F033448

General Info

Members Datasets Scaffolds Average Seq Length
105 63 210 546

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0098108|Ga0395901_0098108_1132_2922
Length 596
Sequence MNQSSGVTRPKQRNSDALAKGPGAPGYHRRGPPVIDLSTERRRRLTHRALPAVGGLAALALAAGALVGSFAASADEHAARDFAEAWERGDERAMYALLSDSARSARPFKRFRXAYRRAADTATLVAIAAGEPDGTRGGSIVVPMTLRTRVFGRLRGDLLVPVEEEHVEWEPRLVFPELREGERLRRKSVPAERATLLSRNGKVLAEGPADARSSPLVGIADSIAGSMEPEETRDEREALYARGFPRAWPVGQSGLEEAFEDRLAGRPGGELLAGRRVLARARPREAPPVRTTIDPRVQEAAVIALAGRFGGIAALDPLSGDILALAGIAFSAPQPPGSTFKIVTTTAALEAGLVKLTDEFPVATAATIDGVELENANGESCGGSFRDSFAHSCNSVFAPLGVKVGAERLVDVAKRYGWNAKPSIPGEVASTLPPASEIRTPLEVGSTAIGQGKVLATPLRLASAAQVIAADGVRYEPTLAADERVKGIRVTTPRVARTIRSLMVDVVSYGTGTAAAIADVKVAGKTGTAELEDTRGPNADQTAADGSNTDAWFAAFAPAIRPRIAVGVMFVRAGAGGATAAPAARVVLEEGLKRRR

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
10 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
11 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
16 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
17 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
22 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
24 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
25 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
26 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
27 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
28 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
29 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
30 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
31 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
32 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
33 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
34 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
35 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
36 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
40 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
41 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
42 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
43 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
44 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
45 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
46 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
47 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
48 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
49 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
52 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
54 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
55 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
56 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
57 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
58 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
59 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
60 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
61 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
62 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
63 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.81
Rhizosphere 89.52
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0098108 3300038443 Bacteria 3072
2 JGI25407J50210_10000932 3300003373 Bacteria 6292
3 JGI25407J50210_10002309 3300003373 Bacteria 4471
4 Ga0070674_100078420 3300005356 Bacteria 2354
5 Ga0070700_100009332 3300005441 Bacteria 5377
6 Ga0081455_10025517 3300005937 Bacteria 5453
7 Ga0081538_10000098 3300005981 Bacteria 84863
8 Ga0081538_10000207 3300005981 Bacteria 65439
9 Ga0081538_10000398 3300005981 Bacteria 49598
10 Ga0081538_10000624 3300005981 Bacteria 39292
11 Ga0081538_10000827 3300005981 Bacteria 33540
12 Ga0081538_10001153 3300005981 Bacteria 27920
13 Ga0081538_10002426 3300005981 Bacteria 18272
14 Ga0081538_10011053 3300005981 Bacteria 7342
15 Ga0081538_10013928 3300005981 Bacteria 6335
16 Ga0081538_10022614 3300005981 Bacteria 4551
17 Ga0081538_10030949 3300005981 Bacteria 3620
18 Ga0081540_1001234 3300005983 Bacteria 22306
19 Ga0081539_10002969 3300005985 Bacteria 22267
20 Ga0081539_10007975 3300005985 Bacteria 9415
21 Ga0075430_100013074 3300006846 Bacteria 7073
22 Ga0075431_100002575 3300006847 Bacteria 17518
23 Ga0111539_10011886 3300009094 Bacteria 10912
24 Ga0105245_10064427 3300009098 Bacteria 3312
25 Ga0114129_10060249 3300009147 Bacteria 5307
26 Ga0105243_10021894 3300009148 Bacteria 4854
27 Ga0157380_10040750 3300014326 Bacteria 3620
28 Ga0213875_10000162 3300021388 Bacteria 70242
29 Ga0207691_10024747 3300025940 Bacteria 5644
30 Ga0207679_10059437 3300025945 Bacteria 2836
31 Ga0207708_10011936 3300026075 Bacteria 6471
32 Ga0207708_10062189 3300026075 Bacteria 2852
33 Ga0207648_10074833 3300026089 Bacteria 2952
34 Ga0207428_10021072 3300027907 Bacteria 5523
35 Ga0268266_10006550 3300028379 Bacteria 10650
36 Ga0265326_10000448 3300028558 Bacteria 16170
37 Ga0265334_10000003 3300028573 Bacteria 244354
38 Ga0265336_10009915 3300028666 Bacteria 3275
39 Ga0265338_10005629 3300028800 Bacteria 16266
40 Ga0265338_10050937 3300028800 Bacteria 3736
41 Ga0265324_10002157 3300029957 Bacteria 10319
42 Ga0265327_10009343 3300031251 Bacteria 7091
43 Ga0307405_10017955 3300031731 Bacteria 3894
44 Ga0307406_10064236 3300031901 Bacteria 2381
45 Ga0307406_10066973 3300031901 Bacteria 2339
46 Ga0307406_10079705 3300031901 Bacteria 2172
47 Ga0307407_10010013 3300031903 Bacteria 4449
48 Ga0307409_100019025 3300031995 Bacteria 4637
49 Ga0307409_100039643 3300031995 Bacteria 3498
50 Ga0307409_100087753 3300031995 Bacteria 2536
51 Ga0307416_100006776 3300032002 Bacteria 7203
52 Ga0307416_100046202 3300032002 Bacteria 3435
53 Ga0307416_100051313 3300032002 Bacteria 3294
54 Ga0307414_10004031 3300032004 Bacteria 7928
55 Ga0307414_10038392 3300032004 Bacteria 3216
56 Ga0307411_10063840 3300032005 Bacteria 2463
57 Ga0307415_100000329 3300032126 Bacteria 20572
58 Ga0307415_100067337 3300032126 Bacteria 2502
59 Ga0395900_0030089 3300037418 Bacteria 5573
60 Ga0395905_0024742 3300037471 Bacteria 5666
61 Ga0436364_0476979 3300037853 Bacteria 6834
62 Ga0436364_0532382 3300037853 Bacteria 57757
63 Ga0436364_0929138 3300037853 Bacteria 3582
64 Ga0436364_1382614 3300037853 Bacteria 17798
65 Ga0395901_0020502 3300038443 Bacteria 6765
66 Ga0395901_0082774 3300038443 Bacteria 3353
67 Ga0436365_0770308 3300039437 Bacteria 3726
68 Ga0436365_1053335 3300039437 Bacteria 6067
69 Ga0466966_0078542 3300044684 Bacteria 2058
70 Ga0466963_0014402 3300044694 Bacteria 4875
71 Ga0466963_0018254 3300044694 Unclassified 4382
72 Ga0466963_0022092 3300044694 Bacteria 4025
73 Ga0466963_0089814 3300044694 Bacteria 2091
74 Ga0466964_0036916 3300044706 Bacteria 1961
75 Ga0466967_0001024 3300045976 Bacteria 15325
76 Ga0466967_0013844 3300045976 Bacteria 6254
77 Ga0466967_0053576 3300045976 Bacteria 3546
78 Ga0466967_0068357 3300045976 Bacteria 3172
79 Ga0466967_0102870 3300045976 Bacteria 2613
80 Ga0466967_0166932 3300045976 Bacteria 2069
81 Ga0495664_0000094 3300046477 Bacteria 43654
82 Ga0496109_0003471 3300048912 Bacteria 13159
83 Ga0496109_0015075 3300048912 Bacteria 6728
84 Ga0496110_0056155 3300048913 Bacteria 3465
85 Ga0496112_0212167 3300048915 Bacteria 1893
86 Ga0501036_0050938 3300049572 Bacteria 3506
87 Ga0501039_0017081 3300049575 Bacteria 5564
88 Ga0501041_0026970 3300049577 Bacteria 3460
89 Ga0501042_0033990 3300049578 Bacteria 3616
90 Ga0501042_0112512 3300049578 Bacteria 1960
91 Ga0501072_0009824 3300049588 Bacteria 7274
92 Ga0501072_0057752 3300049588 Bacteria 3058
93 Ga0501074_0093361 3300049590 Bacteria 2155
94 Ga0501076_0010135 3300049592 Bacteria 6979
95 Ga0501079_0066518 3300049741 Bacteria 2781
96 Ga0501045_0031381 3300049824 Bacteria 3848
97 nmdc:mga08y16_23412_c1 3300050511 Bacteria 6525
98 nmdc:mga08y16_78687_c1 3300050511 Bacteria 3437
99 Ga0495601_0077058 3300053077 Bacteria 2135
100 Ga0495655_0006531 3300053083 Unclassified 2124
101 Ga0501084_0013986 3300054114 Bacteria 6643
102 Ga0501082_0074303 3300060353 Bacteria 2928
103 Ga0501082_0100134 3300060353 Bacteria 2506
104 Ga0530510_0004935 3300061734 Bacteria 9214
105 Ga0530510_0018303 3300061734 Bacteria 4967
106 Ga0395901_0098108
107 JGI25407J50210_10000932
108 JGI25407J50210_10002309
109 Ga0070674_100078420
110 Ga0070700_100009332
111 Ga0081455_10025517
112 Ga0081538_10000098
113 Ga0081538_10000207
114 Ga0081538_10000398
115 Ga0081538_10000624
116 Ga0081538_10000827
117 Ga0081538_10001153
118 Ga0081538_10002426
119 Ga0081538_10011053
120 Ga0081538_10013928
121 Ga0081538_10022614
122 Ga0081538_10030949
123 Ga0081540_1001234
124 Ga0081539_10002969
125 Ga0081539_10007975
126 Ga0075430_100013074
127 Ga0075431_100002575
128 Ga0111539_10011886
129 Ga0105245_10064427
130 Ga0114129_10060249
131 Ga0105243_10021894
132 Ga0157380_10040750
133 Ga0213875_10000162
134 Ga0207691_10024747
135 Ga0207679_10059437
136 Ga0207708_10011936
137 Ga0207708_10062189
138 Ga0207648_10074833
139 Ga0207428_10021072
140 Ga0268266_10006550
141 Ga0265326_10000448
142 Ga0265334_10000003
143 Ga0265336_10009915
144 Ga0265338_10005629
145 Ga0265338_10050937
146 Ga0265324_10002157
147 Ga0265327_10009343
148 Ga0307405_10017955
149 Ga0307406_10064236
150 Ga0307406_10066973
151 Ga0307406_10079705
152 Ga0307407_10010013
153 Ga0307409_100019025
154 Ga0307409_100039643
155 Ga0307409_100087753
156 Ga0307416_100006776
157 Ga0307416_100046202
158 Ga0307416_100051313
159 Ga0307414_10004031
160 Ga0307414_10038392
161 Ga0307411_10063840
162 Ga0307415_100000329
163 Ga0307415_100067337
164 Ga0395900_0030089
165 Ga0395905_0024742
166 Ga0436364_0476979
167 Ga0436364_0532382
168 Ga0436364_0929138
169 Ga0436364_1382614
170 Ga0395901_0020502
171 Ga0395901_0082774
172 Ga0436365_0770308
173 Ga0436365_1053335
174 Ga0466966_0078542
175 Ga0466963_0014402
176 Ga0466963_0018254
177 Ga0466963_0022092
178 Ga0466963_0089814
179 Ga0466964_0036916
180 Ga0466967_0001024
181 Ga0466967_0013844
182 Ga0466967_0053576
183 Ga0466967_0068357
184 Ga0466967_0102870
185 Ga0466967_0166932
186 Ga0495664_0000094
187 Ga0496109_0003471
188 Ga0496109_0015075
189 Ga0496110_0056155
190 Ga0496112_0212167
191 Ga0501036_0050938
192 Ga0501039_0017081
193 Ga0501041_0026970
194 Ga0501042_0033990
195 Ga0501042_0112512
196 Ga0501072_0009824
197 Ga0501072_0057752
198 Ga0501074_0093361
199 Ga0501076_0010135
200 Ga0501079_0066518
201 Ga0501045_0031381
202 nmdc:mga08y16_23412_c1
203 nmdc:mga08y16_78687_c1
204 Ga0495601_0077058
205 Ga0495655_0006531
206 Ga0501084_0013986
207 Ga0501082_0074303
208 Ga0501082_0100134
209 Ga0530510_0004935
210 Ga0530510_0018303

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00905

Transpeptidase

Penicillin binding protein transpeptidase domain

310

589

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i1h-assembly1.cif.gz_A crystal structure of tp domain from chlamydia trachomatis penicillin-binding protein 3 in complex with meropenem 0.8761 211 506
6i1g-assembly1.cif.gz_A crystal structure of tp domain from chlamydia trachomatis penicillin-binding protein 3 in complex with piperacillin 0.8634 211 506
6i1f-assembly2.cif.gz_B crystal structure of tp domain from chlamydia trachomatis penicillin-binding protein 3 in complex with amoxicillin 0.8625 213 506
6i1h-assembly2.cif.gz_B crystal structure of tp domain from chlamydia trachomatis penicillin-binding protein 3 in complex with meropenem 0.8555 211 510
6hzi-assembly1.cif.gz_A apo structure of tp domain from burkholderia pseudomallei penicillin-binding protein 3 0.8553 213 509
ID Description Score Start End Superfamily
3oc2A03 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.89 249 425 3.40.710.10
3ue3A03 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8772 249 425 3.40.710.10
3oc2A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8771 430 511 3.30.450.330
3equB02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8715 425 506 3.30.450.330
af_P0AD65_248_620_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.871 209 508 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A538K8S8-F1-model_v4 Penicillin-binding protein 2 0.9771 256 510 GO:0005886
GO:0008658
GO:0071555
GO:0071972
AF-A0A838FJI4-F1-model_v4 Penicillin-binding protein transpeptidase domain-containing protein 0.9683 301 510 GO:0005886
GO:0008658
GO:0071555
GO:0071972
AF-A0A2W6CSN5-F1-model_v4 Penicillin-binding protein transpeptidase domain-containing protein 0.9583 364 510 GO:0005886
GO:0008658
GO:0071555
GO:0071972
AF-A0A538K8S8-F1-model_v4 Penicillin-binding protein 2 0.9542 256 510 GO:0005886
GO:0008658
GO:0071555
GO:0071972
AF-A0A7V8ZCI5-F1-model_v4 Penicillin-binding protein transpeptidase domain-containing protein 0.9492 102 511 GO:0005886
GO:0008658
GO:0071555
GO:0071972

Map