F039454

General Info

Members Datasets Scaffolds Average Seq Length
106 78 106 203

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_1209117|Ga0451576_1209117_30_644
Length 204
Sequence VSQQTYRQALADYIRAQAKPPDKFSHQPRLYDWARRLGLAENRPFDDEVLYAAAWLHDLGVFIGHRPEEQAALATWDNVAYAVKEAPALLRQFGFPPEKIAAVSEVIRTHQPAAKPTSFEGVLLRDADILEQLGAVGVLRTVSKVGRDSRFVRFGDALRVLRCNLEQLPSQLQLPSARNMAEPRLAILKAFLEAADLETAGVES

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
15 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
30 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
31 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
32 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
33 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
38 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
41 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
42 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
43 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
44 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
45 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
46 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
47 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
56 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
57 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
58 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
59 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
60 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
61 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
62 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
63 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
64 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
65 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
66 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
69 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
70 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
71 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
72 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
73 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
74 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
75 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
77 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
78 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.94
Rhizosphere 93.4
Stem 0
Stem Tuber 0
Unclassified 5.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10046697 3300003320 Bacteria 6900
2 Ga0070658_10220815 3300005327 Bacteria 1603
3 Ga0070689_100267945 3300005340 Bacteria 1413
4 Ga0070689_100943920 3300005340 Unclassified 765
5 Ga0070688_100966969 3300005365 Bacteria 675
6 Ga0070667_100667780 3300005367 Unclassified 960
7 Ga0070711_100608350 3300005439 Bacteria 912
8 Ga0070681_10422355 3300005458 Unclassified 1245
9 Ga0070695_100313726 3300005545 Bacteria 1163
10 Ga0068855_100039195 3300005563 Bacteria 5625
11 Ga0068855_100136036 3300005563 Bacteria 2804
12 Ga0068856_100005190 3300005614 Bacteria 12859
13 Ga0068856_100076947 3300005614 Plasmid 3305
14 Ga0068863_100138298 3300005841 Bacteria 2327
15 Ga0070715_10122128 3300006163 Bacteria 1243
16 Ga0105240_10005936 3300009093 Bacteria 18087
17 Ga0105241_10160941 3300009174 Unclassified 1845
18 Ga0105242_10180186 3300009176 Unclassified 1864
19 Ga0105248_10819396 3300009177 Bacteria 1050
20 Ga0105238_10060201 3300009551 Unclassified 3802
21 Ga0157369_10006621 3300013105 Bacteria 13403
22 Ga0157372_10028659 3300013307 Bacteria 6079
23 Ga0157375_10000036 3300013308 Bacteria 177008
24 Ga0163163_10000064 3300014325 Bacteria 117551
25 Ga0163163_10131893 3300014325 Bacteria 2539
26 Ga0157376_10303556 3300014969 Bacteria 1512
27 Ga0207680_10106451 3300025903 Bacteria 1811
28 Ga0207695_10066865 3300025913 Bacteria 3689
29 Ga0207695_10142118 3300025913 Bacteria 2348
30 Ga0207670_10234655 3300025936 Bacteria 1410
31 Ga0207711_10734321 3300025941 Bacteria 921
32 Ga0207702_10037939 3300026078 Bacteria 4035
33 Ga0207702_10478624 3300026078 Bacteria 1211
34 Ga0268266_10283475 3300028379 Bacteria 1541
35 Ga0265337_1010143 3300028556 Bacteria 3314
36 Ga0265337_1014038 3300028556 Bacteria 2667
37 Ga0265319_1177541 3300028563 Unclassified 656
38 Ga0265334_10015452 3300028573 Bacteria 3171
39 Ga0265322_10113120 3300028654 Bacteria 773
40 Ga0265336_10018889 3300028666 Unclassified 2228
41 Ga0265338_10024252 3300028800 Bacteria 6202
42 Ga0265338_10096658 3300028800 Bacteria 2422
43 Ga0265338_10135611 3300028800 Bacteria 1935
44 Ga0265770_1053075 3300030878 Bacteria 738
45 Ga0265320_10033439 3300031240 Unclassified 2625
46 Ga0265339_10280519 3300031249 Bacteria 799
47 Ga0265342_10258352 3300031712 Unclassified 927
48 Ga0307516_10359829 3300031730 Bacteria 1120
49 Ga0373957_0038690 3300035120 Bacteria 1787
50 Ga0373955_0141431 3300035172 Unclassified 1411
51 Ga0373931_0223788 3300035691 Bacteria 1134
52 Ga0373927_0048470 3300035695 Bacteria 2748
53 Ga0373933_0015576 3300035724 Bacteria 4240
54 Ga0373947_0547411 3300035725 Unclassified 788
55 Ga0373937_0010196 3300036401 Bacteria 8199
56 Ga0373937_0292430 3300036401 Unclassified 1539
57 Ga0373925_0003057 3300037068 Bacteria 13153
58 Ga0395899_0569295 3300037312 Bacteria 726
59 Ga0395900_0715677 3300037418 Bacteria 934
60 Ga0395898_0460157 3300037466 Bacteria 1211
61 Ga0395898_0880234 3300037466 Bacteria 834
62 Ga0395901_0441620 3300038443 Unclassified 1332
63 Ga0451577_0009267 3300042876 Bacteria 9487
64 Ga0451577_0022438 3300042876 Bacteria 5763
65 Ga0451577_0694908 3300042876 Bacteria 921
66 Ga0453684_0034129 3300044712 Bacteria 7071
67 Ga0453684_0156718 3300044712 Unclassified 2699
68 Ga0453684_0259742 3300044712 Bacteria 1990
69 Ga0466959_0058675 3300045049 Bacteria 2803
70 Ga0466959_0059699 3300045049 Bacteria 2777
71 Ga0451576_0066478 3300045051 Bacteria 3753
72 Ga0451576_0405653 3300045051 Bacteria 1429
73 Ga0451576_1076342 3300045051 Unclassified 842
74 Ga0451576_1209117 3300045051 Unclassified 789
75 Ga0466958_0337994 3300045836 Bacteria 969
76 Ga0495592_0135306 3300046454 Unclassified 1720
77 Ga0495641_0011932 3300046461 Bacteria 4903
78 Ga0495582_0035741 3300046473 Bacteria 2733
79 Ga0495630_0000186 3300046517 Bacteria 48315
80 Ga0495630_0007812 3300046517 Bacteria 7660
81 Ga0495666_0270547 3300046526 Unclassified 771
82 Ga0495640_0569771 3300046533 Unclassified 685
83 Ga0495586_0000050 3300046535 Bacteria 70669
84 Ga0495586_0002193 3300046535 Bacteria 10602
85 Ga0495586_0295511 3300046535 Bacteria 928
86 Ga0495645_0003854 3300046543 Bacteria 10209
87 Ga0495645_0294296 3300046543 Unclassified 1063
88 Ga0495634_0064566 3300046642 Bacteria 2426
89 Ga0495634_0130559 3300046642 Bacteria 1602
90 Ga0495658_0266872 3300046683 Bacteria 1078
91 Ga0495613_0010010 3300046689 Bacteria 7042
92 Ga0495674_0006656 3300047319 Bacteria 11074
93 Ga0495674_0654747 3300047319 Bacteria 828
94 Ga0495676_0036314 3300047321 Unclassified 4116
95 Ga0495676_0108635 3300047321 Bacteria 2040
96 Ga0495684_0475331 3300047471 Unclassified 864
97 Ga0495686_0005986 3300047472 Bacteria 9464
98 Ga0496115_0402875 3300048918 Bacteria 1110
99 Ga0496120_0112875 3300048923 Bacteria 1417
100 Ga0496126_0000010 3300048929 Bacteria 744888
101 Ga0496126_0002849 3300048929 Bacteria 22624
102 Ga0496126_0198185 3300048929 Unclassified 1697
103 Ga0501033_0044452 3300049570 Bacteria 3307
104 Ga0501044_0040985 3300049823 Bacteria 4822
105 nmdc:mga08x19_313502_c1 3300050514 Bacteria 1091
106 Ga0495601_0068319 3300053077 Unclassified 2265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006163 Ga0070715_10122128 Ga0070715_101221282 186
2 3300035695 Ga0373927_0048470 Ga0373927_0048470_1556_2164 186
3 3300037068 Ga0373925_0003057 Ga0373925_0003057_11058_11666 186
4 3300046517 Ga0495630_0007812 Ga0495630_0007812_5277_5885 186
5 3300005340 Ga0070689_100943920 Ga0070689_1009439201 189
6 3300005365 Ga0070688_100966969 Ga0070688_1009669691 196
7 3300009177 Ga0105248_10819396 Ga0105248_108193962 197
8 3300025941 Ga0207711_10734321 Ga0207711_107343211 197
9 3300028379 Ga0268266_10283475 Ga0268266_102834751 197
10 3300042876 Ga0451577_0694908 Ga0451577_0694908_220_822 197
11 3300048918 Ga0496115_0402875 Ga0496115_0402875_444_1046 197
12 3300049570 Ga0501033_0044452 Ga0501033_0044452_2245_2901 197
13 3300049823 Ga0501044_0040985 Ga0501044_0040985_2938_3603 197
14 3300005458 Ga0070681_10422355 Ga0070681_104223552 198
15 3300005563 Ga0068855_100039195 Ga0068855_1000391954 198
16 3300005614 Ga0068856_100076947 Ga0068856_1000769472 198
17 3300009093 Ga0105240_10005936 Ga0105240_100059364 198
18 3300009174 Ga0105241_10160941 Ga0105241_101609412 198
19 3300009551 Ga0105238_10060201 Ga0105238_100602012 198
20 3300013105 Ga0157369_10006621 Ga0157369_100066215 198
21 3300013307 Ga0157372_10028659 Ga0157372_100286592 198
22 3300025913 Ga0207695_10066865 Ga0207695_100668653 198
23 3300025913 Ga0207695_10142118 Ga0207695_101421183 198
24 3300026078 Ga0207702_10478624 Ga0207702_104786242 198
25 3300028800 Ga0265338_10096658 Ga0265338_100966581 198
26 3300030878 Ga0265770_1053075 Ga0265770_10530751 198
27 3300031712 Ga0265342_10258352 Ga0265342_102583521 198
28 3300037312 Ga0395899_0569295 Ga0395899_0569295_13_618 198
29 3300037418 Ga0395900_0715677 Ga0395900_0715677_282_887 198
30 3300037466 Ga0395898_0460157 Ga0395898_0460157_241_846 198
31 3300037466 Ga0395898_0880234 Ga0395898_0880234_70_675 198
32 3300038443 Ga0395901_0441620 Ga0395901_0441620_424_1029 198
33 3300045049 Ga0466959_0058675 Ga0466959_0058675_1467_2072 198
34 3300045049 Ga0466959_0059699 Ga0466959_0059699_1536_2141 198
35 3300045051 Ga0451576_0405653 Ga0451576_0405653_103_708 198
36 3300045836 Ga0466958_0337994 Ga0466958_0337994_173_778 198
37 3300046535 Ga0495586_0295511 Ga0495586_0295511_214_828 198
38 3300048929 Ga0496126_0000010 Ga0496126_0000010_80251_80856 198
39 3300003320 rootH2_10046697 rootH2_100466974 199
40 3300005327 Ga0070658_10220815 Ga0070658_102208152 199
41 3300005340 Ga0070689_100267945 Ga0070689_1002679451 199
42 3300005367 Ga0070667_100667780 Ga0070667_1006677801 199
43 3300005439 Ga0070711_100608350 Ga0070711_1006083501 199
44 3300005545 Ga0070695_100313726 Ga0070695_1003137262 199
45 3300005563 Ga0068855_100136036 Ga0068855_1001360364 199
46 3300005614 Ga0068856_100005190 Ga0068856_10000519011 199
47 3300005841 Ga0068863_100138298 Ga0068863_1001382983 199
48 3300009176 Ga0105242_10180186 Ga0105242_101801862 199
49 3300013308 Ga0157375_10000036 Ga0157375_10000036132 199
50 3300014325 Ga0163163_10000064 Ga0163163_1000006482 199
51 3300014325 Ga0163163_10131893 Ga0163163_101318932 199
52 3300014969 Ga0157376_10303556 Ga0157376_103035562 199
53 3300025903 Ga0207680_10106451 Ga0207680_101064512 199
54 3300025936 Ga0207670_10234655 Ga0207670_102346551 199
55 3300026078 Ga0207702_10037939 Ga0207702_100379392 199
56 3300028556 Ga0265337_1010143 Ga0265337_10101431 199
57 3300028556 Ga0265337_1014038 Ga0265337_10140385 199
58 3300028563 Ga0265319_1177541 Ga0265319_11775411 199
59 3300028573 Ga0265334_10015452 Ga0265334_100154522 199
60 3300028654 Ga0265322_10113120 Ga0265322_101131201 199
61 3300028666 Ga0265336_10018889 Ga0265336_100188892 199
62 3300028800 Ga0265338_10024252 Ga0265338_100242525 199
63 3300028800 Ga0265338_10135611 Ga0265338_101356112 199
64 3300031240 Ga0265320_10033439 Ga0265320_100334392 199
65 3300031249 Ga0265339_10280519 Ga0265339_102805191 199
66 3300031730 Ga0307516_10359829 Ga0307516_103598291 199
67 3300035120 Ga0373957_0038690 Ga0373957_0038690_441_1049 199
68 3300035172 Ga0373955_0141431 Ga0373955_0141431_303_911 199
69 3300035691 Ga0373931_0223788 Ga0373931_0223788_485_1093 199
70 3300035724 Ga0373933_0015576 Ga0373933_0015576_32_640 199
71 3300035725 Ga0373947_0547411 Ga0373947_0547411_60_668 199
72 3300036401 Ga0373937_0010196 Ga0373937_0010196_7111_7719 199
73 3300036401 Ga0373937_0292430 Ga0373937_0292430_266_874 199
74 3300042876 Ga0451577_0009267 Ga0451577_0009267_4164_4772 199
75 3300042876 Ga0451577_0022438 Ga0451577_0022438_2830_3441 199
76 3300044712 Ga0453684_0034129 Ga0453684_0034129_6113_6721 199
77 3300044712 Ga0453684_0156718 Ga0453684_0156718_915_1523 199
78 3300044712 Ga0453684_0259742 Ga0453684_0259742_1086_1724 199
79 3300045051 Ga0451576_0066478 Ga0451576_0066478_2307_2906 199
80 3300045051 Ga0451576_1076342 Ga0451576_1076342_134_745 199
81 3300045051 Ga0451576_1209117 Ga0451576_1209117_30_644 199
82 3300046454 Ga0495592_0135306 Ga0495592_0135306_357_962 199
83 3300046461 Ga0495641_0011932 Ga0495641_0011932_1529_2137 199
84 3300046473 Ga0495582_0035741 Ga0495582_0035741_950_1558 199
85 3300046517 Ga0495630_0000186 Ga0495630_0000186_19318_19926 199
86 3300046526 Ga0495666_0270547 Ga0495666_0270547_41_649 199
87 3300046533 Ga0495640_0569771 Ga0495640_0569771_14_622 199
88 3300046535 Ga0495586_0000050 Ga0495586_0000050_60193_60801 199
89 3300046535 Ga0495586_0002193 Ga0495586_0002193_7026_7634 199
90 3300046543 Ga0495645_0003854 Ga0495645_0003854_5322_5921 199
91 3300046543 Ga0495645_0294296 Ga0495645_0294296_303_911 199
92 3300046642 Ga0495634_0064566 Ga0495634_0064566_644_1252 199
93 3300046642 Ga0495634_0130559 Ga0495634_0130559_119_727 199
94 3300046683 Ga0495658_0266872 Ga0495658_0266872_315_923 199
95 3300046689 Ga0495613_0010010 Ga0495613_0010010_5494_6102 199
96 3300047319 Ga0495674_0006656 Ga0495674_0006656_10054_10662 199
97 3300047319 Ga0495674_0654747 Ga0495674_0654747_82_693 199
98 3300047321 Ga0495676_0036314 Ga0495676_0036314_38_646 199
99 3300047321 Ga0495676_0108635 Ga0495676_0108635_977_1585 199
100 3300047471 Ga0495684_0475331 Ga0495684_0475331_81_689 199
101 3300047472 Ga0495686_0005986 Ga0495686_0005986_2234_2842 199
102 3300048923 Ga0496120_0112875 Ga0496120_0112875_406_1041 199
103 3300048929 Ga0496126_0002849 Ga0496126_0002849_21768_22403 199
104 3300048929 Ga0496126_0198185 Ga0496126_0198185_583_1230 199
105 3300050514 nmdc:mga08x19_313502_c1 nmdc:mga08x19_313502_c1_354_962 199
106 3300053077 Ga0495601_0068319 Ga0495601_0068319_365_982 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

24

133

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dqv-assembly1.cif.gz_B the crystal structure of bacillus subtilis ypgq 0.8314 1 197
3gw7-assembly1.cif.gz_B crystal structure of a metal-dependent phosphohydrolase with conserved hd domain (yedj) from escherichia coli in complex with nickel ions. northeast structural genomics consortium target er63 0.8168 26 196
5dqv-assembly1.cif.gz_B the crystal structure of bacillus subtilis ypgq 0.8106 1 197
5ihy-assembly1.cif.gz_A the crystal structure of bacillus subtilis semet-ypgq 0.7947 3 198
3b57-assembly1.cif.gz_A-2 crystal structure of the lin1889 protein (q92an1) from listeria innocua. northeast structural consortium target lkr65 0.7872 1 194
ID Description Score Start End Superfamily
3gw7B00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432; 0.8168 26 196 1.10.3210.50
2pq7A00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7607 3 196 1.10.3210.10
af_Q8GUM8_114_222_1.20.58.1910 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7538 116 199 1.20.58.1910
af_C6T179_106_223_1.20.58.1910 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7538 116 199 1.20.58.1910
af_Q337J5_106_224_1.20.58.1910 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7514 115 199 1.20.58.1910
ID Description Score Start End GO Terms
AF-A0A0P6XC34-F1-model_v4 Phosphohydrolase 0.9758 12 196 GO:0016787
AF-A0A1V6GEN7-F1-model_v4 deleted 0.954 1 196
AF-A0A1G7QN45-F1-model_v4 HD domain-containing protein 0.9496 2 196
AF-E6QJQ2-F1-model_v4 HD superfamily hydrolase 0.9469 1 196 GO:0016787
AF-A0A354TR10-F1-model_v4 Uncharacterized protein 0.9459 109 196

Feature Viewer

pLDDT pTM Quality
92.07 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map