F039476

General Info

Members Datasets Scaffolds Average Seq Length
106 98 103 167

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0567398|Ga0466967_0567398_167_721
Length 184
Sequence VETAGSQVTIRQLGEPGDLGWVVMAHGEVYDAEFGWNTDFEALVARIVADYATHHDPRREAAWIAELDGRRLGCVFCVADPDEPAAAKLRILLVHPDGRGHGLGGRLVDTCVSFARAARYARIRLWTNHPLEAARRIYLARGFTLTAEQPHRSFGVDLVGQTYELQLVDGDPVLEASATDDAAH

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
3 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
53 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
58 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
59 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
70 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
71 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
74 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
75 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
76 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
77 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
78 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
79 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
80 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
81 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
82 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
87 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
94 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
95 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
96 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.17
Metatranscriptomes 0
Isolates 2.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 0
Rhizoplane 9.43
Rhizosphere 79.25
Stem 0
Stem Tuber 0
Unclassified 8.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10052559 3300003203 Bacteria 1357
2 rootH1_10104601 3300003316 Bacteria 6309
3 Ga0070683_100556534 3300005329 Bacteria 1097
4 Ga0070682_100222994 3300005337 Bacteria 1343
5 Ga0070689_101041778 3300005340 Bacteria 729
6 Ga0070687_100256976 3300005343 Bacteria 1088
7 Ga0070675_101653302 3300005354 Bacteria 591
8 Ga0070659_101012161 3300005366 Bacteria 730
9 Ga0070714_100684296 3300005435 Bacteria 989
10 Ga0070681_10428014 3300005458 Bacteria 1235
11 Ga0070684_100368197 3300005535 Bacteria 1323
12 Ga0068853_100006765 3300005539 Bacteria 9134
13 Ga0068856_101629641 3300005614 Bacteria 658
14 Ga0068863_101641391 3300005841 Bacteria 652
15 Ga0081455_10344691 3300005937 Bacteria 1053
16 Ga0081539_10015750 3300005985 Bacteria 5470
17 Ga0070717_10097531 3300006028 Bacteria 2491
18 Ga0075428_100792286 3300006844 Bacteria 1008
19 Ga0075431_100347488 3300006847 Bacteria 1492
20 Ga0105245_10166117 3300009098 Bacteria 2098
21 Ga0114129_10458558 3300009147 Bacteria 1671
22 Ga0105243_11380802 3300009148 Bacteria 724
23 Ga0105238_10008042 3300009551 Bacteria 10549
24 Ga0105239_12061579 3300010375 Bacteria 662
25 Ga0105246_10291455 3300011119 Bacteria 1313
26 Ga0157371_10001174 3300013102 Bacteria 28121
27 Ga0157369_10422844 3300013105 Bacteria 1381
28 Ga0157372_10182688 3300013307 Bacteria 2428
29 Ga0163163_10958262 3300014325 Bacteria 919
30 Ga0207705_10603930 3300025909 Bacteria 853
31 Ga0207649_10711388 3300025920 Bacteria 779
32 Ga0207694_11003920 3300025924 Bacteria 706
33 Ga0207664_10589224 3300025929 Bacteria 998
34 Ga0207690_10721471 3300025932 Bacteria 820
35 Ga0207661_10119505 3300025944 Bacteria 2242
36 Ga0207661_10285988 3300025944 Bacteria 1475
37 Ga0207679_10896735 3300025945 Bacteria 811
38 Ga0207677_10192421 3300026023 Bacteria 1615
39 Ga0207639_10149442 3300026041 Bacteria 1955
40 Ga0207678_10262741 3300026067 Bacteria 1479
41 Ga0207676_10317574 3300026095 Bacteria 1429
42 Ga0307511_10000212 3300030521 Bacteria 59189
43 Ga0265340_10014551 3300031247 Bacteria 4105
44 Ga0307410_10100970 3300031852 Bacteria 2068
45 Ga0307406_10846903 3300031901 Bacteria 775
46 Ga0307407_10089948 3300031903 Bacteria 1879
47 Ga0307412_10764797 3300031911 Bacteria 835
48 Ga0307409_100206116 3300031995 Bacteria 1763
49 Ga0307415_100516016 3300032126 Bacteria 1048
50 Ga0307415_102480641 3300032126 Bacteria 510
51 Ga0373951_0003915 3300035091 Bacteria 3578
52 Ga0373925_0064719 3300037068 Bacteria 2753
53 Ga0395900_0302214 3300037418 Bacteria 1586
54 Ga0395898_0210662 3300037466 Bacteria 1854
55 Ga0436365_1492923 3300039437 Bacteria 1430
56 Ga0436360_1047352 3300039438 Bacteria 1032
57 Ga0436361_0248511 3300039447 Bacteria 1583
58 Ga0439465_0204825 3300041413 Bacteria 720
59 Ga0451853_0673164 3300041512 Bacteria 1813
60 Ga0466969_0002858 3300044656 Bacteria 9225
61 Ga0466966_0090393 3300044684 Bacteria 1901
62 Ga0466966_0113065 3300044684 Bacteria 1672
63 Ga0466961_0022958 3300044693 Bacteria 4013
64 Ga0466961_0095209 3300044693 Bacteria 1878
65 Ga0466963_0235568 3300044694 Bacteria 1283
66 Ga0466971_0109726 3300044719 Bacteria 1272
67 Ga0466970_0211597 3300044765 Bacteria 1080
68 Ga0466970_0279245 3300044765 Bacteria 939
69 Ga0466970_0575853 3300044765 Bacteria 652
70 Ga0466959_0047547 3300045049 Bacteria 3155
71 Ga0466967_0017755 3300045976 Bacteria 5662
72 Ga0466967_0567398 3300045976 Bacteria 1118
73 Ga0495588_0225566 3300046674 Bacteria 989
74 Ga0495685_154673 3300047447 Bacteria 744
75 Ga0496101_0229397 3300048904 Bacteria 1443
76 Ga0496102_0004164 3300048905 Bacteria 12237
77 Ga0496103_0020316 3300048906 Bacteria 3989
78 Ga0496106_0052387 3300048909 Bacteria 3079
79 Ga0496108_0036560 3300048911 Bacteria 4086
80 Ga0496110_0228765 3300048913 Bacteria 1691
81 Ga0496112_0291085 3300048915 Bacteria 1579
82 Ga0496112_0694495 3300048915 Bacteria 946
83 Ga0496113_0137499 3300048916 Bacteria 1921
84 Ga0496114_0043256 3300048917 Bacteria 3735
85 Ga0496116_0205041 3300048919 Bacteria 1028
86 Ga0496119_0022496 3300048922 Bacteria 4510
87 Ga0496120_0297001 3300048923 Bacteria 741
88 Ga0501034_0431788 3300049571 Bacteria 1237
89 Ga0501039_0142341 3300049575 Bacteria 1884
90 Ga0501043_0379698 3300049579 Bacteria 1070
91 Ga0501072_0423264 3300049588 Bacteria 1055
92 Ga0501075_0046321 3300049591 Bacteria 3267
93 Ga0501045_1207016 3300049824 Bacteria 552
94 nmdc:mga05p37_369871_c1 3300050507 Bacteria 1683
95 nmdc:mga09592_464354_c1 3300050508 Bacteria 1091
96 nmdc:mga06r32_861498_c1 3300050510 Bacteria 864
97 nmdc:mga08y16_907365_c1 3300050511 Bacteria 867
98 Ga0495619_0407862 3300053085 Bacteria 938
99 Ga0500600_0329074 3300053149 Bacteria 639
100 Ga0500616_0014227 3300053153 Bacteria 4579
101 Ga0500630_198241 3300053159 Bacteria 784
102 Ga0501084_0126104 3300054114 Bacteria 2154
103 Ga0530510_0082598 3300061734 Bacteria 2339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0064719 Ga0373925_0064719_510_995 139
2 3300048923 Ga0496120_0297001 Ga0496120_0297001_287_715 142
3 3300050511 nmdc:mga08y16_907365_c1 nmdc:mga08y16_907365_c1_416_856 146
4 3300039438 Ga0436360_1047352 Ga0436360_1047352_245_766 151
5 3300039447 Ga0436361_0248511 Ga0436361_0248511_380_901 151
6 iso_pu_bacteria 2558860280 2559422510 154
7 3300005435 Ga0070714_100684296 Ga0070714_1006842961 157
8 3300006028 Ga0070717_10097531 Ga0070717_100975314 157
9 3300025929 Ga0207664_10589224 Ga0207664_105892242 157
10 3300030521 Ga0307511_10000212 Ga0307511_100002122 157
11 3300032126 Ga0307415_102480641 Ga0307415_1024806411 157
12 3300044656 Ga0466969_0002858 Ga0466969_0002858_7952_8425 157
13 3300044684 Ga0466966_0090393 Ga0466966_0090393_991_1464 157
14 3300044684 Ga0466966_0113065 Ga0466966_0113065_1018_1491 157
15 3300044693 Ga0466961_0022958 Ga0466961_0022958_3018_3491 157
16 3300044693 Ga0466961_0095209 Ga0466961_0095209_132_605 157
17 3300044719 Ga0466971_0109726 Ga0466971_0109726_626_1099 157
18 3300044765 Ga0466970_0211597 Ga0466970_0211597_275_748 157
19 3300045049 Ga0466959_0047547 Ga0466959_0047547_663_1136 157
20 3300005539 Ga0068853_100006765 Ga0068853_1000067656 158
21 3300009551 Ga0105238_10008042 Ga0105238_1000804214 158
22 3300014325 Ga0163163_10958262 Ga0163163_109582622 158
23 3300025924 Ga0207694_11003920 Ga0207694_110039202 158
24 3300026041 Ga0207639_10149442 Ga0207639_101494422 158
25 3300005337 Ga0070682_100222994 Ga0070682_1002229943 159
26 3300005366 Ga0070659_101012161 Ga0070659_1010121612 159
27 3300025932 Ga0207690_10721471 Ga0207690_107214712 159
28 3300025944 Ga0207661_10119505 Ga0207661_101195052 159
29 3300026095 Ga0207676_10317574 Ga0207676_103175741 159
30 3300044694 Ga0466963_0235568 Ga0466963_0235568_388_870 160
31 3300045976 Ga0466967_0017755 Ga0466967_0017755_2904_3386 160
32 3300053153 Ga0500616_0014227 Ga0500616_0014227_2134_2622 162
33 3300005340 Ga0070689_101041778 Ga0070689_1010417781 163
34 3300048917 Ga0496114_0043256 Ga0496114_0043256_1309_1800 163
35 3300048922 Ga0496119_0022496 Ga0496119_0022496_2914_3405 163
36 3300005458 Ga0070681_10428014 Ga0070681_104280142 164
37 3300005535 Ga0070684_100368197 Ga0070684_1003681972 164
38 3300005937 Ga0081455_10344691 Ga0081455_103446911 164
39 3300006847 Ga0075431_100347488 Ga0075431_1003474883 164
40 3300009147 Ga0114129_10458558 Ga0114129_104585582 164
41 3300025920 Ga0207649_10711388 Ga0207649_107113882 164
42 3300025945 Ga0207679_10896735 Ga0207679_108967352 164
43 3300048915 Ga0496112_0291085 Ga0496112_0291085_776_1270 164
44 3300049575 Ga0501039_0142341 Ga0501039_0142341_612_1106 164
45 3300049579 Ga0501043_0379698 Ga0501043_0379698_66_560 164
46 3300049588 Ga0501072_0423264 Ga0501072_0423264_93_587 164
47 3300049591 Ga0501075_0046321 Ga0501075_0046321_2360_2854 164
48 3300049824 Ga0501045_1207016 Ga0501045_1207016_24_518 164
49 3300050507 nmdc:mga05p37_369871_c1 nmdc:mga05p37_369871_c1_674_1168 164
50 3300050508 nmdc:mga09592_464354_c1 nmdc:mga09592_464354_c1_224_718 164
51 3300050510 nmdc:mga06r32_861498_c1 nmdc:mga06r32_861498_c1_50_544 164
52 3300053149 Ga0500600_0329074 Ga0500600_0329074_31_525 164
53 3300054114 Ga0501084_0126104 Ga0501084_0126104_1483_1977 164
54 3300061734 Ga0530510_0082598 Ga0530510_0082598_757_1251 164
55 3300011119 Ga0105246_10291455 Ga0105246_102914552 165
56 3300041512 Ga0451853_0673164 Ga0451853_0673164_840_1337 165
57 3300044765 Ga0466970_0279245 Ga0466970_0279245_90_587 165
58 3300031901 Ga0307406_10846903 Ga0307406_108469032 166
59 3300053159 Ga0500630_198241 Ga0500630_198241_67_597 166
60 3300006844 Ga0075428_100792286 Ga0075428_1007922861 167
61 3300013102 Ga0157371_10001174 Ga0157371_1000117412 168
62 3300013105 Ga0157369_10422844 Ga0157369_104228441 168
63 3300026023 Ga0207677_10192421 Ga0207677_101924212 168
64 3300026067 Ga0207678_10262741 Ga0207678_102627411 168
65 3300031852 Ga0307410_10100970 Ga0307410_101009702 168
66 3300031903 Ga0307407_10089948 Ga0307407_100899482 168
67 3300031911 Ga0307412_10764797 Ga0307412_107647972 168
68 3300031995 Ga0307409_100206116 Ga0307409_1002061162 168
69 3300032126 Ga0307415_100516016 Ga0307415_1005160162 168
70 3300041413 Ga0439465_0204825 Ga0439465_0204825_133_639 168
71 3300048905 Ga0496102_0004164 Ga0496102_0004164_6558_7064 168
72 3300048906 Ga0496103_0020316 Ga0496103_0020316_1610_2116 168
73 iso_pu_bacteria 2862290372 2862297031 168
74 3300025909 Ga0207705_10603930 Ga0207705_106039301 169
75 3300044765 Ga0466970_0575853 Ga0466970_0575853_37_549 170
76 3300053085 Ga0495619_0407862 Ga0495619_0407862_314_856 170
77 3300048919 Ga0496116_0205041 Ga0496116_0205041_39_560 171
78 iso_pu_bacteria 2643221678 2644441229 171
79 3300049571 Ga0501034_0431788 Ga0501034_0431788_702_1220 172
80 3300035091 Ga0373951_0003915 Ga0373951_0003915_790_1332 173
81 3300045976 Ga0466967_0567398 Ga0466967_0567398_167_721 174
82 3300009148 Ga0105243_11380802 Ga0105243_113808021 175
83 3300039437 Ga0436365_1492923 Ga0436365_1492923_314_868 175
84 3300046674 Ga0495588_0225566 Ga0495588_0225566_299_826 175
85 3300003203 JGI25406J46586_10052559 JGI25406J46586_100525591 176
86 3300003316 rootH1_10104601 rootH1_101046012 176
87 3300005329 Ga0070683_100556534 Ga0070683_1005565341 176
88 3300005343 Ga0070687_100256976 Ga0070687_1002569762 176
89 3300005354 Ga0070675_101653302 Ga0070675_1016533021 176
90 3300005614 Ga0068856_101629641 Ga0068856_1016296411 176
91 3300005841 Ga0068863_101641391 Ga0068863_1016413911 176
92 3300005985 Ga0081539_10015750 Ga0081539_100157507 176
93 3300009098 Ga0105245_10166117 Ga0105245_101661173 176
94 3300010375 Ga0105239_12061579 Ga0105239_120615791 176
95 3300013307 Ga0157372_10182688 Ga0157372_101826882 176
96 3300025944 Ga0207661_10285988 Ga0207661_102859882 176
97 3300031247 Ga0265340_10014551 Ga0265340_100145511 176
98 3300037418 Ga0395900_0302214 Ga0395900_0302214_102_635 176
99 3300037466 Ga0395898_0210662 Ga0395898_0210662_1174_1707 176
100 3300047447 Ga0495685_154673 Ga0495685_154673_121_720 176
101 3300048904 Ga0496101_0229397 Ga0496101_0229397_438_974 176
102 3300048909 Ga0496106_0052387 Ga0496106_0052387_2141_2677 176
103 3300048911 Ga0496108_0036560 Ga0496108_0036560_198_734 176
104 3300048913 Ga0496110_0228765 Ga0496110_0228765_771_1307 176
105 3300048915 Ga0496112_0694495 Ga0496112_0694495_269_805 176
106 3300048916 Ga0496113_0137499 Ga0496113_0137499_1240_1776 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

24

143

0.84

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

39

165

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

58

145

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8551 62 168
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8484 58 169
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.8474 60 166
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8451 53 168
7rb3-assembly1.cif.gz_A cryo-em structure of human binary natc complex with a bisubstrate inhibitor 0.8432 9 169
ID Description Score Start End Superfamily
af_Q54BP5_22_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9824 28 167 3.40.630.30
af_Q54BP5_22_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9619 28 167 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8897 87 168 3.40.630.30
af_I1KF23_15_150_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8893 46 167 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8765 61 168 3.40.630.30
ID Description Score Start End GO Terms
AF-K8PSA1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9867 89 168 GO:0008080
AF-A0A7X0LGR2-F1-model_v4 DNA-binding MarR family transcriptional regulator/GNAT superfamily N-acetyltransferase 0.979 9 169 GO:0003677
GO:0003700
GO:0008080
AF-A0A0Q8U8D4-F1-model_v4 MarR family transcriptional regulator 0.9778 8 168 GO:0003700
GO:0008080
AF-A0A1H6BK29-F1-model_v4 Transcriptional regulator, MarR family with acetyltransferase activity 0.9663 3 168 GO:0003700
GO:0008080
AF-A0A6M0RNW5-F1-model_v4 GNAT family N-acetyltransferase 0.9611 13 168 GO:0008080

Feature Viewer

pLDDT pTM Quality
92.53 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map