F046407

General Info

Members Datasets Scaffolds Average Seq Length
108 86 85 121

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10008313|JGI25404J52841_100083133
Length 131
Sequence VSKRKSMIAVVDDDPRILESLEDLFESAGYGVCKFSSVKSLIDAGLSDVGCLITDIGMPYVDGFELHDFVKKVRPDLPVFLITGRHEIGDQQRASATSISGFFRKPFDGPTLLAAVGDALRAHGGDEARFR

Samples

Sample ID Description Type Environment
1 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
2 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
3 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
4 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
5 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
6 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
7 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
8 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
9 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
10 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
11 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
12 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
13 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
14 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
15 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
16 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
17 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
18 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
19 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
20 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
44 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
45 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
46 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
47 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
48 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
49 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
50 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
51 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
52 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
53 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
54 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
55 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
56 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
57 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
64 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
65 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
66 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
67 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
68 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
69 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
70 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
71 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
72 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
73 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
74 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
77 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
78 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
79 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
80 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
81 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
82 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
83 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
84 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
85 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
86 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.7
Metatranscriptomes 0
Isolates 21.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 13.89
Rhizoplane 1.85
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10001401 3300003659 Bacteria 4229
2 JGI25404J52841_10007058 3300003659 Bacteria 2366
3 JGI25404J52841_10008313 3300003659 Bacteria 2208
4 Ga0055530_10007258 3300003791 Bacteria 4711
5 Ga0070706_101154755 3300005467 Bacteria 712
6 Ga0068859_102354654 3300005617 Bacteria 587
7 Ga0068862_102387714 3300005844 Bacteria 540
8 Ga0081455_10230540 3300005937 Bacteria 1367
9 Ga0081540_1000195 3300005983 Bacteria 62863
10 Ga0081540_1003332 3300005983 Bacteria 12739
11 Ga0081540_1014942 3300005983 Bacteria 4938
12 Ga0081539_10230152 3300005985 Unclassified 837
13 Ga0075364_10046396 3300006051 Bacteria 2829
14 Ga0070712_100012431 3300006175 Bacteria 5413
15 Ga0097620_102354010 3300006931 Bacteria 587
16 Ga0105240_10213890 3300009093 Bacteria 2251
17 Ga0157374_10717899 3300013296 Bacteria 1013
18 Ga0163163_10668707 3300014325 Unclassified 1102
19 Ga0209758_1023476 3300025297 Bacteria 2788
20 Ga0209050_1000192 3300025298 Bacteria 138262
21 Ga0209256_1000247 3300025299 Bacteria 96046
22 Ga0207684_11174447 3300025910 Bacteria 636
23 Ga0207695_10309775 3300025913 Bacteria 1469
24 Ga0307515_10089116 3300028794 Bacteria 3889
25 Ga0265331_10000037 3300031250 Bacteria 197251
26 Ga0307513_10029239 3300031456 Bacteria 6286
27 Ga0307513_10346367 3300031456 Bacteria 1235
28 Ga0307405_10603973 3300031731 Bacteria 896
29 Ga0307414_10119851 3300032004 Bacteria 2021
30 Ga0307414_10184052 3300032004 Bacteria 1683
31 Ga0439438_070124 3300041405 Bacteria 868
32 Ga0466960_1011301 3300044901 Bacteria 511
33 Ga0495617_102210 3300046452 Unclassified 931
34 Ga0495596_0000480 3300046500 Bacteria 25337
35 Ga0495607_0027944 3300046501 Bacteria 3483
36 Ga0495607_0056115 3300046501 Bacteria 2262
37 Ga0495606_0351463 3300046507 Bacteria 782
38 Ga0495643_0001266 3300046522 Bacteria 24203
39 Ga0495687_005202 3300047443 Bacteria 8396
40 Ga0495686_0007903 3300047472 Bacteria 7900
41 Ga0496105_0081273 3300048908 Bacteria 2677
42 Ga0496116_0127454 3300048919 Bacteria 1459
43 Ga0496117_0102961 3300048920 Bacteria 1800
44 Ga0496121_0162113 3300048924 Bacteria 1634
45 Ga0501034_0160497 3300049571 Bacteria 2219
46 Ga0501037_0164355 3300049573 Bacteria 1581
47 Ga0501037_0246432 3300049573 Bacteria 1251
48 Ga0501037_0674383 3300049573 Unclassified 689
49 Ga0501038_0194716 3300049574 Bacteria 1630
50 Ga0501042_0007125 3300049578 Bacteria 7312
51 Ga0501046_0012447 3300049580 Bacteria 7241
52 Ga0501047_0235718 3300049581 Bacteria 1682
53 Ga0501047_0277034 3300049581 Bacteria 1523
54 Ga0501047_0355951 3300049581 Bacteria 1300
55 Ga0501047_0511725 3300049581 Unclassified 1027
56 Ga0501047_0960505 3300049581 Bacteria 668
57 Ga0501047_1065836 3300049581 Unclassified 622
58 Ga0501067_0033712 3300049583 Bacteria 2841
59 Ga0501067_0099171 3300049583 Bacteria 1618
60 Ga0501068_0187072 3300049584 Bacteria 1311
61 Ga0501069_0435994 3300049585 Unclassified 778
62 Ga0501070_0234411 3300049586 Bacteria 1503
63 Ga0501070_0266003 3300049586 Bacteria 1401
64 Ga0501071_0215714 3300049587 Bacteria 1444
65 Ga0501073_0140231 3300049589 Bacteria 1675
66 Ga0501074_0131893 3300049590 Bacteria 1787
67 Ga0501238_028339 3300049671 Bacteria 805
68 Ga0501079_0334694 3300049741 Bacteria 1186
69 Ga0501080_0008042 3300049742 Bacteria 9555
70 Ga0501083_0004674 3300049744 Bacteria 9673
71 Ga0501035_0180435 3300049822 Bacteria 1819
72 Ga0501035_0247749 3300049822 Bacteria 1514
73 Ga0501044_0000526 3300049823 Bacteria 46666
74 Ga0501044_0327194 3300049823 Bacteria 1456
75 Ga0501044_0358893 3300049823 Bacteria 1376
76 Ga0501044_0508304 3300049823 Bacteria 1105
77 Ga0501045_0004242 3300049824 Bacteria 9880
78 nmdc:mga03n38_701771_c1 3300050490 Bacteria 583
79 nmdc:mga00v17_176195_c1 3300050491 Bacteria 1379
80 Ga0500583_0599199 3300053092 Bacteria 507
81 Ga0500622_0031074 3300053156 Bacteria 2802
82 Ga0501084_0258627 3300054114 Bacteria 1470
83 Ga0501084_1539897 3300054114 Unclassified 556
84 Ga0501082_0106853 3300060353 Bacteria 2421
85 Ga0501082_0125205 3300060353 Unclassified 2229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0027944 Ga0495607_0027944_37_366 109
2 3300050490 nmdc:mga03n38_701771_c1 nmdc:mga03n38_701771_c1_27_359 109
3 iso_pu_bacteria 2935908558 2935916631 109
4 iso_pu_bacteria 8016511872 8016516181 109
5 iso_pu_bacteria 8017057580 8017060344 109
6 iso_pu_bacteria 8019687851 8019695321 109
7 3300060353 Ga0501082_0106853 Ga0501082_0106853_1583_1939 112
8 iso_pu_bacteria 2924762789 2924764821 112
9 iso_pu_bacteria 2987666974 2987669589 112
10 3300025299 Ga0209256_1000247 Ga0209256_100024772 113
11 3300028794 Ga0307515_10089116 Ga0307515_100891164 114
12 3300032004 Ga0307414_10119851 Ga0307414_101198512 114
13 3300046507 Ga0495606_0351463 Ga0495606_0351463_10_354 114
14 iso_pu_bacteria 2856328259 2856333869 114
15 iso_pu_bacteria 643692032 643823541 114
16 3300003791 Ga0055530_10007258 Ga0055530_100072583 115
17 3300025298 Ga0209050_1000192 Ga0209050_100019290 115
18 3300046500 Ga0495596_0000480 Ga0495596_0000480_10509_10871 115
19 3300046501 Ga0495607_0056115 Ga0495607_0056115_224_586 115
20 3300048908 Ga0496105_0081273 Ga0496105_0081273_923_1270 115
21 iso_pu_bacteria 2818991438 2819553762 115
22 3300003659 JGI25404J52841_10007058 JGI25404J52841_100070584 116
23 3300005467 Ga0070706_101154755 Ga0070706_1011547551 116
24 3300005617 Ga0068859_102354654 Ga0068859_1023546541 116
25 3300005844 Ga0068862_102387714 Ga0068862_1023877142 116
26 3300005983 Ga0081540_1000195 Ga0081540_10001953 116
27 3300006051 Ga0075364_10046396 Ga0075364_100463963 116
28 3300006175 Ga0070712_100012431 Ga0070712_1000124314 116
29 3300006931 Ga0097620_102354010 Ga0097620_1023540102 116
30 3300009093 Ga0105240_10213890 Ga0105240_102138902 116
31 3300013296 Ga0157374_10717899 Ga0157374_107178992 116
32 3300025910 Ga0207684_11174447 Ga0207684_111744471 116
33 3300025913 Ga0207695_10309775 Ga0207695_103097752 116
34 3300031456 Ga0307513_10346367 Ga0307513_103463672 116
35 3300032004 Ga0307414_10184052 Ga0307414_101840523 116
36 3300044901 Ga0466960_1011301 Ga0466960_1011301_15_383 116
37 3300047472 Ga0495686_0007903 Ga0495686_0007903_2922_3290 116
38 3300048919 Ga0496116_0127454 Ga0496116_0127454_529_891 116
39 3300048920 Ga0496117_0102961 Ga0496117_0102961_450_812 116
40 3300049573 Ga0501037_0164355 Ga0501037_0164355_602_970 116
41 3300049573 Ga0501037_0246432 Ga0501037_0246432_600_950 116
42 3300049581 Ga0501047_0235718 Ga0501047_0235718_322_672 116
43 3300049581 Ga0501047_0277034 Ga0501047_0277034_849_1217 116
44 3300049581 Ga0501047_0511725 Ga0501047_0511725_372_722 116
45 3300049581 Ga0501047_1065836 Ga0501047_1065836_80_448 116
46 3300049585 Ga0501069_0435994 Ga0501069_0435994_65_415 116
47 3300049586 Ga0501070_0266003 Ga0501070_0266003_804_1154 116
48 3300049587 Ga0501071_0215714 Ga0501071_0215714_328_678 116
49 3300049822 Ga0501035_0180435 Ga0501035_0180435_738_1088 116
50 3300049822 Ga0501035_0247749 Ga0501035_0247749_464_832 116
51 3300049823 Ga0501044_0000526 Ga0501044_0000526_45811_46179 116
52 3300049823 Ga0501044_0327194 Ga0501044_0327194_116_466 116
53 3300049823 Ga0501044_0358893 Ga0501044_0358893_807_1175 116
54 3300050491 nmdc:mga00v17_176195_c1 nmdc:mga00v17_176195_c1_771_1139 116
55 3300060353 Ga0501082_0125205 Ga0501082_0125205_1735_2085 116
56 3300025297 Ga0209758_1023476 Ga0209758_10234761 117
57 3300031250 Ga0265331_10000037 Ga0265331_1000003738 117
58 3300031456 Ga0307513_10029239 Ga0307513_100292394 117
59 3300048924 Ga0496121_0162113 Ga0496121_0162113_1144_1509 117
60 3300049671 Ga0501238_028339 Ga0501238_028339_405_770 117
61 3300053156 Ga0500622_0031074 Ga0500622_0031074_2000_2365 117
62 iso_pu_bacteria 2585427633 2585992650 117
63 iso_pu_bacteria 2989771324 2989776245 117
64 3300046522 Ga0495643_0001266 Ga0495643_0001266_13910_14266 118
65 3300047443 Ga0495687_005202 Ga0495687_005202_5064_5420 118
66 iso_pu_bacteria 2582581866 2585394454 118
67 3300049571 Ga0501034_0160497 Ga0501034_0160497_1528_1905 119
68 3300049574 Ga0501038_0194716 Ga0501038_0194716_417_794 119
69 3300049581 Ga0501047_0355951 Ga0501047_0355951_777_1154 119
70 3300049584 Ga0501068_0187072 Ga0501068_0187072_392_769 119
71 3300049586 Ga0501070_0234411 Ga0501070_0234411_990_1367 119
72 3300049589 Ga0501073_0140231 Ga0501073_0140231_151_528 119
73 3300049590 Ga0501074_0131893 Ga0501074_0131893_777_1154 119
74 3300049741 Ga0501079_0334694 Ga0501079_0334694_319_696 119
75 3300049823 Ga0501044_0508304 Ga0501044_0508304_16_393 119
76 3300054114 Ga0501084_0258627 Ga0501084_0258627_271_648 119
77 iso_pu_bacteria 2524023209 2524459359 119
78 iso_pu_bacteria 2582581294 2585203218 119
79 iso_pu_bacteria 2687453392 2688595068 119
80 iso_pu_bacteria 2842298080 2842301151 119
81 iso_pu_bacteria 2842357229 2842360538 119
82 3300049581 Ga0501047_0960505 Ga0501047_0960505_267_629 120
83 3300053092 Ga0500583_0599199 Ga0500583_0599199_117_497 120
84 3300031731 Ga0307405_10603973 Ga0307405_106039732 121
85 3300046452 Ga0495617_102210 Ga0495617_102210_122_505 121
86 3300049578 Ga0501042_0007125 Ga0501042_0007125_4603_4986 121
87 3300049580 Ga0501046_0012447 Ga0501046_0012447_2864_3247 121
88 3300049583 Ga0501067_0033712 Ga0501067_0033712_1212_1595 121
89 3300049583 Ga0501067_0099171 Ga0501067_0099171_1162_1545 121
90 3300049742 Ga0501080_0008042 Ga0501080_0008042_7141_7524 121
91 3300049744 Ga0501083_0004674 Ga0501083_0004674_915_1298 121
92 3300049824 Ga0501045_0004242 Ga0501045_0004242_8912_9295 121
93 3300054114 Ga0501084_1539897 Ga0501084_1539897_13_396 121
94 3300005937 Ga0081455_10230540 Ga0081455_102305403 122
95 3300041405 Ga0439438_070124 Ga0439438_070124_350_739 123
96 3300049573 Ga0501037_0674383 Ga0501037_0674383_92_481 123
97 iso_pu_bacteria 2599185301 2599940271 123
98 iso_pu_bacteria 2935926038 2935934116 123
99 iso_pu_bacteria 2935934488 2935942592 123
100 iso_pu_bacteria 2935942939 2935951040 123
101 iso_pu_bacteria 2935951376 2935959493 123
102 iso_pu_bacteria 2935967501 2935975583 123
103 3300014325 Ga0163163_10668707 Ga0163163_106687072 124
104 3300003659 JGI25404J52841_10001401 JGI25404J52841_100014014 125
105 3300003659 JGI25404J52841_10008313 JGI25404J52841_100083133 125
106 3300005983 Ga0081540_1003332 Ga0081540_10033326 125
107 3300005983 Ga0081540_1014942 Ga0081540_10149422 125
108 3300005985 Ga0081539_10230152 Ga0081539_102301522 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

117

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9501 2 115
3nns-assembly3.cif.gz_B bef3 activated drrb receiver domain 0.9419 2 115
2wb4-assembly1.cif.gz_B activated diguanylate cyclase pled in complex with c-di-gmp 0.9365 2 117
3q15-assembly1.cif.gz_C-2 crystal structure of raph complexed with spo0f 0.9344 2 113
4uhj-assembly1.cif.gz_A crystal structure of the receiver domain of cpxr from e. coli (orthorhombic form) 0.9274 2 120
ID Description Score Start End Superfamily
3nnsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9392 2 115 3.40.50.2300
2wb4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9365 2 117 3.40.50.2300
2v0nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9362 2 117 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9352 2 78 3.40.50.2300
af_P0AFU4_2_125_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.934 2 115 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0T1XDT8-F1-model_v4 Regulator 0.9723 2 116 GO:0000160
AF-A0A1G6QT38-F1-model_v4 Response regulator receiver domain-containing protein 0.971 2 118 GO:0000160
AF-A0A7Y5NUP6-F1-model_v4 Response regulator 0.9689 2 116 GO:0000160
AF-A0A561HA96-F1-model_v4 deleted 0.9677 2 113
AF-A0A1X0SXH6-F1-model_v4 Response regulator receiver protein 0.9665 2 116 GO:0000160

Feature Viewer

pLDDT pTM Quality
85.2 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map