F016901

General Info

Members Datasets Scaffolds Average Seq Length
102 66 102 132

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0091227|Ga0495669_0091227_62_517
Length 151
Sequence MTGETSSSSAPATGQNFLKASSATSARAKAAPRLTGPSSDRRRPTPTSVDGFALSGPSHPPDPSFNAYRKDLADVALAGRVIASHYAEPVEREIASATPLRLAPSEEGEVILHLARGDHFAMLDDSLGWAWGYAGEDGRVGYIHLSAVAGV

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
10 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
11 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
12 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
13 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
14 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
19 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
20 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
21 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
31 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
32 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
33 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
34 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
35 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
36 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
37 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
38 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
39 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
40 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
41 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
42 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
43 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
44 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
45 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
48 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
49 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
50 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
51 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
52 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
53 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
54 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
55 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
56 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
57 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
58 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
59 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
60 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
61 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
63 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
64 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
65 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
66 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 4.9
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 2.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10030580 3300001990 Bacteria 1685
2 Ga0068868_100246187 3300005338 Bacteria 1503
3 Ga0070671_100186760 3300005355 Bacteria 1756
4 Ga0070673_100034859 3300005364 Bacteria 3813
5 Ga0070659_100224087 3300005366 Bacteria 1553
6 Ga0070659_100780374 3300005366 Bacteria 830
7 Ga0070672_100161533 3300005543 Bacteria 1859
8 Ga0068856_101982617 3300005614 Bacteria 593
9 Ga0068852_100421664 3300005616 Bacteria 1316
10 Ga0097621_100511375 3300006237 Bacteria 1089
11 Ga0075436_101164674 3300006914 Unclassified 581
12 Ga0105238_10070049 3300009551 Bacteria 3507
13 Ga0157373_10106496 3300013100 Bacteria 1971
14 Ga0157373_10185544 3300013100 Bacteria 1465
15 Ga0157373_10392709 3300013100 Bacteria 993
16 Ga0157371_10105016 3300013102 Unclassified 2004
17 Ga0157371_10446026 3300013102 Bacteria 951
18 Ga0157370_10306326 3300013104 Bacteria 1466
19 Ga0157369_10106650 3300013105 Bacteria 2981
20 Ga0157374_10499011 3300013296 Bacteria 1221
21 Ga0157372_10273083 3300013307 Bacteria 1965
22 Ga0157372_13465865 3300013307 Bacteria 501
23 Ga0157380_10003876 3300014326 Bacteria 10317
24 Ga0157376_11295194 3300014969 Unclassified 759
25 Ga0163161_10915042 3300017792 Bacteria 744
26 Ga0206353_10361072 3300020082 Bacteria 626
27 Ga0207642_10053112 3300025899 Bacteria 1842
28 Ga0207690_10052405 3300025932 Bacteria 2733
29 Ga0207690_10260599 3300025932 Bacteria 1343
30 Ga0207691_10299195 3300025940 Bacteria 1382
31 Ga0207711_11141116 3300025941 Bacteria 720
32 Ga0207661_10605616 3300025944 Bacteria 1006
33 Ga0207679_11433495 3300025945 Bacteria 634
34 Ga0207668_10807407 3300025972 Bacteria 831
35 Ga0207678_11633619 3300026067 Bacteria 567
36 Ga0307515_10239950 3300028794 Bacteria 1586
37 Ga0307414_10145188 3300032004 Bacteria 1863
38 Ga0373945_0306827 3300035116 Bacteria 681
39 Ga0373937_0727365 3300036401 Unclassified 939
40 Ga0395899_0532517 3300037312 Archaea 758
41 Ga0395899_0908335 3300037312 Bacteria 536
42 Ga0395900_0002862 3300037418 Bacteria 18816
43 Ga0395900_0144063 3300037418 Bacteria 2438
44 Ga0395900_0363745 3300037418 Bacteria 1417
45 Ga0395900_0394261 3300037418 Bacteria 1350
46 Ga0395900_0495553 3300037418 Bacteria 1172
47 Ga0395900_1235163 3300037418 Unclassified 662
48 Ga0395900_1298587 3300037418 Bacteria 642
49 Ga0395898_0070513 3300037466 Bacteria 3378
50 Ga0395905_0009943 3300037471 Bacteria 9269
51 Ga0395905_0034861 3300037471 Bacteria 4724
52 Ga0395905_0096007 3300037471 Bacteria 2783
53 Ga0395905_0451169 3300037471 Bacteria 1184
54 Ga0395905_0869524 3300037471 Bacteria 804
55 Ga0395905_1649411 3300037471 Unclassified 546
56 Ga0395905_1773703 3300037471 Bacteria 523
57 Ga0395901_0038512 3300038443 Bacteria 4946
58 Ga0395901_0071625 3300038443 Bacteria 3612
59 Ga0395901_0185932 3300038443 Bacteria 2179
60 Ga0395901_0922200 3300038443 Bacteria 854
61 Ga0395901_0974706 3300038443 Unclassified 825
62 Ga0436365_0055961 3300039437 Bacteria 7479
63 Ga0436363_1352272 3300039450 Bacteria 4441
64 Ga0439448_0026065 3300042005 Bacteria 1837
65 Ga0439448_0256783 3300042005 Unclassified 617
66 Ga0466969_0394018 3300044656 Bacteria 628
67 Ga0466972_0462624 3300044658 Bacteria 596
68 Ga0466966_0042820 3300044684 Bacteria 2904
69 Ga0466966_0053512 3300044684 Bacteria 2561
70 Ga0466963_0042700 3300044694 Bacteria 2978
71 Ga0466971_0066104 3300044719 Bacteria 1638
72 Ga0466971_0094478 3300044719 Bacteria 1370
73 Ga0466971_0685784 3300044719 Bacteria 514
74 Ga0466957_0695019 3300044842 Unclassified 717
75 Ga0466957_0948619 3300044842 Unclassified 616
76 Ga0466957_1017605 3300044842 Bacteria 595
77 Ga0466957_1055646 3300044842 Unclassified 585
78 Ga0466958_0097584 3300045836 Bacteria 1824
79 Ga0466967_0150347 3300045976 Bacteria 2175
80 Ga0466967_0255730 3300045976 Bacteria 1674
81 Ga0466967_0570302 3300045976 Bacteria 1115
82 Ga0466967_2516987 3300045976 Bacteria 509
83 Ga0495642_0389880 3300046528 Bacteria 614
84 Ga0495668_0031496 3300046616 Bacteria 2988
85 Ga0495669_0021805 3300046684 Bacteria 2783
86 Ga0495669_0091227 3300046684 Bacteria 1407
87 Ga0495669_0519484 3300046684 Bacteria 579
88 Ga0495683_0391132 3300047323 Unclassified 580
89 Ga0495677_0148487 3300047445 Bacteria 902
90 Ga0495677_0182215 3300047445 Bacteria 814
91 Ga0495593_0580712 3300047673 Bacteria 562
92 Ga0496100_0466474 3300048903 Bacteria 970
93 Ga0496102_0490828 3300048905 Bacteria 1150
94 Ga0496109_1392141 3300048912 Unclassified 637
95 Ga0496113_1495712 3300048916 Bacteria 521
96 Ga0496114_0457165 3300048917 Bacteria 1130
97 Ga0501042_0740882 3300049578 Bacteria 715
98 Ga0501069_0580253 3300049585 Bacteria 672
99 nmdc:mga03683_85057_c1 3300050489 Bacteria 1371
100 nmdc:mga0yw44_134768_c1 3300050492 Bacteria 1601
101 Ga0495612_0338042 3300053078 Unclassified 679
102 Ga0500627_0194231 3300053158 Bacteria 911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0451169 Ga0395905_0451169_752_1156 105
2 3300028794 Ga0307515_10239950 Ga0307515_102399502 106
3 3300048912 Ga0496109_1392141 Ga0496109_1392141_17_358 106
4 3300014326 Ga0157380_10003876 Ga0157380_100038766 110
5 3300025945 Ga0207679_11433495 Ga0207679_114334952 113
6 3300032004 Ga0307414_10145188 Ga0307414_101451882 113
7 3300045836 Ga0466958_0097584 Ga0466958_0097584_827_1222 114
8 3300013104 Ga0157370_10306326 Ga0157370_103063263 115
9 3300039437 Ga0436365_0055961 Ga0436365_0055961_2790_3161 115
10 3300039450 Ga0436363_1352272 Ga0436363_1352272_1285_1656 115
11 3300044842 Ga0466957_1055646 Ga0466957_1055646_99_470 115
12 3300048905 Ga0496102_0490828 Ga0496102_0490828_208_579 115
13 3300050489 nmdc:mga03683_85057_c1 nmdc:mga03683_85057_c1_352_726 116
14 3300014969 Ga0157376_11295194 Ga0157376_112951941 117
15 3300044684 Ga0466966_0042820 Ga0466966_0042820_774_1154 117
16 3300013100 Ga0157373_10106496 Ga0157373_101064963 118
17 3300013100 Ga0157373_10185544 Ga0157373_101855443 118
18 3300013100 Ga0157373_10392709 Ga0157373_103927092 118
19 3300013102 Ga0157371_10446026 Ga0157371_104460262 118
20 3300013105 Ga0157369_10106650 Ga0157369_101066505 118
21 3300013296 Ga0157374_10499011 Ga0157374_104990113 118
22 3300013307 Ga0157372_10273083 Ga0157372_102730833 118
23 3300037418 Ga0395900_0002862 Ga0395900_0002862_3568_3948 118
24 3300037418 Ga0395900_0363745 Ga0395900_0363745_51_434 118
25 3300037466 Ga0395898_0070513 Ga0395898_0070513_93_473 118
26 3300037471 Ga0395905_0034861 Ga0395905_0034861_2883_3263 118
27 3300038443 Ga0395901_0071625 Ga0395901_0071625_334_717 118
28 3300042005 Ga0439448_0256783 Ga0439448_0256783_36_419 118
29 3300045976 Ga0466967_0150347 Ga0466967_0150347_137_520 118
30 3300045976 Ga0466967_2516987 Ga0466967_2516987_110_490 118
31 3300038443 Ga0395901_0038512 Ga0395901_0038512_4526_4930 119
32 3300049585 Ga0501069_0580253 Ga0501069_0580253_10_414 119
33 3300009551 Ga0105238_10070049 Ga0105238_100700491 120
34 3300042005 Ga0439448_0026065 Ga0439448_0026065_1384_1788 120
35 3300044719 Ga0466971_0066104 Ga0466971_0066104_26_424 120
36 3300044719 Ga0466971_0685784 Ga0466971_0685784_66_470 122
37 3300044842 Ga0466957_0695019 Ga0466957_0695019_14_418 122
38 3300044842 Ga0466957_1017605 Ga0466957_1017605_34_438 122
39 3300037471 Ga0395905_0009943 Ga0395905_0009943_5866_6261 123
40 3300050492 nmdc:mga0yw44_134768_c1 nmdc:mga0yw44_134768_c1_642_1037 123
41 3300005366 Ga0070659_100224087 Ga0070659_1002240871 124
42 3300005614 Ga0068856_101982617 Ga0068856_1019826172 124
43 3300013307 Ga0157372_13465865 Ga0157372_134658651 124
44 3300035116 Ga0373945_0306827 Ga0373945_0306827_269_667 124
45 3300037418 Ga0395900_0394261 Ga0395900_0394261_83_478 124
46 3300037418 Ga0395900_1235163 Ga0395900_1235163_10_444 124
47 3300037471 Ga0395905_0869524 Ga0395905_0869524_61_459 124
48 3300037471 Ga0395905_1773703 Ga0395905_1773703_23_424 124
49 3300044658 Ga0466972_0462624 Ga0466972_0462624_129_527 124
50 3300045976 Ga0466967_0570302 Ga0466967_0570302_298_696 124
51 3300037418 Ga0395900_0144063 Ga0395900_0144063_240_638 125
52 3300037471 Ga0395905_1649411 Ga0395905_1649411_129_530 125
53 3300038443 Ga0395901_0922200 Ga0395901_0922200_366_764 125
54 3300044684 Ga0466966_0053512 Ga0466966_0053512_2114_2515 125
55 3300044694 Ga0466963_0042700 Ga0466963_0042700_238_639 125
56 3300044842 Ga0466957_0948619 Ga0466957_0948619_51_452 125
57 3300046528 Ga0495642_0389880 Ga0495642_0389880_94_498 125
58 3300005355 Ga0070671_100186760 Ga0070671_1001867601 126
59 3300005364 Ga0070673_100034859 Ga0070673_1000348592 126
60 3300005366 Ga0070659_100780374 Ga0070659_1007803741 126
61 3300005543 Ga0070672_100161533 Ga0070672_1001615331 126
62 3300006914 Ga0075436_101164674 Ga0075436_1011646741 126
63 3300025940 Ga0207691_10299195 Ga0207691_102991952 126
64 3300036401 Ga0373937_0727365 Ga0373937_0727365_51_455 126
65 3300037312 Ga0395899_0532517 Ga0395899_0532517_18_422 126
66 3300037312 Ga0395899_0908335 Ga0395899_0908335_15_419 126
67 3300037418 Ga0395900_0495553 Ga0395900_0495553_746_1150 126
68 3300038443 Ga0395901_0185932 Ga0395901_0185932_166_567 126
69 3300045976 Ga0466967_0255730 Ga0466967_0255730_1125_1529 126
70 3300046684 Ga0495669_0021805 Ga0495669_0021805_16_420 126
71 3300046684 Ga0495669_0519484 Ga0495669_0519484_15_419 126
72 3300047445 Ga0495677_0148487 Ga0495677_0148487_188_592 126
73 3300047673 Ga0495593_0580712 Ga0495593_0580712_72_476 126
74 3300048903 Ga0496100_0466474 Ga0496100_0466474_27_431 126
75 3300048916 Ga0496113_1495712 Ga0496113_1495712_48_452 126
76 3300053078 Ga0495612_0338042 Ga0495612_0338042_211_615 126
77 3300037471 Ga0395905_0096007 Ga0395905_0096007_1335_1754 127
78 3300049578 Ga0501042_0740882 Ga0501042_0740882_192_605 129
79 3300048917 Ga0496114_0457165 Ga0496114_0457165_103_519 130
80 3300025941 Ga0207711_11141116 Ga0207711_111411162 131
81 3300025972 Ga0207668_10807407 Ga0207668_108074072 131
82 3300038443 Ga0395901_0974706 Ga0395901_0974706_93_536 131
83 3300037418 Ga0395900_1298587 Ga0395900_1298587_55_486 134
84 3300044656 Ga0466969_0394018 Ga0466969_0394018_22_453 134
85 3300044719 Ga0466971_0094478 Ga0466971_0094478_901_1332 134
86 3300013102 Ga0157371_10105016 Ga0157371_101050162 136
87 3300025932 Ga0207690_10260599 Ga0207690_102605991 137
88 3300005338 Ga0068868_100246187 Ga0068868_1002461871 138
89 3300017792 Ga0163161_10915042 Ga0163161_109150421 138
90 3300025899 Ga0207642_10053112 Ga0207642_100531123 138
91 3300025932 Ga0207690_10052405 Ga0207690_100524054 138
92 3300026067 Ga0207678_11633619 Ga0207678_116336191 138
93 3300046616 Ga0495668_0031496 Ga0495668_0031496_2520_2963 138
94 3300047323 Ga0495683_0391132 Ga0495683_0391132_113_556 138
95 3300047445 Ga0495677_0182215 Ga0495677_0182215_33_476 138
96 3300053158 Ga0500627_0194231 Ga0500627_0194231_401_844 138
97 3300006237 Ga0097621_100511375 Ga0097621_1005113751 139
98 3300020082 Ga0206353_10361072 Ga0206353_103610722 139
99 3300025944 Ga0207661_10605616 Ga0207661_106056161 139
100 3300046684 Ga0495669_0091227 Ga0495669_0091227_62_517 139
101 3300005616 Ga0068852_100421664 Ga0068852_1004216642 141
102 3300001990 JGI24737J22298_10030580 JGI24737J22298_100305801 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18348

SH3_16

Bacterial dipeptidyl-peptidase Sh3 domain

100

148

0.95

PF07653

SH3_2

Variant SH3 domain

89

151

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bio-assembly1.cif.gz_A structure of nlpc1 from trichomonas vaginalis 0.911 79 142
6biq-assembly5.cif.gz_D structure of nlpc2 from trichomonas vaginalis 0.9102 79 140
6biq-assembly4.cif.gz_C structure of nlpc2 from trichomonas vaginalis 0.8697 79 142
3npf-assembly1.cif.gz_B crystal structure of a putative dipeptidyl-peptidase vi (bacova_00612) from bacteroides ovatus at 1.72 a resolution 0.842 79 142
4krt-assembly2.cif.gz_B x-ray structure of endolysin from clostridium perfringens phage phism101 0.824 81 140
ID Description Score Start End Superfamily
af_Q2FXU3_37_103_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.9077 82 140 2.30.30.40
4krtB03 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8533 82 142 2.30.30.40
af_P0ADT8_18_85_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8409 79 138 2.30.30.40
4r0kB02 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8187 81 140 2.30.30.40
af_K7LF98_298_352_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8163 81 142 2.30.30.40
ID Description Score Start End GO Terms
AF-A0A7Z0AN75-F1-model_v4 deleted 0.9544 81 142
AF-A0A0C5WWT2-F1-model_v4 Uncharacterized protein 0.9522 80 142
AF-A0A523KG48-F1-model_v4 Peptidoglycan binding-like domain-containing protein 0.9438 81 142
AF-A0A0A6D2M2-F1-model_v4 SH3b domain-containing protein 0.9421 81 142
AF-A0A848G7Z8-F1-model_v4 DUF4384 domain-containing protein 0.941 80 139

Feature Viewer

pLDDT pTM Quality
66.89 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map