F034856

General Info

Members Datasets Scaffolds Average Seq Length
105 87 210 308

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0061112|Ga0500568_0061112_433_1425
Length 330
Sequence MQRITWLVALALAGCPAQSTTEVQEPGFGPQPMDGGGAAGPIDGLDQATVDPSTLGERQDHLVDFAFEGGALEFDLYRKGTELTQIVRNRYMVPVVIRWDITTFANVRGTSPLSGSTFIPAADRANGAGPWVKLATLQQIDATVGYRRALVFRGRWGDPRSRPEQYAYALPFTKGSSYSVLQGFHGEFSHKGSNEYAIDFDCPVATTVRASREGIVVAANAEAVGSGNTRDFLDHKKVNFVLILHDDGTLGEYMHLAPSSLSVQAGERVKRGQTIALSGNTGYSSTPHLHFQLMTAGIDGISALSFPFEFAIGHDNSEEPVQGKRYTAFE

Samples

Sample ID Description Type Environment
1 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
49 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
50 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
51 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
52 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
59 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
60 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
61 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
62 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
64 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
65 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
66 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
67 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
68 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
69 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
70 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
71 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
72 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
73 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
74 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
75 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
76 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
77 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
78 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
79 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
80 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
81 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
82 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
83 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
84 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
85 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
86 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.81
Nodule 0
Rhizoplane 0
Rhizosphere 64.76
Stem 0
Stem Tuber 0
Unclassified 18.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500568_0061112 3300053139 Unclassified 1458
2 rootL2_10297113 3300003322 Unclassified 1668
3 Ga0070690_100038880 3300005330 Bacteria 3004
4 Ga0070690_100286630 3300005330 Bacteria 1177
5 Ga0068869_100034004 3300005334 Unclassified 3603
6 Ga0068868_100110388 3300005338 Bacteria 2234
7 Ga0070689_100041980 3300005340 Unclassified 3512
8 Ga0070689_100170135 3300005340 Bacteria 1765
9 Ga0070708_100050752 3300005445 Bacteria 3674
10 Ga0070678_100042907 3300005456 Unclassified 3218
11 Ga0070706_100030176 3300005467 Bacteria 4994
12 Ga0070698_100004589 3300005471 Bacteria 15169
13 Ga0070679_100059861 3300005530 Bacteria 3795
14 Ga0070665_100037107 3300005548 Bacteria 4901
15 Ga0068855_100447661 3300005563 Bacteria 1410
16 Ga0068857_100506706 3300005577 Unclassified 1133
17 Ga0068856_100122722 3300005614 Unclassified 2600
18 Ga0068866_10212096 3300005718 Bacteria 1163
19 Ga0068863_100251831 3300005841 Unclassified 1706
20 Ga0068860_100339813 3300005843 Bacteria 1476
21 Ga0070717_10155893 3300006028 Bacteria 1978
22 Ga0068865_100048543 3300006881 Bacteria 2922
23 Ga0075435_100185752 3300007076 Bacteria 1758
24 Ga0105245_10000072 3300009098 Bacteria 105617
25 Ga0105245_10115138 3300009098 Unclassified 2505
26 Ga0105243_10130134 3300009148 Bacteria 2134
27 Ga0105249_10069642 3300009553 Bacteria 3247
28 Ga0105239_10194793 3300010375 Unclassified 2269
29 Ga0157374_10210195 3300013296 Unclassified 1908
30 Ga0157376_10010341 3300014969 Bacteria 6818
31 Ga0207684_10043343 3300025910 Bacteria 3815
32 Ga0207662_10115907 3300025918 Bacteria 1675
33 Ga0207652_10130805 3300025921 Bacteria 2238
34 Ga0207687_10003619 3300025927 Bacteria 10413
35 Ga0207686_10188941 3300025934 Bacteria 1467
36 Ga0207670_10029963 3300025936 Unclassified 3472
37 Ga0207670_10053038 3300025936 Bacteria 2729
38 Ga0207689_10175075 3300025942 Bacteria 1769
39 Ga0207661_10304881 3300025944 Bacteria 1429
40 Ga0207676_10533744 3300026095 Unclassified 1119
41 Ga0207674_10511344 3300026116 Unclassified 1160
42 Ga0207675_100309601 3300026118 Unclassified 1540
43 Ga0207683_10017194 3300026121 Bacteria 6159
44 Ga0268266_10008346 3300028379 Bacteria 9219
45 Ga0268264_10408125 3300028381 Bacteria 1307
46 Ga0307517_10121530 3300028786 Bacteria 1928
47 Ga0307515_10013481 3300028794 Bacteria 15272
48 Ga0265338_10027053 3300028800 Bacteria 5765
49 Ga0265338_10247287 3300028800 Bacteria 1317
50 Ga0307513_10001795 3300031456 Bacteria 30489
51 Ga0307509_10000012 3300031507 Bacteria 285083
52 Ga0307509_10017359 3300031507 Bacteria 8287
53 Ga0307509_10034426 3300031507 Bacteria 5565
54 Ga0307509_10085364 3300031507 Bacteria 3249
55 Ga0307509_10175644 3300031507 Unclassified 2015
56 Ga0307516_10015788 3300031730 Bacteria 7931
57 Ga0307516_10054562 3300031730 Bacteria 3904
58 Ga0373949_0000569 3300035090 Bacteria 12147
59 Ga0373936_0000009 3300035113 Bacteria 263478
60 Ga0373941_0042134 3300035115 Bacteria 1416
61 Ga0373956_0040740 3300035119 Bacteria 2061
62 Ga0373961_0000154 3300035241 Bacteria 33086
63 Ga0395899_0031540 3300037312 Bacteria 3982
64 Ga0395900_0250786 3300037418 Unclassified 1771
65 Ga0395898_0026083 3300037466 Bacteria 5884
66 Ga0395905_0158514 3300037471 Bacteria 2128
67 Ga0395905_0693444 3300037471 Bacteria 921
68 Ga0395901_0076954 3300038443 Bacteria 3482
69 Ga0436365_0406596 3300039437 Bacteria 2440
70 Ga0495590_0052506 3300046457 Bacteria 1424
71 Ga0495622_0089290 3300046557 Bacteria 1416
72 Ga0495686_0041831 3300047472 Bacteria 2916
73 Ga0495686_0120992 3300047472 Bacteria 1560
74 Ga0501047_0017944 3300049581 Bacteria 6782
75 Ga0501070_0035373 3300049586 Bacteria 4174
76 Ga0501071_0036821 3300049587 Bacteria 3490
77 Ga0501072_0042121 3300049588 Bacteria 3587
78 Ga0501216_009003 3300049660 Bacteria 1585
79 Ga0501230_000718 3300049667 Bacteria 3569
80 nmdc:mga0rr50_106082_c1 3300050513 Bacteria 2216
81 Ga0500635_0011061 3300053080 Bacteria 2555
82 Ga0500583_0010866 3300053092 Bacteria 3402
83 Ga0500566_0018062 3300053094 Bacteria 4142
84 Ga0500566_0020041 3300053094 Bacteria 3927
85 Ga0500566_0091795 3300053094 Bacteria 1678
86 Ga0500554_000050 3300053102 Bacteria 20889
87 Ga0500572_002548 3300053111 Bacteria 4347
88 Ga0500595_000017 3300053119 Bacteria 206032
89 Ga0500597_000932 3300053120 Bacteria 6836
90 Ga0500614_000035 3300053123 Bacteria 30070
91 Ga0500614_002345 3300053123 Bacteria 4238
92 Ga0500614_047635 3300053123 Bacteria 1114
93 Ga0500617_021804 3300053124 Bacteria 2821
94 Ga0500642_0015244 3300053130 Unclassified 2884
95 Ga0500642_0019084 3300053130 Bacteria 2667
96 Ga0500559_0000792 3300053136 Bacteria 20636
97 Ga0500564_129847 3300053138 Bacteria 1091
98 Ga0500603_015484 3300053150 Bacteria 1795
99 Ga0500622_0056375 3300053156 Bacteria 2012
100 Ga0500630_083521 3300053159 Bacteria 1490
101 Ga0500639_025487 3300053163 Bacteria 3127
102 Ga0500636_0064894 3300053177 Bacteria 2126
103 Ga0500636_0100898 3300053177 Unclassified 1641
104 Ga0500637_0206248 3300053178 Bacteria 1117
105 Ga0501082_0014999 3300060353 Bacteria 6677
106 Ga0500568_0061112
107 rootL2_10297113
108 Ga0070690_100038880
109 Ga0070690_100286630
110 Ga0068869_100034004
111 Ga0068868_100110388
112 Ga0070689_100041980
113 Ga0070689_100170135
114 Ga0070708_100050752
115 Ga0070678_100042907
116 Ga0070706_100030176
117 Ga0070698_100004589
118 Ga0070679_100059861
119 Ga0070665_100037107
120 Ga0068855_100447661
121 Ga0068857_100506706
122 Ga0068856_100122722
123 Ga0068866_10212096
124 Ga0068863_100251831
125 Ga0068860_100339813
126 Ga0070717_10155893
127 Ga0068865_100048543
128 Ga0075435_100185752
129 Ga0105245_10000072
130 Ga0105245_10115138
131 Ga0105243_10130134
132 Ga0105249_10069642
133 Ga0105239_10194793
134 Ga0157374_10210195
135 Ga0157376_10010341
136 Ga0207684_10043343
137 Ga0207662_10115907
138 Ga0207652_10130805
139 Ga0207687_10003619
140 Ga0207686_10188941
141 Ga0207670_10029963
142 Ga0207670_10053038
143 Ga0207689_10175075
144 Ga0207661_10304881
145 Ga0207676_10533744
146 Ga0207674_10511344
147 Ga0207675_100309601
148 Ga0207683_10017194
149 Ga0268266_10008346
150 Ga0268264_10408125
151 Ga0307517_10121530
152 Ga0307515_10013481
153 Ga0265338_10027053
154 Ga0265338_10247287
155 Ga0307513_10001795
156 Ga0307509_10000012
157 Ga0307509_10017359
158 Ga0307509_10034426
159 Ga0307509_10085364
160 Ga0307509_10175644
161 Ga0307516_10015788
162 Ga0307516_10054562
163 Ga0373949_0000569
164 Ga0373936_0000009
165 Ga0373941_0042134
166 Ga0373956_0040740
167 Ga0373961_0000154
168 Ga0395899_0031540
169 Ga0395900_0250786
170 Ga0395898_0026083
171 Ga0395905_0158514
172 Ga0395905_0693444
173 Ga0395901_0076954
174 Ga0436365_0406596
175 Ga0495590_0052506
176 Ga0495622_0089290
177 Ga0495686_0041831
178 Ga0495686_0120992
179 Ga0501047_0017944
180 Ga0501070_0035373
181 Ga0501071_0036821
182 Ga0501072_0042121
183 Ga0501216_009003
184 Ga0501230_000718
185 nmdc:mga0rr50_106082_c1
186 Ga0500635_0011061
187 Ga0500583_0010866
188 Ga0500566_0018062
189 Ga0500566_0020041
190 Ga0500566_0091795
191 Ga0500554_000050
192 Ga0500572_002548
193 Ga0500595_000017
194 Ga0500597_000932
195 Ga0500614_000035
196 Ga0500614_002345
197 Ga0500614_047635
198 Ga0500617_021804
199 Ga0500642_0015244
200 Ga0500642_0019084
201 Ga0500559_0000792
202 Ga0500564_129847
203 Ga0500603_015484
204 Ga0500622_0056375
205 Ga0500630_083521
206 Ga0500639_025487
207 Ga0500636_0064894
208 Ga0500636_0100898
209 Ga0500637_0206248
210 Ga0501082_0014999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01551

Peptidase_M23

Peptidase family M23

193

300

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmy-assembly1.cif.gz_A nmr solution structure of lysostaphin 0.8504 190 292
5j1l-assembly1.cif.gz_A crystal structure of csd1-csd2 dimer i 0.7978 192 293
6smk-assembly1.cif.gz_A crystal structure of catalytic domain a109h mutant of prophage-encoded m23 protein enpa from enterococcus faecalis. 0.7951 161 301
7qrl-assembly2.cif.gz_B lytm domain of dipm, a coordinator of a complex net of autolysins in caulobacter crescentus 0.7938 160 301
4zyb-assembly3.cif.gz_C high resolution structure of m23 peptidase lytm with substrate analogue 0.7644 170 292
ID Description Score Start End Superfamily
4zybC00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.7644 170 292 2.70.70.10
af_Q2G105_44_121_3.10.450.40 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7509 48 84 3.10.450.40
4bh5D00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.7113 159 301 2.70.70.10
af_P9WKW9_248_374_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.7111 156 297 2.70.70.10
4qpbA00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.7105 163 300 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A538Q9X4-F1-model_v4 M23 family metallopeptidase 0.911 165 325 GO:0004222
AF-A0A538Q9X4-F1-model_v4 M23 family metallopeptidase 0.9057 165 325 GO:0004222
AF-A0A4Q3W419-F1-model_v4 M23 family metallopeptidase 0.8956 162 323 GO:0004222
AF-A0A3D9P5E6-F1-model_v4 deleted 0.8947 159 323
AF-A0A368DP23-F1-model_v4 M23 family peptidase 0.8938 160 323 GO:0004222

Map