F015698

General Info

Members Datasets Scaffolds Average Seq Length
102 44 102 294

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10000241|Ga0316579_100002414
Length 348
Sequence VSKLLSPKVLVPTLVLIVGLVIINVVFTIPGVVLPEISIAAEPVFDVTLGGFWPNGITNTLLASWLTTAILVVGIWAITRKTREVPRRWQGALEMVIEGMYNLVEGAAGRKWARRFFPIVMTIFLFVITASWLGLTPLFGSWGALHHAEHGEPVQWLNDAHTVGLWVPADESQEAEAYSSEEEAHPGEGEVYTLAPMFRAATTDLNVTLALALVSVVLTQYFGLSALGIGYLSKFINVGGFVKAFTKRGIGCMGRVAAFGMGIIDFFIGIVELISEIGKIISFSFRLFGNIFAGEVLLGVMAFLIPYLVSLPFYGLELFVGFVQALVFMMLSVAFFIVATTTHGEEGH

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
4 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
5 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
6 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
9 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
10 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
17 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
18 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
19 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
20 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
21 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
22 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
23 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
24 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
25 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
26 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
27 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
28 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
29 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
30 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
31 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
33 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
34 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
35 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
36 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
37 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
38 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
39 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
40 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
41 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
42 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
43 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
44 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 0
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 3.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100004833 3300005336 Bacteria 10144
2 Ga0070680_100006567 3300005336 Bacteria 8847
3 Ga0070682_100279245 3300005337 Bacteria 1217
4 Ga0070681_10106866 3300005458 Bacteria 2740
5 Ga0070685_10264411 3300005466 Bacteria 1145
6 Ga0070679_100001689 3300005530 Bacteria 19878
7 Ga0070679_100032178 3300005530 Bacteria 5186
8 Ga0070704_100000005 3300005549 Bacteria 112444
9 Ga0070704_100022890 3300005549 Bacteria 4072
10 Ga0068856_100008301 3300005614 Bacteria 10122
11 Ga0068863_100016972 3300005841 Bacteria 6982
12 Ga0114129_10105907 3300009147 Bacteria 3885
13 Ga0207707_10113980 3300025912 Bacteria 2363
14 Ga0207660_10006186 3300025917 Bacteria 7777
15 Ga0207652_10035146 3300025921 Bacteria 4228
16 Ga0207652_10113254 3300025921 Bacteria 2408
17 Ga0207702_10011739 3300026078 Bacteria 7296
18 Ga0207641_10012340 3300026088 Bacteria 7011
19 Ga0207676_10296707 3300026095 Bacteria 1474
20 Ga0265336_10009643 3300028666 Bacteria 3331
21 Ga0265338_10025450 3300028800 Bacteria 6003
22 Ga0265320_10027661 3300031240 Bacteria 2954
23 Ga0265340_10000131 3300031247 Bacteria 37276
24 Ga0265331_10009388 3300031250 Bacteria 5492
25 Ga0265331_10079316 3300031250 Bacteria 1528
26 Ga0265327_10013698 3300031251 Bacteria 5366
27 Ga0265316_10328472 3300031344 Bacteria 1110
28 Ga0265313_10004960 3300031595 Bacteria 9959
29 Ga0316579_10000241 3300031691 Bacteria 16729
30 Ga0316579_10014856 3300031691 Unclassified 3375
31 Ga0316579_10032408 3300031691 Unclassified 2397
32 Ga0265314_10001735 3300031711 Bacteria 23593
33 Ga0316576_10025030 3300031727 Unclassified 4175
34 Ga0316577_10000584 3300031733 Bacteria 14964
35 Ga0316577_10000730 3300031733 Bacteria 14009
36 Ga0316577_10001746 3300031733 Bacteria 10460
37 Ga0316577_10001929 3300031733 Bacteria 10046
38 Ga0316577_10043925 3300031733 Bacteria 2500
39 Ga0316577_10048213 3300031733 Bacteria 2379
40 Ga0316577_10128188 3300031733 Bacteria 1428
41 Ga0316577_10136574 3300031733 Bacteria 1381
42 Ga0307416_100919060 3300032002 Bacteria 976
43 Ga0316585_10049791 3300032137 Bacteria 1344
44 Ga0316580_10038319 3300032139 Bacteria 1482
45 Ga0316593_10019794 3300032168 Unclassified 2084
46 Ga0316574_0004274 3300035398 Bacteria 7462
47 Ga0316582_0000336 3300036647 Bacteria 16557
48 Ga0316582_0004726 3300036647 Bacteria 6933
49 Ga0316582_0010615 3300036647 Archaea 5053
50 Ga0316582_0023139 3300036647 Bacteria 3699
51 Ga0316582_0126291 3300036647 Bacteria 1715
52 Ga0316584_0000278 3300036712 Bacteria 26081
53 Ga0316584_0000895 3300036712 Bacteria 16968
54 Ga0316584_0001093 3300036712 Bacteria 15878
55 Ga0316584_0002187 3300036712 Bacteria 12253
56 Ga0316584_0050996 3300036712 Unclassified 3094
57 Ga0316584_0064170 3300036712 Bacteria 2750
58 Ga0316584_0079611 3300036712 Bacteria 2455
59 Ga0316581_0000174 3300037588 Bacteria 10460
60 Ga0316581_0075612 3300037588 Bacteria 1034
61 Ga0400491_28417 3300038727 Bacteria 31159
62 Ga0400489_18103 3300039093 Bacteria 4062
63 Ga0400489_23981 3300039093 Bacteria 41609
64 Ga0451849_0792182 3300041505 Unclassified 1837
65 Ga0451577_0000003 3300042876 Bacteria 921850
66 Ga0451577_0000056 3300042876 Bacteria 273200
67 Ga0451577_0024803 3300042876 Bacteria 5449
68 Ga0451577_0069527 3300042876 Bacteria 3140
69 Ga0451577_0241608 3300042876 Unclassified 1634
70 Ga0451577_0352002 3300042876 Unclassified 1336
71 Ga0453683_0000006 3300044673 Bacteria 586638
72 Ga0453683_0001340 3300044673 Bacteria 21578
73 Ga0453683_0059831 3300044673 Bacteria 2381
74 Ga0453684_0000009 3300044712 Bacteria 1139914
75 Ga0453684_0000018 3300044712 Bacteria 921850
76 Ga0453684_0000042 3300044712 Bacteria 682980
77 Ga0453684_0000777 3300044712 Bacteria 110019
78 Ga0453684_0001872 3300044712 Bacteria 54750
79 Ga0453684_0004229 3300044712 Bacteria 30759
80 Ga0453684_0014586 3300044712 Bacteria 12545
81 Ga0453684_0041939 3300044712 Bacteria 6177
82 Ga0453684_0118949 3300044712 Bacteria 3194
83 Ga0453684_0155006 3300044712 Unclassified 2717
84 Ga0453684_0167888 3300044712 Bacteria 2589
85 Ga0453684_0186321 3300044712 Bacteria 2432
86 Ga0453684_0697507 3300044712 Bacteria 1103
87 Ga0451576_0000243 3300045051 Bacteria 133634
88 Ga0451576_0000370 3300045051 Bacteria 106737
89 Ga0451576_0000437 3300045051 Bacteria 95694
90 Ga0451576_0003958 3300045051 Bacteria 19748
91 Ga0451576_0003965 3300045051 Bacteria 19712
92 Ga0451576_0004387 3300045051 Bacteria 18381
93 Ga0451576_0040937 3300045051 Bacteria 4899
94 Ga0451576_0048875 3300045051 Bacteria 4441
95 Ga0451576_0073703 3300045051 Unclassified 3553
96 Ga0451576_0108809 3300045051 Bacteria 2884
97 Ga0451576_0380218 3300045051 Bacteria 1480
98 Ga0451576_0383095 3300045051 Bacteria 1474
99 Ga0451576_0547598 3300045051 Bacteria 1215
100 Ga0451576_0594395 3300045051 Bacteria 1163
101 nmdc:mga05p37_88465_c1 3300050507 Bacteria 3817
102 Ga0500616_0000008 3300053153 Bacteria 785239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0001872 Ga0453684_0001872_43240_44223 223
2 3300037588 Ga0316581_0075612 Ga0316581_0075612_15_845 232
3 3300044712 Ga0453684_0186321 Ga0453684_0186321_1686_2393 233
4 3300035398 Ga0316574_0004274 Ga0316574_0004274_6244_7263 239
5 3300036647 Ga0316582_0023139 Ga0316582_0023139_1963_2982 239
6 3300036712 Ga0316584_0050996 Ga0316584_0050996_1308_2351 239
7 3300005549 Ga0070704_100000005 Ga0070704_10000000512 242
8 3300042876 Ga0451577_0024803 Ga0451577_0024803_1964_2830 242
9 3300044712 Ga0453684_0000009 Ga0453684_0000009_53021_53887 242
10 3300044712 Ga0453684_0041939 Ga0453684_0041939_4982_5896 242
11 3300031691 Ga0316579_10032408 Ga0316579_100324083 244
12 3300031733 Ga0316577_10001929 Ga0316577_100019299 244
13 3300036712 Ga0316584_0002187 Ga0316584_0002187_1603_2598 244
14 3300044712 Ga0453684_0014586 Ga0453684_0014586_954_1814 244
15 3300045051 Ga0451576_0380218 Ga0451576_0380218_297_1157 244
16 3300009147 Ga0114129_10105907 Ga0114129_101059075 246
17 3300044712 Ga0453684_0167888 Ga0453684_0167888_1039_1893 246
18 3300045051 Ga0451576_0594395 Ga0451576_0594395_80_1072 246
19 3300050507 nmdc:mga05p37_88465_c1 nmdc:mga05p37_88465_c1_2328_3293 246
20 3300038727 Ga0400491_28417 Ga0400491_28417_5963_6907 247
21 3300045051 Ga0451576_0383095 Ga0451576_0383095_30_851 249
22 3300005336 Ga0070680_100006567 Ga0070680_1000065677 250
23 3300005530 Ga0070679_100001689 Ga0070679_1000016897 250
24 3300025921 Ga0207652_10113254 Ga0207652_101132543 250
25 3300031251 Ga0265327_10013698 Ga0265327_100136983 250
26 3300041505 Ga0451849_0792182 Ga0451849_0792182_917_1783 250
27 3300045051 Ga0451576_0048875 Ga0451576_0048875_3449_4312 250
28 3300036647 Ga0316582_0126291 Ga0316582_0126291_424_1317 252
29 3300031344 Ga0265316_10328472 Ga0265316_103284722 253
30 3300044712 Ga0453684_0118949 Ga0453684_0118949_1190_2140 255
31 3300031733 Ga0316577_10048213 Ga0316577_100482134 257
32 3300036712 Ga0316584_0064170 Ga0316584_0064170_528_1553 257
33 3300039093 Ga0400489_18103 Ga0400489_18103_2932_3921 258
34 3300031691 Ga0316579_10014856 Ga0316579_100148563 261
35 3300036712 Ga0316584_0000278 Ga0316584_0000278_24545_25528 261
36 3300045051 Ga0451576_0108809 Ga0451576_0108809_579_1436 261
37 3300039093 Ga0400489_23981 Ga0400489_23981_36170_37225 262
38 3300045051 Ga0451576_0003958 Ga0451576_0003958_495_1334 262
39 3300045051 Ga0451576_0040937 Ga0451576_0040937_889_1731 262
40 3300031240 Ga0265320_10027661 Ga0265320_100276613 263
41 3300031250 Ga0265331_10009388 Ga0265331_100093885 263
42 3300031711 Ga0265314_10001735 Ga0265314_1000173517 263
43 3300031733 Ga0316577_10000730 Ga0316577_100007309 263
44 3300031733 Ga0316577_10136574 Ga0316577_101365742 263
45 3300036647 Ga0316582_0004726 Ga0316582_0004726_11_988 263
46 3300042876 Ga0451577_0000003 Ga0451577_0000003_416514_417344 263
47 3300042876 Ga0451577_0069527 Ga0451577_0069527_25_873 263
48 3300042876 Ga0451577_0241608 Ga0451577_0241608_261_1112 263
49 3300042876 Ga0451577_0352002 Ga0451577_0352002_389_1234 263
50 3300044673 Ga0453683_0001340 Ga0453683_0001340_8285_9133 263
51 3300044673 Ga0453683_0059831 Ga0453683_0059831_44_856 263
52 3300044712 Ga0453684_0000018 Ga0453684_0000018_293323_294153 263
53 3300044712 Ga0453684_0000042 Ga0453684_0000042_337340_338185 263
54 3300044712 Ga0453684_0000777 Ga0453684_0000777_89061_89921 263
55 3300044712 Ga0453684_0155006 Ga0453684_0155006_1038_1889 263
56 3300044712 Ga0453684_0697507 Ga0453684_0697507_42_893 263
57 3300045051 Ga0451576_0000243 Ga0451576_0000243_129373_130206 263
58 3300045051 Ga0451576_0000437 Ga0451576_0000437_308_1156 263
59 3300045051 Ga0451576_0073703 Ga0451576_0073703_624_1442 263
60 3300045051 Ga0451576_0547598 Ga0451576_0547598_124_972 263
61 3300005614 Ga0068856_100008301 Ga0068856_1000083014 264
62 3300026078 Ga0207702_10011739 Ga0207702_100117398 264
63 3300031691 Ga0316579_10000241 Ga0316579_100002414 264
64 3300031727 Ga0316576_10025030 Ga0316576_100250304 264
65 3300031733 Ga0316577_10000584 Ga0316577_100005844 264
66 3300031733 Ga0316577_10001746 Ga0316577_100017466 264
67 3300031733 Ga0316577_10043925 Ga0316577_100439252 264
68 3300031733 Ga0316577_10128188 Ga0316577_101281881 264
69 3300032137 Ga0316585_10049791 Ga0316585_100497911 264
70 3300032139 Ga0316580_10038319 Ga0316580_100383192 264
71 3300032168 Ga0316593_10019794 Ga0316593_100197942 264
72 3300036647 Ga0316582_0000336 Ga0316582_0000336_7664_8680 264
73 3300036647 Ga0316582_0010615 Ga0316582_0010615_2163_3173 264
74 3300036712 Ga0316584_0000895 Ga0316584_0000895_8334_9350 264
75 3300036712 Ga0316584_0001093 Ga0316584_0001093_13354_14364 264
76 3300036712 Ga0316584_0079611 Ga0316584_0079611_1427_2443 264
77 3300037588 Ga0316581_0000174 Ga0316581_0000174_6516_7532 264
78 3300044673 Ga0453683_0000006 Ga0453683_0000006_159119_159964 264
79 3300045051 Ga0451576_0000370 Ga0451576_0000370_4506_5351 264
80 3300045051 Ga0451576_0004387 Ga0451576_0004387_2575_3432 264
81 3300005458 Ga0070681_10106866 Ga0070681_101068664 265
82 3300025912 Ga0207707_10113980 Ga0207707_101139804 265
83 3300042876 Ga0451577_0000056 Ga0451577_0000056_17523_18434 269
84 3300044712 Ga0453684_0004229 Ga0453684_0004229_15276_16187 269
85 3300028666 Ga0265336_10009643 Ga0265336_100096434 272
86 3300028800 Ga0265338_10025450 Ga0265338_100254508 272
87 3300031247 Ga0265340_10000131 Ga0265340_1000013110 272
88 3300031595 Ga0265313_10004960 Ga0265313_100049607 272
89 3300005337 Ga0070682_100279245 Ga0070682_1002792451 273
90 3300005841 Ga0068863_100016972 Ga0068863_1000169728 277
91 3300026088 Ga0207641_10012340 Ga0207641_100123405 277
92 3300026095 Ga0207676_10296707 Ga0207676_102967073 277
93 3300045051 Ga0451576_0003965 Ga0451576_0003965_17399_18316 280
94 3300031250 Ga0265331_10079316 Ga0265331_100793162 281
95 3300005549 Ga0070704_100022890 Ga0070704_1000228905 282
96 3300053153 Ga0500616_0000008 Ga0500616_0000008_58544_59401 282
97 3300032002 Ga0307416_100919060 Ga0307416_1009190601 283
98 3300005466 Ga0070685_10264411 Ga0070685_102644111 289
99 3300005336 Ga0070680_100004833 Ga0070680_1000048335 293
100 3300005530 Ga0070679_100032178 Ga0070679_1000321782 293
101 3300025917 Ga0207660_10006186 Ga0207660_100061864 293
102 3300025921 Ga0207652_10035146 Ga0207652_100351462 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

61

337

0.89

Feature Viewer

pLDDT pTM Quality
55.64 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map