F049279

General Info

Members Datasets Scaffolds Average Seq Length
108 61 216 120

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10068412|Ga0265326_100684122
Length 123
Sequence METKFLKNQTKTNNNSFFQQVYEVTRLIPFGRVTNYGAIARYLGSGQSARMVGWALNTCHNQPDVPAHRVVNRNGLLTGKIHFGGPNIMQQLLENEGIKVEDDQVIDFDKLFWDPAKELEVGD

Samples

Sample ID Description Type Environment
1 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
6 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
12 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
18 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
24 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
38 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
41 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
42 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
43 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
44 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
49 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
50 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
51 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
52 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
53 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
56 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
57 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
58 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
59 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
60 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
61 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.93
Rhizosphere 97.22
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265326_10068412 3300028558 Bacteria 1004
2 Ga0065707_10416358 3300005295 Unclassified 836
3 Ga0070689_100634029 3300005340 Bacteria 928
4 Ga0070688_100106882 3300005365 Bacteria 1854
5 Ga0068867_101335223 3300005459 Bacteria 663
6 Ga0070685_10117210 3300005466 Bacteria 1649
7 Ga0070685_10213018 3300005466 Unclassified 1262
8 Ga0070685_11031357 3300005466 Bacteria 618
9 Ga0070698_100049669 3300005471 Bacteria 4280
10 Ga0070672_101027719 3300005543 Bacteria 731
11 Ga0068852_100361821 3300005616 Bacteria 1419
12 Ga0068864_101686352 3300005618 Bacteria 638
13 Ga0068851_10051900 3300005834 Bacteria 2084
14 Ga0068870_10843262 3300005840 Bacteria 643
15 Ga0068860_100035920 3300005843 Bacteria 4751
16 Ga0097621_100282262 3300006237 Bacteria 1462
17 Ga0068865_100882942 3300006881 Bacteria 776
18 Ga0111539_12488706 3300009094 Unclassified 600
19 Ga0157374_11009406 3300013296 Bacteria 851
20 Ga0163162_11388942 3300013306 Bacteria 799
21 Ga0157372_10374346 3300013307 Unclassified 1660
22 Ga0157372_11737221 3300013307 Bacteria 718
23 Ga0157375_10331456 3300013308 Unclassified 1687
24 Ga0157375_10903367 3300013308 Bacteria 1027
25 Ga0163163_10084630 3300014325 Bacteria 3178
26 Ga0163163_12900109 3300014325 Bacteria 535
27 Ga0157376_10427819 3300014969 Bacteria 1286
28 Ga0157376_12089797 3300014969 Bacteria 605
29 Ga0163161_10401911 3300017792 Bacteria 1099
30 Ga0163161_10504649 3300017792 Bacteria 986
31 Ga0207662_11079994 3300025918 Bacteria 570
32 Ga0207686_10107381 3300025934 Unclassified 1876
33 Ga0207686_10877058 3300025934 Bacteria 723
34 Ga0207691_10219968 3300025940 Bacteria 1647
35 Ga0207667_10044738 3300025949 Bacteria 4690
36 Ga0207648_11173738 3300026089 Bacteria 721
37 Ga0207674_11043688 3300026116 Bacteria 787
38 Ga0207675_101189413 3300026118 Unclassified 783
39 Ga0207683_10318478 3300026121 Unclassified 1424
40 Ga0207698_10293556 3300026142 Unclassified 1510
41 Ga0268264_10597805 3300028381 Bacteria 1087
42 Ga0265337_1042850 3300028556 Bacteria 1296
43 Ga0265334_10010318 3300028573 Bacteria 3945
44 Ga0265318_10022813 3300028577 Unclassified 2500
45 Ga0265323_10057857 3300028653 Bacteria 1355
46 Ga0265336_10110008 3300028666 Bacteria 820
47 Ga0265338_10531201 3300028800 Bacteria 825
48 Ga0265330_10481762 3300031235 Bacteria 527
49 Ga0265320_10306961 3300031240 Bacteria 702
50 Ga0265329_10079552 3300031242 Unclassified 1038
51 Ga0265316_10004983 3300031344 Bacteria 13039
52 Ga0265316_10012386 3300031344 Bacteria 7652
53 Ga0265316_10053051 3300031344 Unclassified 3178
54 Ga0265342_10021993 3300031712 Bacteria 4063
55 Ga0265342_10702554 3300031712 Unclassified 505
56 Ga0265342_10708071 3300031712 Unclassified 503
57 Ga0316576_11089626 3300031727 Unclassified 567
58 Ga0307415_101295844 3300032126 Unclassified 690
59 Ga0316584_0127660 3300036712 Bacteria 1899
60 Ga0316584_0406941 3300036712 Bacteria 968
61 Ga0451807_2319159 3300041486 Bacteria 871
62 Ga0451835_0202495 3300041492 Bacteria 571
63 Ga0451843_1545484 3300041509 Bacteria 914
64 Ga0451577_0000043 3300042876 Bacteria 329533
65 Ga0451577_0003597 3300042876 Bacteria 17038
66 Ga0451577_0200087 3300042876 Bacteria 1803
67 Ga0451577_0363403 3300042876 Bacteria 1313
68 Ga0451577_0401739 3300042876 Unclassified 1244
69 Ga0451577_1640365 3300042876 Unclassified 567
70 Ga0453683_0000092 3300044673 Bacteria 136648
71 Ga0453683_0078624 3300044673 Bacteria 2065
72 Ga0453683_0100010 3300044673 Bacteria 1820
73 Ga0453683_0110779 3300044673 Unclassified 1726
74 Ga0453683_0163234 3300044673 Unclassified 1410
75 Ga0453683_0310541 3300044673 Bacteria 1009
76 Ga0453683_0470044 3300044673 Bacteria 814
77 Ga0453683_1159073 3300044673 Unclassified 516
78 Ga0453684_0000133 3300044712 Bacteria 329529
79 Ga0453684_0000337 3300044712 Bacteria 195296
80 Ga0453684_0000340 3300044712 Bacteria 194264
81 Ga0453684_0016504 3300044712 Bacteria 11535
82 Ga0453684_0027231 3300044712 Bacteria 8205
83 Ga0453684_0064735 3300044712 Bacteria 4668
84 Ga0453684_0106991 3300044712 Bacteria 3407
85 Ga0453684_0112389 3300044712 Bacteria 3306
86 Ga0453684_0151745 3300044712 Bacteria 2752
87 Ga0453684_0160929 3300044712 Bacteria 2655
88 Ga0453684_0168376 3300044712 Bacteria 2585
89 Ga0453684_0220993 3300044712 Unclassified 2194
90 Ga0453684_0680718 3300044712 Bacteria 1120
91 Ga0453684_1104349 3300044712 Bacteria 838
92 Ga0453684_1793344 3300044712 Bacteria 624
93 Ga0453684_1869766 3300044712 Unclassified 608
94 Ga0451576_0000093 3300045051 Bacteria 226300
95 Ga0451576_0000097 3300045051 Bacteria 220569
96 Ga0451576_0000369 3300045051 Bacteria 107433
97 Ga0451576_0051111 3300045051 Bacteria 4334
98 Ga0451576_0100128 3300045051 Bacteria 3014
99 Ga0451576_0145360 3300045051 Bacteria 2472
100 Ga0451576_0262535 3300045051 Bacteria 1805
101 Ga0451576_0580454 3300045051 Bacteria 1178
102 Ga0495592_0118923 3300046454 Bacteria 1861
103 Ga0495662_0135605 3300046476 Unclassified 1211
104 Ga0495586_0068857 3300046535 Unclassified 1931
105 Ga0495667_0435642 3300046559 Bacteria 824
106 Ga0495634_0005579 3300046642 Bacteria 9655
107 Ga0495599_0208186 3300046678 Unclassified 1200
108 Ga0495684_0267707 3300047471 Unclassified 1237
109 Ga0265326_10068412
110 Ga0065707_10416358
111 Ga0070689_100634029
112 Ga0070688_100106882
113 Ga0068867_101335223
114 Ga0070685_10117210
115 Ga0070685_10213018
116 Ga0070685_11031357
117 Ga0070698_100049669
118 Ga0070672_101027719
119 Ga0068852_100361821
120 Ga0068864_101686352
121 Ga0068851_10051900
122 Ga0068870_10843262
123 Ga0068860_100035920
124 Ga0097621_100282262
125 Ga0068865_100882942
126 Ga0111539_12488706
127 Ga0157374_11009406
128 Ga0163162_11388942
129 Ga0157372_10374346
130 Ga0157372_11737221
131 Ga0157375_10331456
132 Ga0157375_10903367
133 Ga0163163_10084630
134 Ga0163163_12900109
135 Ga0157376_10427819
136 Ga0157376_12089797
137 Ga0163161_10401911
138 Ga0163161_10504649
139 Ga0207662_11079994
140 Ga0207686_10107381
141 Ga0207686_10877058
142 Ga0207691_10219968
143 Ga0207667_10044738
144 Ga0207648_11173738
145 Ga0207674_11043688
146 Ga0207675_101189413
147 Ga0207683_10318478
148 Ga0207698_10293556
149 Ga0268264_10597805
150 Ga0265337_1042850
151 Ga0265334_10010318
152 Ga0265318_10022813
153 Ga0265323_10057857
154 Ga0265336_10110008
155 Ga0265338_10531201
156 Ga0265330_10481762
157 Ga0265320_10306961
158 Ga0265329_10079552
159 Ga0265316_10004983
160 Ga0265316_10012386
161 Ga0265316_10053051
162 Ga0265342_10021993
163 Ga0265342_10702554
164 Ga0265342_10708071
165 Ga0316576_11089626
166 Ga0307415_101295844
167 Ga0316584_0127660
168 Ga0316584_0406941
169 Ga0451807_2319159
170 Ga0451835_0202495
171 Ga0451843_1545484
172 Ga0451577_0000043
173 Ga0451577_0003597
174 Ga0451577_0200087
175 Ga0451577_0363403
176 Ga0451577_0401739
177 Ga0451577_1640365
178 Ga0453683_0000092
179 Ga0453683_0078624
180 Ga0453683_0100010
181 Ga0453683_0110779
182 Ga0453683_0163234
183 Ga0453683_0310541
184 Ga0453683_0470044
185 Ga0453683_1159073
186 Ga0453684_0000133
187 Ga0453684_0000337
188 Ga0453684_0000340
189 Ga0453684_0016504
190 Ga0453684_0027231
191 Ga0453684_0064735
192 Ga0453684_0106991
193 Ga0453684_0112389
194 Ga0453684_0151745
195 Ga0453684_0160929
196 Ga0453684_0168376
197 Ga0453684_0220993
198 Ga0453684_0680718
199 Ga0453684_1104349
200 Ga0453684_1793344
201 Ga0453684_1869766
202 Ga0451576_0000093
203 Ga0451576_0000097
204 Ga0451576_0000369
205 Ga0451576_0051111
206 Ga0451576_0100128
207 Ga0451576_0145360
208 Ga0451576_0262535
209 Ga0451576_0580454
210 Ga0495592_0118923
211 Ga0495662_0135605
212 Ga0495586_0068857
213 Ga0495667_0435642
214 Ga0495634_0005579
215 Ga0495599_0208186
216 Ga0495684_0267707

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

16

98

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e1p-assembly1.cif.gz_A crystal structure of sulfurisphaera tokodaii o6-methylguanine methyltransferase c120s variant in complex with o6-methyldeoxyguanosine 0.8977 6 91
4zye-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase 0.8944 8 93
7dqr-assembly1.cif.gz_A crystal structure of sulfurisphaera tokodaii methylated o6-methylguanine methyltransferase 0.8935 8 91
7dqq-assembly1.cif.gz_A crystal structure of sulfurisphaera tokodaii o6-methylguanine methyltransferase y91f/c120s variant in complex with o6-methyldeoxyguanosine 0.889 8 90
4wx9-assembly1.cif.gz_C-4 crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.8592 1 88
ID Description Score Start End Superfamily
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8906 1 87 1.10.10.10
af_O05862_6_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8844 6 105 1.10.10.10
4hduA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8755 3 106 1.10.10.10
af_A0A1D8PU47_6_130_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8686 4 106 1.10.10.10
af_O05862_6_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8586 6 105 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0Q4LFE5-F1-model_v4 Cysteine methyltransferase 0.9925 7 106 GO:0006281
GO:0008168
GO:0032259
AF-A0A1I2C0P0-F1-model_v4 Methylated-DNA-protein-cysteine methyltransferase related protein 0.9922 6 106 GO:0006281
GO:0008168
GO:0032259
AF-H5SNW0-F1-model_v4 DNA methyltransferase 0.99 16 93 GO:0006281
GO:0008168
GO:0032259
AF-A0A2T0U7P7-F1-model_v4 Methylated-DNA-protein-cysteine methyltransferase-like protein 0.9882 3 108 GO:0006281
GO:0008168
GO:0032259
AF-A0A524PVB7-F1-model_v4 MGMT family protein 0.987 21 106 GO:0003824
GO:0006281

Map