F034997

General Info

Members Datasets Scaffolds Average Seq Length
105 85 104 453

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221603|2644028336
Length 497
Sequence VIDIYALELAARGVVVSEPMLLAKDDNMQSINPHSGQVVRSYDPQDDAEVDRLLSAAETAFHDWKKSSFTDRAQLMKTAGATLRDRKEQLAELMADEMGKVMRDGIAEIEKCAGCCDYYADNAQRFLASHAVPTDAEDSYIAFDPLGPVLAIMPWNFPFWQIFRFAAPALMAGNVGVLKHASNVSGCALAIQDIFKTAGFPAHAFTSLLIESARVERVIRHPAIKAVTLTGSTPAGRSVATTAGSELKKTVLELGGSDAYVVLDDADLDAAVDICVKSRLINAGQSCIAAKRFIVAKSLRTQFEKAYAERFEKIRYGNPRDENSNIGPMARVDLRDEIHRQVEESIRQGARLLTGGKIPAGEGAYYPPTVLTDVMPGMVAFDEEIFGPVAAIIEASNEDHAIELANQSPFGLGAALFTRDKERANRLARRIEAGSVFINAFVKSDVRLPFGGVKQSGYGRELSWFGIQEFVNVKTIYHARIEAATGAASKASGGALE

Samples

Sample ID Description Type Environment
1 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
48 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
49 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
50 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
65 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
66 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
67 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
68 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
71 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
72 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
73 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
74 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
77 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
78 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
81 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
82 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
83 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
84 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
85 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.86
Nodule 0
Rhizoplane 6.67
Rhizosphere 88.57
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10003622 3300001990 Bacteria 5444
2 Ga0070683_100096424 3300005329 Bacteria 2781
3 Ga0070680_100001680 3300005336 Bacteria 16209
4 Ga0070682_100001021 3300005337 Bacteria 16160
5 Ga0070674_100033137 3300005356 Bacteria 3437
6 Ga0070688_100048223 3300005365 Bacteria 2646
7 Ga0070701_10049986 3300005438 Bacteria 2163
8 Ga0070711_100083395 3300005439 Bacteria 2284
9 Ga0070708_100003229 3300005445 Bacteria 12717
10 Ga0070681_10047431 3300005458 Bacteria 4294
11 Ga0068867_100087924 3300005459 Bacteria 2354
12 Ga0068867_100182190 3300005459 Bacteria 1671
13 Ga0070698_100033174 3300005471 Bacteria 5348
14 Ga0070698_100035181 3300005471 Bacteria 5180
15 Ga0070679_100007027 3300005530 Bacteria 10499
16 Ga0070684_100087500 3300005535 Bacteria 2766
17 Ga0070672_100023111 3300005543 Bacteria 4578
18 Ga0070695_100000342 3300005545 Bacteria 23875
19 Ga0068855_100008427 3300005563 Bacteria 12469
20 Ga0070664_100135307 3300005564 Bacteria 2167
21 Ga0068859_100009518 3300005617 Bacteria 9811
22 Ga0075434_100001115 3300006871 Bacteria 22053
23 Ga0097620_100009518 3300006931 Bacteria 9811
24 Ga0105240_10295919 3300009093 Bacteria 1853
25 Ga0111539_10008114 3300009094 Bacteria 13378
26 Ga0111539_10071513 3300009094 Bacteria 4093
27 Ga0114129_10047390 3300009147 Bacteria 6039
28 Ga0105237_10091162 3300009545 Bacteria 3037
29 Ga0157378_10031393 3300013297 Bacteria 4693
30 Ga0157375_10041012 3300013308 Bacteria 4467
31 Ga0207682_10067784 3300025893 Bacteria 1507
32 Ga0207642_10055220 3300025899 Bacteria 1815
33 Ga0207699_10025617 3300025906 Bacteria 3240
34 Ga0207671_10091440 3300025914 Bacteria 2293
35 Ga0207646_10020800 3300025922 Bacteria 6076
36 Ga0207659_10074794 3300025926 Bacteria 2484
37 Ga0207659_10232443 3300025926 Bacteria 1488
38 Ga0207706_10034054 3300025933 Bacteria 4533
39 Ga0207670_10037189 3300025936 Bacteria 3171
40 Ga0207665_10000498 3300025939 Bacteria 26564
41 Ga0207691_10122028 3300025940 Unclassified 2308
42 Ga0207661_10056861 3300025944 Bacteria 3142
43 Ga0207708_10121789 3300026075 Bacteria 2033
44 Ga0207648_10015455 3300026089 Bacteria 7020
45 Ga0209999_1006410 3300027543 Bacteria 2114
46 Ga0265338_10120755 3300028800 Bacteria 2089
47 Ga0307410_10010508 3300031852 Bacteria 5248
48 Ga0307407_10075343 3300031903 Bacteria 2022
49 Ga0307411_10089786 3300032005 Bacteria 2141
50 Ga0373959_0001685 3300034820 Bacteria 3518
51 Ga0373941_0002063 3300035115 Bacteria 4359
52 Ga0316582_0044411 3300036647 Bacteria 2793
53 Ga0395899_0001527 3300037312 Bacteria 19557
54 Ga0395899_0003134 3300037312 Bacteria 13163
55 Ga0395899_0013173 3300037312 Bacteria 6324
56 Ga0395900_0139171 3300037418 Bacteria 2486
57 Ga0395900_0140216 3300037418 Bacteria 2476
58 Ga0395900_0181500 3300037418 Bacteria 2138
59 Ga0395898_0046432 3300037466 Bacteria 4266
60 Ga0395898_0133452 3300037466 Bacteria 2377
61 Ga0395905_0011996 3300037471 Bacteria 8358
62 Ga0395905_0217001 3300037471 Bacteria 1791
63 Ga0395905_0250257 3300037471 Bacteria 1655
64 Ga0395901_0002171 3300038443 Bacteria 20034
65 Ga0395901_0013966 3300038443 Bacteria 8172
66 Ga0395901_0081839 3300038443 Bacteria 3372
67 Ga0395901_0101866 3300038443 Bacteria 3013
68 Ga0436363_0859843 3300039450 Bacteria 2742
69 Ga0451577_0046467 3300042876 Bacteria 3884
70 Ga0451577_0205266 3300042876 Bacteria 1779
71 Ga0453683_0004512 3300044673 Bacteria 9866
72 Ga0466966_0035297 3300044684 Bacteria 3230
73 Ga0453684_0065476 3300044712 Bacteria 4634
74 Ga0466970_0003664 3300044765 Bacteria 7502
75 Ga0466959_0008242 3300045049 Bacteria 7357
76 Ga0451576_0063933 3300045051 Bacteria 3834
77 Ga0451576_0148071 3300045051 Bacteria 2448
78 Ga0466958_0081725 3300045836 Bacteria 1989
79 Ga0495643_0067851 3300046522 Bacteria 1878
80 Ga0495661_0046584 3300046665 Bacteria 2646
81 Ga0495658_0128342 3300046683 Bacteria 1541
82 Ga0495687_008283 3300047443 Bacteria 5975
83 Ga0495687_017889 3300047443 Bacteria 3518
84 Ga0495686_0000124 3300047472 Bacteria 159708
85 Ga0496102_0063156 3300048905 Bacteria 3390
86 Ga0496103_0059943 3300048906 Bacteria 2365
87 Ga0496104_0231357 3300048907 Bacteria 1760
88 Ga0496105_0144073 3300048908 Bacteria 1960
89 Ga0496110_0044338 3300048913 Bacteria 3884
90 Ga0496111_0109472 3300048914 Bacteria 2034
91 Ga0496112_0000612 3300048915 Bacteria 24619
92 Ga0501075_0131918 3300049591 Bacteria 1903
93 Ga0501081_0035362 3300049743 Bacteria 3400
94 Ga0501280_000004 3300049776 Bacteria 87510
95 nmdc:mga05p37_108985_c1 3300050507 Bacteria 3406
96 nmdc:mga05p37_359711_c1 3300050507 Bacteria 1711
97 nmdc:mga08y16_35932_c1 3300050511 Bacteria 5203
98 nmdc:mga08y16_55042_c1 3300050511 Bacteria 4158
99 nmdc:mga0n895_6391_c1 3300050512 Bacteria 10003
100 nmdc:mga0a205_103438_c1 3300050515 Bacteria 2746
101 Ga0500595_016540 3300053119 Bacteria 2745
102 Ga0500622_0000034 3300053156 Bacteria 187647
103 Ga0500622_0000235 3300053156 Bacteria 57565
104 Ga0501084_0043059 3300054114 Bacteria 3777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0044411 Ga0316582_0044411_1629_2777 382
2 3300045051 Ga0451576_0063933 Ga0451576_0063933_2662_3813 383
3 3300025893 Ga0207682_10067784 Ga0207682_100677842 393
4 3300025933 Ga0207706_10034054 Ga0207706_100340543 412
5 3300031852 Ga0307410_10010508 Ga0307410_100105084 414
6 3300031903 Ga0307407_10075343 Ga0307407_100753431 414
7 3300032005 Ga0307411_10089786 Ga0307411_100897862 414
8 3300005336 Ga0070680_100001680 Ga0070680_1000016802 415
9 3300005337 Ga0070682_100001021 Ga0070682_1000010212 415
10 3300005458 Ga0070681_10047431 Ga0070681_100474311 415
11 3300005530 Ga0070679_100007027 Ga0070679_1000070278 415
12 3300027543 Ga0209999_1006410 Ga0209999_10064102 415
13 3300025899 Ga0207642_10055220 Ga0207642_100552202 429
14 3300050511 nmdc:mga08y16_35932_c1 nmdc:mga08y16_35932_c1_1341_2705 433
15 3300050507 nmdc:mga05p37_359711_c1 nmdc:mga05p37_359711_c1_62_1426 436
16 3300005545 Ga0070695_100000342 Ga0070695_10000034218 437
17 3300044673 Ga0453683_0004512 Ga0453683_0004512_2139_3539 438
18 3300045051 Ga0451576_0148071 Ga0451576_0148071_49_1449 439
19 3300038443 Ga0395901_0081839 Ga0395901_0081839_1993_3348 441
20 3300053156 Ga0500622_0000235 Ga0500622_0000235_28776_30128 441
21 3300053156 Ga0500622_0000034 Ga0500622_0000034_15617_16969 442
22 3300053119 Ga0500595_016540 Ga0500595_016540_1368_2729 443
23 3300009147 Ga0114129_10047390 Ga0114129_100473906 444
24 3300025926 Ga0207659_10232443 Ga0207659_102324432 444
25 3300050507 nmdc:mga05p37_108985_c1 nmdc:mga05p37_108985_c1_122_1519 444
26 3300048905 Ga0496102_0063156 Ga0496102_0063156_471_1859 446
27 3300048906 Ga0496103_0059943 Ga0496103_0059943_638_2026 446
28 3300048907 Ga0496104_0231357 Ga0496104_0231357_341_1729 446
29 3300048908 Ga0496105_0144073 Ga0496105_0144073_151_1539 446
30 3300048913 Ga0496110_0044338 Ga0496110_0044338_2012_3400 446
31 3300048914 Ga0496111_0109472 Ga0496111_0109472_26_1414 446
32 3300046665 Ga0495661_0046584 Ga0495661_0046584_478_1854 448
33 3300047443 Ga0495687_017889 Ga0495687_017889_1572_2948 448
34 3300009094 Ga0111539_10071513 Ga0111539_100715132 450
35 3300050511 nmdc:mga08y16_55042_c1 nmdc:mga08y16_55042_c1_932_2284 450
36 3300009094 Ga0111539_10008114 Ga0111539_1000811411 451
37 3300049776 Ga0501280_000004 Ga0501280_000004_69725_71095 451
38 3300005365 Ga0070688_100048223 Ga0070688_1000482232 453
39 3300005438 Ga0070701_10049986 Ga0070701_100499861 453
40 3300005471 Ga0070698_100033174 Ga0070698_1000331743 453
41 3300005543 Ga0070672_100023111 Ga0070672_1000231114 453
42 3300005617 Ga0068859_100009518 Ga0068859_1000095188 453
43 3300006931 Ga0097620_100009518 Ga0097620_1000095184 453
44 3300013308 Ga0157375_10041012 Ga0157375_100410124 453
45 3300025936 Ga0207670_10037189 Ga0207670_100371892 453
46 3300042876 Ga0451577_0046467 Ga0451577_0046467_1943_3304 453
47 3300042876 Ga0451577_0205266 Ga0451577_0205266_234_1595 453
48 3300044712 Ga0453684_0065476 Ga0453684_0065476_3147_4508 453
49 3300005445 Ga0070708_100003229 Ga0070708_1000032299 454
50 3300025922 Ga0207646_10020800 Ga0207646_100208005 454
51 3300025926 Ga0207659_10074794 Ga0207659_100747943 454
52 3300028800 Ga0265338_10120755 Ga0265338_101207552 454
53 3300046683 Ga0495658_0128342 Ga0495658_0128342_68_1432 454
54 3300050515 nmdc:mga0a205_103438_c1 nmdc:mga0a205_103438_c1_1366_2730 454
55 3300044765 Ga0466970_0003664 Ga0466970_0003664_116_1522 455
56 3300045836 Ga0466958_0081725 Ga0466958_0081725_588_1964 458
57 3300047472 Ga0495686_0000124 Ga0495686_0000124_12571_13950 459
58 3300005563 Ga0068855_100008427 Ga0068855_1000084271 460
59 3300005564 Ga0070664_100135307 Ga0070664_1001353072 461
60 3300026089 Ga0207648_10015455 Ga0207648_100154553 461
61 3300037418 Ga0395900_0140216 Ga0395900_0140216_109_1500 462
62 3300038443 Ga0395901_0002171 Ga0395901_0002171_16214_17605 462
63 3300005459 Ga0068867_100182190 Ga0068867_1001821901 463
64 3300025940 Ga0207691_10122028 Ga0207691_101220282 463
65 3300037312 Ga0395899_0001527 Ga0395899_0001527_2023_3429 463
66 3300037312 Ga0395899_0003134 Ga0395899_0003134_623_2029 463
67 3300037312 Ga0395899_0013173 Ga0395899_0013173_4399_5805 463
68 3300037418 Ga0395900_0139171 Ga0395900_0139171_485_1891 463
69 3300037418 Ga0395900_0181500 Ga0395900_0181500_305_1711 463
70 3300037466 Ga0395898_0133452 Ga0395898_0133452_330_1736 463
71 3300037471 Ga0395905_0217001 Ga0395905_0217001_223_1644 463
72 3300038443 Ga0395901_0013966 Ga0395901_0013966_5305_6711 463
73 3300038443 Ga0395901_0101866 Ga0395901_0101866_1368_2774 463
74 3300047443 Ga0495687_008283 Ga0495687_008283_69_1484 463
75 3300039450 Ga0436363_0859843 Ga0436363_0859843_818_2212 464
76 3300049591 Ga0501075_0131918 Ga0501075_0131918_257_1651 464
77 3300049743 Ga0501081_0035362 Ga0501081_0035362_1326_2720 464
78 3300054114 Ga0501084_0043059 Ga0501084_0043059_1280_2674 464
79 3300005329 Ga0070683_100096424 Ga0070683_1000964242 465
80 3300005356 Ga0070674_100033137 Ga0070674_1000331373 465
81 3300005439 Ga0070711_100083395 Ga0070711_1000833952 465
82 3300005459 Ga0068867_100087924 Ga0068867_1000879241 465
83 3300005535 Ga0070684_100087500 Ga0070684_1000875002 465
84 3300006871 Ga0075434_100001115 Ga0075434_1000011157 465
85 3300009093 Ga0105240_10295919 Ga0105240_102959192 465
86 3300013297 Ga0157378_10031393 Ga0157378_100313932 465
87 3300025906 Ga0207699_10025617 Ga0207699_100256174 465
88 3300025939 Ga0207665_10000498 Ga0207665_1000049824 465
89 3300025944 Ga0207661_10056861 Ga0207661_100568614 465
90 3300026075 Ga0207708_10121789 Ga0207708_101217892 465
91 3300034820 Ga0373959_0001685 Ga0373959_0001685_1161_2558 465
92 3300035115 Ga0373941_0002063 Ga0373941_0002063_2560_3957 465
93 3300037466 Ga0395898_0046432 Ga0395898_0046432_1942_3354 465
94 3300044684 Ga0466966_0035297 Ga0466966_0035297_715_2115 465
95 3300045049 Ga0466959_0008242 Ga0466959_0008242_5861_7261 465
96 3300046522 Ga0495643_0067851 Ga0495643_0067851_442_1839 465
97 3300048915 Ga0496112_0000612 Ga0496112_0000612_11766_13163 465
98 3300050512 nmdc:mga0n895_6391_c1 nmdc:mga0n895_6391_c1_3177_4574 465
99 3300005471 Ga0070698_100035181 Ga0070698_1000351816 467
100 3300009545 Ga0105237_10091162 Ga0105237_100911623 468
101 3300025914 Ga0207671_10091440 Ga0207671_100914402 468
102 iso_pu_bacteria 2643221603 2644028336 478
103 3300001990 JGI24737J22298_10003622 JGI24737J22298_100036222 479
104 3300037471 Ga0395905_0011996 Ga0395905_0011996_5394_6833 479
105 3300037471 Ga0395905_0250257 Ga0395905_0250257_36_1475 479

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

21

476

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3efv-assembly1.cif.gz_A crystal structure of a putative succinate-semialdehyde dehydrogenase from salmonella typhimurium lt2 with bound nad 0.9759 15 470
3vz0-assembly2.cif.gz_C structural insights into cofactor and substrate selection by gox0499 0.9742 15 468
4it9-assembly1.cif.gz_B structure of bacterial enzyme 0.9714 16 468
3vz3-assembly1.cif.gz_B structural insights into substrate and cofactor selection by sp2771 0.9706 16 468
3vz2-assembly1.cif.gz_A structural insights into substrate and cofactor selection by sp2771 0.9706 16 468
ID Description Score Start End Superfamily
af_P9WNX9_3_238_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.983 16 246 3.40.605.10
af_P76149_8_455_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9784 16 463 2.40.10.10
af_P9WNX9_1_452_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9779 15 463 3.40.605.10
af_P76149_8_455_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9741 16 463 2.40.10.10
af_P9WNX9_1_452_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9694 15 463 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A1F8WJH0-F1-model_v4 Succinate-semialdehyde dehydrogenase 0.9869 15 468 GO:0004030
GO:0004777
AF-A0A0L8V6G4-F1-model_v4 Succinate-semialdehyde dehdyrogenase 0.9866 58 468 GO:0004030
GO:0004777
AF-A0A660Z5C5-F1-model_v4 NAD-dependent succinate-semialdehyde dehydrogenase 0.9863 162 468 GO:0004777
AF-A0A2E9ZAN8-F1-model_v4 Succinate-semialdehyde dehydrogenase 0.986 16 468 GO:0004030
GO:0004777
AF-A0A7T9QII3-F1-model_v4 deleted 0.9834 16 468

Feature Viewer

pLDDT pTM Quality
91.22 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map