082_0036144
216 2870790659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

22

159

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9576 8 163
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9569 8 162
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9548 8 162
3pu2-assembly2.cif.gz_B crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9515 6 162
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9506 9 163
ID Description Score Start End Superfamily
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9464 8 163 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9337 8 163 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9177 6 160 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9123 17 158 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8897 10 159 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A347Q920-F1-model_v4 deleted 0.981 7 161
AF-A0A1Z4H2Q2-F1-model_v4 deleted 0.9806 10 163
AF-A0A521SWN2-F1-model_v4 ATPase 0.9751 8 163
AF-A0A1B2HJG2-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.975 8 162
AF-A0A535HI98-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9736 21 163

Map