F049440

General Info

Members Datasets Scaffolds Average Seq Length
108 86 216 178

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10013593|Ga0265327_100135935
Length 210
Sequence LAKILIRINDLRIFDTVLFVYLRNKINYMENIFSYLKALHIIFVVTWFAGLFYIVRLFIYHTEANSKAEPEKSILIHQYKIMQKRLWYGITWPSMIITLILGGCMLWQNSAFLLQAYFILKLCFVGGLVLYHLQCHVMFKQLQRDVVKSTSFKLRMWNELATLFLVAIVFLIVLKSNTGFIWGMLGLVVFAVTLMLAIKIYKKSRDKKGN

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
37 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
38 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
43 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
44 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
45 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
46 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
49 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
50 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
51 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
52 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
53 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
54 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
55 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
57 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
58 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
59 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
60 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
61 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
62 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
63 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
64 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
65 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
66 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
67 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
68 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
69 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
70 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
71 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
73 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
74 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
75 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
76 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
77 2738541278 Niastella sp. CF465 Isolate Unclassified
78 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
79 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
80 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
81 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
82 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
83 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
84 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
85 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
86 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.74
Metatranscriptomes 0
Isolates 9.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.7
Nodule 0
Rhizoplane 0
Rhizosphere 87.96
Stem 0
Stem Tuber 0
Unclassified 13.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10013593 3300031251 Bacteria 5398
2 rootH2_10067873 3300003320 Unclassified 1340
3 Ga0065714_10113320 3300005288 Bacteria 1443
4 Ga0065714_10172249 3300005288 Unclassified 999
5 Ga0065704_10078402 3300005289 Bacteria 4440
6 Ga0065704_10113716 3300005289 Bacteria 1859
7 Ga0065712_10022169 3300005290 Bacteria 1879
8 Ga0070670_100079664 3300005331 Bacteria 2815
9 Ga0068869_100397798 3300005334 Bacteria 1132
10 Ga0070669_100209806 3300005353 Unclassified 1536
11 Ga0070672_100374966 3300005543 Unclassified 1216
12 Ga0070665_100033646 3300005548 Bacteria 5157
13 Ga0068857_100084305 3300005577 Bacteria 2840
14 Ga0068854_100045397 3300005578 Bacteria 3124
15 Ga0068852_100517375 3300005616 Bacteria 1190
16 Ga0070712_100279901 3300006175 Bacteria 1343
17 Ga0105240_10039066 3300009093 Bacteria 6081
18 Ga0105240_11566247 3300009093 Unclassified 690
19 Ga0105241_10103659 3300009174 Bacteria 2265
20 Ga0105242_10150152 3300009176 Unclassified 2031
21 Ga0105242_10164583 3300009176 Bacteria 1944
22 Ga0105237_10002974 3300009545 Bacteria 20487
23 Ga0105237_10049901 3300009545 Bacteria 4205
24 Ga0105239_10744498 3300010375 Bacteria 1122
25 Ga0157371_10020288 3300013102 Bacteria 4892
26 Ga0157371_10318200 3300013102 Bacteria 1129
27 Ga0157370_10034153 3300013104 Bacteria 4955
28 Ga0157369_10005273 3300013105 Bacteria 15070
29 Ga0157369_11214246 3300013105 Bacteria 769
30 Ga0157372_10000026 3300013307 Bacteria 195407
31 Ga0157372_10000683 3300013307 Bacteria 37283
32 Ga0157372_10241694 3300013307 Unclassified 2095
33 Ga0157372_10346600 3300013307 Bacteria 1730
34 Ga0163161_10003674 3300017792 Bacteria 10758
35 Ga0207647_10009649 3300025904 Bacteria 6853
36 Ga0207695_10006677 3300025913 Bacteria 14893
37 Ga0207671_10000036 3300025914 Bacteria 236133
38 Ga0207686_10213132 3300025934 Bacteria 1390
39 Ga0207689_10175423 3300025942 Bacteria 1767
40 Ga0207667_10160208 3300025949 Bacteria 2315
41 Ga0207640_10024944 3300025981 Bacteria 3614
42 Ga0207702_10587537 3300026078 Bacteria 1092
43 Ga0207698_10183106 3300026142 Bacteria 1858
44 Ga0268266_10038023 3300028379 Bacteria 4098
45 Ga0307408_100000059 3300031548 Bacteria 134620
46 Ga0307407_10485464 3300031903 Bacteria 903
47 Ga0307414_10000183 3300032004 Bacteria 42718
48 Ga0307414_10181689 3300032004 Bacteria 1692
49 Ga0307414_10498319 3300032004 Bacteria 1077
50 Ga0307411_10081909 3300032005 Bacteria 2224
51 Ga0307415_101068239 3300032126 Unclassified 754
52 Ga0316584_0252966 3300036712 Bacteria 1286
53 Ga0395899_0201593 3300037312 Bacteria 1387
54 Ga0395905_0000001 3300037471 Bacteria 2037079
55 Ga0395905_0103007 3300037471 Unclassified 2680
56 Ga0451837_0159534 3300041494 Bacteria 3599
57 Ga0451837_1657414 3300041494 Bacteria 1058
58 Ga0439446_0151884 3300042156 Unclassified 762
59 Ga0451577_0000260 3300042876 Bacteria 104156
60 Ga0466969_0043976 3300044656 Bacteria 2224
61 Ga0466966_0024567 3300044684 Bacteria 3940
62 Ga0453684_0000836 3300044712 Bacteria 103922
63 Ga0453684_1060667 3300044712 Unclassified 858
64 Ga0451576_0046423 3300045051 Bacteria 4573
65 Ga0451576_1063821 3300045051 Bacteria 847
66 Ga0495606_0006167 3300046507 Bacteria 11158
67 Ga0495632_0092740 3300046519 Bacteria 1430
68 Ga0496123_0316007 3300048926 Unclassified 739
69 Ga0501296_027559 3300049519 Bacteria 752
70 Ga0501299_037416 3300049522 Unclassified 961
71 Ga0501033_0183758 3300049570 Bacteria 1498
72 Ga0501198_001928 3300049649 Bacteria 2747
73 Ga0501201_001998 3300049651 Bacteria 1880
74 Ga0501202_001714 3300049652 Bacteria 3558
75 Ga0501202_046656 3300049652 Bacteria 950
76 Ga0501206_004910 3300049653 Bacteria 1715
77 Ga0501207_015699 3300049654 Bacteria 1168
78 Ga0501217_011969 3300049661 Bacteria 1926
79 Ga0501217_013076 3300049661 Bacteria 1858
80 Ga0501217_177421 3300049661 Bacteria 652
81 Ga0501223_000160 3300049663 Bacteria 17828
82 Ga0501223_007311 3300049663 Bacteria 2263
83 Ga0501242_002425 3300049674 Bacteria 1959
84 Ga0501257_109077 3300049686 Bacteria 732
85 Ga0501259_000812 3300049688 Bacteria 5126
86 Ga0501260_003720 3300049689 Bacteria 1383
87 Ga0501221_015832 3300049704 Bacteria 1419
88 Ga0501221_067072 3300049704 Unclassified 840
89 Ga0501225_0007605 3300049705 Bacteria 3138
90 Ga0501225_0250500 3300049705 Bacteria 582
91 Ga0501080_0366313 3300049742 Bacteria 1300
92 Ga0501241_000579 3300049758 Bacteria 7860
93 Ga0501035_0003729 3300049822 Bacteria 14529
94 Ga0501044_0193977 3300049823 Bacteria 1992
95 Ga0500583_0000159 3300053092 Bacteria 27775
96 Ga0500641_0003464 3300053096 Bacteria 5579
97 Ga0500556_0098369 3300053104 Unclassified 1124
98 Ga0500577_0338721 3300053142 Bacteria 657
99 2738724706 2738541278 Bacteria 9755573
100 2839992534 2839989709 Bacteria 3773432
101 2840678834 2840677318 Bacteria 2664183
102 2884637027 2884634485 Bacteria 3928637
103 2890806547 2890804823 Bacteria 3717572
104 2896086652 2896085136 Bacteria 6129793
105 2896113035 2896109856 Bacteria 7140722
106 2910245870 2910245624 Bacteria 6935613
107 2919694009 2919692658 Bacteria 5943958
108 2965321261 2965320100 Bacteria 3975600
109 Ga0265327_10013593
110 rootH2_10067873
111 Ga0065714_10113320
112 Ga0065714_10172249
113 Ga0065704_10078402
114 Ga0065704_10113716
115 Ga0065712_10022169
116 Ga0070670_100079664
117 Ga0068869_100397798
118 Ga0070669_100209806
119 Ga0070672_100374966
120 Ga0070665_100033646
121 Ga0068857_100084305
122 Ga0068854_100045397
123 Ga0068852_100517375
124 Ga0070712_100279901
125 Ga0105240_10039066
126 Ga0105240_11566247
127 Ga0105241_10103659
128 Ga0105242_10150152
129 Ga0105242_10164583
130 Ga0105237_10002974
131 Ga0105237_10049901
132 Ga0105239_10744498
133 Ga0157371_10020288
134 Ga0157371_10318200
135 Ga0157370_10034153
136 Ga0157369_10005273
137 Ga0157369_11214246
138 Ga0157372_10000026
139 Ga0157372_10000683
140 Ga0157372_10241694
141 Ga0157372_10346600
142 Ga0163161_10003674
143 Ga0207647_10009649
144 Ga0207695_10006677
145 Ga0207671_10000036
146 Ga0207686_10213132
147 Ga0207689_10175423
148 Ga0207667_10160208
149 Ga0207640_10024944
150 Ga0207702_10587537
151 Ga0207698_10183106
152 Ga0268266_10038023
153 Ga0307408_100000059
154 Ga0307407_10485464
155 Ga0307414_10000183
156 Ga0307414_10181689
157 Ga0307414_10498319
158 Ga0307411_10081909
159 Ga0307415_101068239
160 Ga0316584_0252966
161 Ga0395899_0201593
162 Ga0395905_0000001
163 Ga0395905_0103007
164 Ga0451837_0159534
165 Ga0451837_1657414
166 Ga0439446_0151884
167 Ga0451577_0000260
168 Ga0466969_0043976
169 Ga0466966_0024567
170 Ga0453684_0000836
171 Ga0453684_1060667
172 Ga0451576_0046423
173 Ga0451576_1063821
174 Ga0495606_0006167
175 Ga0495632_0092740
176 Ga0496123_0316007
177 Ga0501296_027559
178 Ga0501299_037416
179 Ga0501033_0183758
180 Ga0501198_001928
181 Ga0501201_001998
182 Ga0501202_001714
183 Ga0501202_046656
184 Ga0501206_004910
185 Ga0501207_015699
186 Ga0501217_011969
187 Ga0501217_013076
188 Ga0501217_177421
189 Ga0501223_000160
190 Ga0501223_007311
191 Ga0501242_002425
192 Ga0501257_109077
193 Ga0501259_000812
194 Ga0501260_003720
195 Ga0501221_015832
196 Ga0501221_067072
197 Ga0501225_0007605
198 Ga0501225_0250500
199 Ga0501080_0366313
200 Ga0501241_000579
201 Ga0501035_0003729
202 Ga0501044_0193977
203 Ga0500583_0000159
204 Ga0500641_0003464
205 Ga0500556_0098369
206 Ga0500577_0338721
207 2738724706
208 2839992534
209 2840678834
210 2884637027
211 2890806547
212 2896086652
213 2896113035
214 2910245870
215 2919694009
216 2965321261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03653

UPF0093

Uncharacterised protein family (UPF0093)

29

177

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bbi-assembly1.cif.gz_A the crac channel orai in an unlatched-closed conformation; k163w loss-of-function mutation; p42212 crystal form 0.4682 46 177
6bbi-assembly1.cif.gz_B-2 the crac channel orai in an unlatched-closed conformation; k163w loss-of-function mutation; p42212 crystal form 0.4681 46 177
7rpr-assembly2.cif.gz_B borrelia miyamotoi fbpa complement inhibitory domain 0.4655 5 130
7ldd-assembly1.cif.gz_E native ampa receptor 0.4581 9 139
7lep-assembly1.cif.gz_F the composite lbd-tmd structure combined from all hippocampal ampar subtypes at 3.25 angstrom resolution 0.4573 10 139
ID Description Score Start End Superfamily
af_Q4DL94_237_563_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.5929 2 100 1.20.1560.10
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5708 2 77 1.10.287.1490
af_K7UYZ6_115_176_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5117 16 52 1.25.10.10
af_F1Q930_116_353_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5114 7 145 1.20.1070.10
af_P9WFR7_179_308_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4887 9 148 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A519V1Q3-F1-model_v4 Protoporphyrinogen IX oxidase 0.9832 2 135 GO:0005886
GO:0006782
GO:0016491
GO:0046872
AF-A0A355B7I5-F1-model_v4 Protoporphyrinogen IX oxidase 0.9809 1 113 GO:0005886
GO:0006782
GO:0016491
GO:0046872
AF-A0A520D1F1-F1-model_v4 deleted 0.967 2 113
AF-A0A4Q3NVD5-F1-model_v4 deleted 0.9648 3 114
AF-A0A832H0H3-F1-model_v4 Protoporphyrinogen IX oxidase 0.9646 1 73 GO:0005886
GO:0006782
GO:0016491
GO:0046872

Map