F033284

General Info

Members Datasets Scaffolds Average Seq Length
105 31 210 112

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0410275|Ga0316574_0410275_342_689
Length 115
Sequence MVMKLIIAYIQPHKLSDVKRSLYKAEVYKMSVTNSLGCGQQKGYHESYRGVDIEVNLLKKIRLEIAVNEDFVDRTVEAIIEGAKSGQIGDGKIFILDLPECIRIRTGEKGHDAIG

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
3 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
4 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
5 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
6 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
7 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
8 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
13 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
14 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
15 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
16 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
17 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
18 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
19 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
20 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
21 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
22 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
23 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
24 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
25 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
26 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
27 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
28 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
29 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
30 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
31 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.71
Metatranscriptomes 34.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0410275 3300035398 Bacteria 852
2 Ga0070717_10115827 3300006028 Bacteria 2291
3 Ga0316575_10037225 3300031665 Bacteria 1916
4 Ga0316579_10136270 3300031691 Bacteria 1183
5 Ga0316579_10223580 3300031691 Bacteria 911
6 Ga0316579_10242005 3300031691 Bacteria 873
7 Ga0316579_10386447 3300031691 Unclassified 677
8 Ga0316576_10006364 3300031727 Bacteria 7341
9 Ga0316576_10039657 3300031727 Bacteria 3382
10 Ga0316576_10084575 3300031727 Bacteria 2358
11 Ga0316576_10128067 3300031727 Bacteria 1909
12 Ga0316576_10142330 3300031727 Unclassified 1806
13 Ga0316576_10237084 3300031727 Bacteria 1371
14 Ga0316576_10279702 3300031727 Bacteria 1250
15 Ga0316576_10364672 3300031727 Unclassified 1074
16 Ga0316576_10393419 3300031727 Bacteria 1028
17 Ga0316576_10433325 3300031727 Bacteria 972
18 Ga0316576_10486493 3300031727 Bacteria 909
19 Ga0316576_10691828 3300031727 Unclassified 739
20 Ga0316576_10772523 3300031727 Bacteria 693
21 Ga0316576_11028249 3300031727 Bacteria 586
22 Ga0316578_10922718 3300031728 Bacteria 504
23 Ga0316577_10090662 3300031733 Bacteria 1711
24 Ga0316577_10247099 3300031733 Bacteria 1009
25 Ga0316593_10032759 3300032168 Bacteria 1699
26 Ga0316593_10074985 3300032168 Bacteria 1174
27 Ga0316593_10102165 3300032168 Bacteria 1018
28 Ga0316593_10167879 3300032168 Bacteria 804
29 Ga0316593_10286199 3300032168 Bacteria 622
30 Ga0316593_10314988 3300032168 Bacteria 594
31 Ga0316593_10380249 3300032168 Unclassified 544
32 Ga0316592_1009598 3300033524 Bacteria 1938
33 Ga0316592_1020427 3300033524 Bacteria 1407
34 Ga0316592_1029155 3300033524 Bacteria 1197
35 Ga0316592_1061875 3300033524 Bacteria 841
36 Ga0316592_1070137 3300033524 Bacteria 792
37 Ga0316592_1104205 3300033524 Unclassified 654
38 Ga0316592_1107461 3300033524 Unclassified 644
39 Ga0316592_1132181 3300033524 Bacteria 583
40 Ga0316592_1145949 3300033524 Unclassified 557
41 Ga0316588_1009350 3300033528 Bacteria 2043
42 Ga0316588_1010055 3300033528 Bacteria 1985
43 Ga0316588_1011345 3300033528 Bacteria 1898
44 Ga0316588_1014212 3300033528 Bacteria 1739
45 Ga0316588_1014492 3300033528 Bacteria 1726
46 Ga0316588_1041159 3300033528 Bacteria 1105
47 Ga0316588_1042116 3300033528 Bacteria 1093
48 Ga0316588_1053894 3300033528 Unclassified 977
49 Ga0316588_1066710 3300033528 Bacteria 881
50 Ga0316588_1081031 3300033528 Unclassified 804
51 Ga0316588_1092564 3300033528 Unclassified 754
52 Ga0316588_1104750 3300033528 Unclassified 710
53 Ga0316588_1119381 3300033528 Unclassified 667
54 Ga0316588_1193498 3300033528 Bacteria 530
55 Ga0316588_1215590 3300033528 Bacteria 504
56 Ga0316596_1018722 3300033541 Bacteria 1753
57 Ga0316596_1108640 3300033541 Bacteria 752
58 Ga0316596_1149220 3300033541 Bacteria 642
59 Ga0316596_1187447 3300033541 Bacteria 574
60 Ga0316596_1219200 3300033541 Bacteria 532
61 Ga0316574_0644051 3300035398 Unclassified 653
62 Ga0316574_0729897 3300035398 Unclassified 606
63 Ga0316582_0009887 3300036647 Bacteria 5198
64 Ga0316582_0017845 3300036647 Bacteria 4115
65 Ga0316582_0122395 3300036647 Bacteria 1742
66 Ga0316582_0233871 3300036647 Bacteria 1258
67 Ga0316582_0332049 3300036647 Bacteria 1046
68 Ga0316582_0516294 3300036647 Unclassified 823
69 Ga0316582_0573205 3300036647 Unclassified 777
70 Ga0316582_0753710 3300036647 Bacteria 668
71 Ga0316582_0893209 3300036647 Bacteria 608
72 Ga0316582_1015450 3300036647 Unclassified 566
73 Ga0316582_1050224 3300036647 Unclassified 556
74 Ga0316584_0616533 3300036712 Bacteria 751
75 Ga0316584_0769408 3300036712 Bacteria 656
76 Ga0316584_1130779 3300036712 Unclassified 519
77 Ga0316581_0198915 3300037588 Bacteria 617
78 Ga0436364_0740370 3300037853 Bacteria 649
79 Ga0400484_06150 3300038725 Bacteria 1599
80 Ga0400484_34127 3300038725 Bacteria 2681
81 Ga0400490_30868 3300038726 Bacteria 1620
82 Ga0400490_60527 3300038726 Bacteria 4272
83 Ga0400486_01487 3300038742 Bacteria 1316
84 Ga0400483_028177 3300039062 Bacteria 1941
85 Ga0400483_137056 3300039062 Bacteria 1583
86 Ga0400483_151002 3300039062 Bacteria 2309
87 Ga0400489_22847 3300039093 Bacteria 1726
88 Ga0400489_51679 3300039093 Bacteria 2075
89 Ga0400489_96037 3300039093 Bacteria 2917
90 Ga0436365_0279528 3300039437 Bacteria 782
91 Ga0451855_0151684 3300041511 Bacteria 649
92 Ga0453683_0404540 3300044673 Bacteria 880
93 Ga0466963_0025400 3300044694 Bacteria 3778
94 Ga0453684_0033422 3300044712 Bacteria 7172
95 Ga0453684_0040110 3300044712 Bacteria 6366
96 Ga0453684_0045906 3300044712 Bacteria 5821
97 Ga0453684_0153949 3300044712 Bacteria 2728
98 Ga0453684_0635287 3300044712 Unclassified 1166
99 Ga0466959_0624662 3300045049 Bacteria 724
100 Ga0451576_1119786 3300045051 Bacteria 823
101 Ga0466958_0622648 3300045836 Bacteria 702
102 Ga0466967_0165478 3300045976 Bacteria 2078
103 Ga0466967_1404065 3300045976 Bacteria 695
104 Ga0501084_0848839 3300054114 Bacteria 769
105 Ga0466962_0499236 3300061719 Bacteria 616
106 Ga0316574_0410275
107 Ga0070717_10115827
108 Ga0316575_10037225
109 Ga0316579_10136270
110 Ga0316579_10223580
111 Ga0316579_10242005
112 Ga0316579_10386447
113 Ga0316576_10006364
114 Ga0316576_10039657
115 Ga0316576_10084575
116 Ga0316576_10128067
117 Ga0316576_10142330
118 Ga0316576_10237084
119 Ga0316576_10279702
120 Ga0316576_10364672
121 Ga0316576_10393419
122 Ga0316576_10433325
123 Ga0316576_10486493
124 Ga0316576_10691828
125 Ga0316576_10772523
126 Ga0316576_11028249
127 Ga0316578_10922718
128 Ga0316577_10090662
129 Ga0316577_10247099
130 Ga0316593_10032759
131 Ga0316593_10074985
132 Ga0316593_10102165
133 Ga0316593_10167879
134 Ga0316593_10286199
135 Ga0316593_10314988
136 Ga0316593_10380249
137 Ga0316592_1009598
138 Ga0316592_1020427
139 Ga0316592_1029155
140 Ga0316592_1061875
141 Ga0316592_1070137
142 Ga0316592_1104205
143 Ga0316592_1107461
144 Ga0316592_1132181
145 Ga0316592_1145949
146 Ga0316588_1009350
147 Ga0316588_1010055
148 Ga0316588_1011345
149 Ga0316588_1014212
150 Ga0316588_1014492
151 Ga0316588_1041159
152 Ga0316588_1042116
153 Ga0316588_1053894
154 Ga0316588_1066710
155 Ga0316588_1081031
156 Ga0316588_1092564
157 Ga0316588_1104750
158 Ga0316588_1119381
159 Ga0316588_1193498
160 Ga0316588_1215590
161 Ga0316596_1018722
162 Ga0316596_1108640
163 Ga0316596_1149220
164 Ga0316596_1187447
165 Ga0316596_1219200
166 Ga0316574_0644051
167 Ga0316574_0729897
168 Ga0316582_0009887
169 Ga0316582_0017845
170 Ga0316582_0122395
171 Ga0316582_0233871
172 Ga0316582_0332049
173 Ga0316582_0516294
174 Ga0316582_0573205
175 Ga0316582_0753710
176 Ga0316582_0893209
177 Ga0316582_1015450
178 Ga0316582_1050224
179 Ga0316584_0616533
180 Ga0316584_0769408
181 Ga0316584_1130779
182 Ga0316581_0198915
183 Ga0436364_0740370
184 Ga0400484_06150
185 Ga0400484_34127
186 Ga0400490_30868
187 Ga0400490_60527
188 Ga0400486_01487
189 Ga0400483_028177
190 Ga0400483_137056
191 Ga0400483_151002
192 Ga0400489_22847
193 Ga0400489_51679
194 Ga0400489_96037
195 Ga0436365_0279528
196 Ga0451855_0151684
197 Ga0453683_0404540
198 Ga0466963_0025400
199 Ga0453684_0033422
200 Ga0453684_0040110
201 Ga0453684_0045906
202 Ga0453684_0153949
203 Ga0453684_0635287
204 Ga0466959_0624662
205 Ga0451576_1119786
206 Ga0466958_0622648
207 Ga0466967_0165478
208 Ga0466967_1404065
209 Ga0501084_0848839
210 Ga0466962_0499236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

3

108

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hwu-assembly3.cif.gz_A structure of pii protein from herbaspirillum seropedicae 0.9127 1 107
4cnz-assembly1.cif.gz_C structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate 0.912 1 107
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9105 1 107
4cnz-assembly2.cif.gz_F structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate 0.9094 1 107
1hwu-assembly3.cif.gz_A structure of pii protein from herbaspirillum seropedicae 0.904 1 107
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8721 1 106 3.30.70.120
3ce8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8706 1 92 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8665 2 106 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.866 2 107 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8636 1 106 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A5P9GRJ3-F1-model_v4 Nitrogen regulatory protein P-II 0.9327 2 107 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A181C720-F1-model_v4 deleted 0.9317 2 107
AF-A0A0S6X0Z4-F1-model_v4 Nitrogen regulatory protein P-II 0.9317 2 107 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A154TQF6-F1-model_v4 deleted 0.9249 2 107
AF-A0A2V3UFD4-F1-model_v4 Nitrogen regulatory protein P-II 0.9247 2 107 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Map