F013095

General Info

Members Datasets Scaffolds Average Seq Length
102 75 204 429

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100078055|Ga0070689_1000780552
Length 493
Sequence MTRMRCLFVSFVKRRLMKGYAGVLLSGERMLRGEKTLEVDSIPLELPLGWHPPHQVAKNKSFFDEVASFSQFGQRSKRIETAFSANGGTAVIPTFVNEFWTARQRQASSFHEVSYRACFKPQLPRFFIERLTQPGDVVYDPFMGRGTTPVESALMGRVPFGNDINPLSLTFTGPRLNPPTLEEISARLKGINLTDCDEFPDDLLVFYHPDTLREICALKKYFLGARHSGPQRIATNDAPNSSEALLTNENAATRSAARRDAVGEWLCMVALNRLTGHSPGFFSVYTLPPNQAVSVKSQQKINEKRKQSPPYRDVAKLIIKKSKQLLGDVTPETRQVLASVADKATFTNSPADATTALPANSVSLVVTSPPFLNVVQYADDNWLRCWFLGIDPQSVKLTVPRKLDAWAAAMTSVFHELHRVLKPGGHVAFEVGEVHSGKTKLEETVLPCGIAARLEPVLVLINDQKFTKTANCWGVNNMSKGTNTNRIVVFRKG

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
37 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
38 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
39 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
44 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
45 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
46 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
47 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
48 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
49 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
50 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
54 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
55 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
56 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
57 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
58 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
59 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
60 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
61 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
62 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
63 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
64 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
65 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
66 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
67 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
68 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
69 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
70 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
72 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
73 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
74 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
75 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.06
Stem 0
Stem Tuber 0
Unclassified 20.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100078055 3300005340 Bacteria 2596
2 Ga0065707_10100348 3300005295 Unclassified 2937
3 Ga0070666_10035277 3300005335 Bacteria 3317
4 Ga0070689_100040476 3300005340 Bacteria 3574
5 Ga0070691_10050065 3300005341 Bacteria 1992
6 Ga0070675_100072660 3300005354 Bacteria 2856
7 Ga0070673_100204921 3300005364 Unclassified 1700
8 Ga0070688_100062034 3300005365 Unclassified 2366
9 Ga0070713_100128957 3300005436 Bacteria 2228
10 Ga0070701_10027572 3300005438 Unclassified 2784
11 Ga0070694_100002826 3300005444 Bacteria 10309
12 Ga0070678_100025993 3300005456 Bacteria 3951
13 Ga0070704_100009870 3300005549 Bacteria 5791
14 Ga0068857_100001809 3300005577 Bacteria 17202
15 Ga0068859_100231009 3300005617 Bacteria 1938
16 Ga0068859_100231578 3300005617 Bacteria 1936
17 Ga0068863_100092812 3300005841 Unclassified 2865
18 Ga0081455_10117458 3300005937 Bacteria 2102
19 Ga0068871_100159042 3300006358 Unclassified 1931
20 Ga0075430_100122883 3300006846 Bacteria 2164
21 Ga0075431_100034270 3300006847 Bacteria 5231
22 Ga0075429_100193437 3300006880 Unclassified 1782
23 Ga0097620_100231003 3300006931 Bacteria 1938
24 Ga0097620_100231570 3300006931 Bacteria 1936
25 Ga0105240_10001350 3300009093 Bacteria 42116
26 Ga0111539_10000399 3300009094 Bacteria 54028
27 Ga0111539_10032949 3300009094 Bacteria 6291
28 Ga0111539_10162724 3300009094 Bacteria 2610
29 Ga0111539_10346099 3300009094 Bacteria 1730
30 Ga0105248_10230419 3300009177 Bacteria 2085
31 Ga0157374_10094700 3300013296 Bacteria 2854
32 Ga0157375_10000068 3300013308 Bacteria 110172
33 Ga0163163_10125463 3300014325 Unclassified 2604
34 Ga0207695_10022614 3300025913 Bacteria 7130
35 Ga0207700_10141467 3300025928 Bacteria 1977
36 Ga0207670_10021902 3300025936 Bacteria 3950
37 Ga0207641_10105166 3300026088 Unclassified 2493
38 Ga0207676_10111699 3300026095 Unclassified 2288
39 Ga0207674_10014475 3300026116 Bacteria 8710
40 Ga0207683_10158516 3300026121 Bacteria 2045
41 Ga0207428_10020211 3300027907 Bacteria 5661
42 Ga0265337_1001382 3300028556 Bacteria 11931
43 Ga0265328_10003036 3300031239 Bacteria 7492
44 Ga0265328_10010826 3300031239 Bacteria 3663
45 Ga0265329_10001840 3300031242 Bacteria 10060
46 Ga0265331_10001372 3300031250 Bacteria 17900
47 Ga0265327_10002360 3300031251 Bacteria 20115
48 Ga0265327_10020146 3300031251 Bacteria 4074
49 Ga0265327_10033352 3300031251 Bacteria 2870
50 Ga0265316_10122046 3300031344 Bacteria 1967
51 Ga0265314_10001244 3300031711 Bacteria 29077
52 Ga0307407_10039360 3300031903 Bacteria 2628
53 Ga0373926_0005695 3300035083 Bacteria 4112
54 Ga0373951_0001643 3300035091 Bacteria 5866
55 Ga0373954_0046242 3300035118 Bacteria 2034
56 Ga0373931_0094694 3300035691 Unclassified 1670
57 Ga0373935_0006885 3300035692 Bacteria 6788
58 Ga0373947_0038543 3300035725 Bacteria 2840
59 Ga0373925_0004864 3300037068 Bacteria 10107
60 Ga0451853_4100682 3300041512 Unclassified 2171
61 Ga0451577_0008643 3300042876 Bacteria 9891
62 Ga0451577_0027721 3300042876 Bacteria 5126
63 Ga0451577_0043164 3300042876 Unclassified 4039
64 Ga0453683_0043886 3300044673 Bacteria 2805
65 Ga0453684_0000655 3300044712 Bacteria 124610
66 Ga0453684_0007038 3300044712 Bacteria 21016
67 Ga0453684_0033818 3300044712 Bacteria 7113
68 Ga0453684_0120286 3300044712 Bacteria 3172
69 Ga0451576_0006909 3300045051 Bacteria 13743
70 Ga0451576_0011471 3300045051 Bacteria 10062
71 Ga0451576_0049094 3300045051 Bacteria 4429
72 Ga0451576_0110478 3300045051 Bacteria 2861
73 Ga0451576_0116500 3300045051 Unclassified 2782
74 Ga0451576_0149724 3300045051 Bacteria 2434
75 Ga0451576_0196520 3300045051 Unclassified 2107
76 Ga0451576_0213475 3300045051 Bacteria 2015
77 Ga0495651_0194192 3300046462 Unclassified 1426
78 Ga0495582_0032701 3300046473 Bacteria 2859
79 Ga0495628_0100094 3300046516 Unclassified 2238
80 Ga0495630_0000024 3300046517 Bacteria 155139
81 Ga0495630_0094262 3300046517 Unclassified 2263
82 Ga0495666_0010240 3300046526 Bacteria 4679
83 Ga0495666_0012063 3300046526 Bacteria 4313
84 Ga0495640_0142202 3300046533 Bacteria 1546
85 Ga0495586_0000006 3300046535 Bacteria 168866
86 Ga0495634_0020401 3300046642 Bacteria 4700
87 Ga0495674_0022279 3300047319 Bacteria 5842
88 Ga0495674_0076343 3300047319 Bacteria 2882
89 Ga0495676_0091932 3300047321 Bacteria 2266
90 Ga0496122_0000587 3300048925 Bacteria 74640
91 Ga0496123_0002406 3300048926 Bacteria 23377
92 Ga0501080_0051201 3300049742 Bacteria 3842
93 Ga0501083_0003474 3300049744 Bacteria 11019
94 Ga0501035_0109768 3300049822 Bacteria 2418
95 Ga0501044_0138990 3300049823 Unclassified 2418
96 nmdc:mga09592_89826_c1 3300050508 Unclassified 1806
97 nmdc:mga08y16_118836_c1 3300050511 Bacteria 2751
98 nmdc:mga08y16_203519_c1 3300050511 Unclassified 2051
99 nmdc:mga08y16_3424_c1 3300050511 Bacteria 16460
100 nmdc:mga08y16_41507_c1 3300050511 Bacteria 4819
101 2883359121 2883354860 Bacteria 5865246
102 2891089920 2891088606 Bacteria 4762464
103 Ga0070689_100078055
104 Ga0065707_10100348
105 Ga0070666_10035277
106 Ga0070689_100040476
107 Ga0070691_10050065
108 Ga0070675_100072660
109 Ga0070673_100204921
110 Ga0070688_100062034
111 Ga0070713_100128957
112 Ga0070701_10027572
113 Ga0070694_100002826
114 Ga0070678_100025993
115 Ga0070704_100009870
116 Ga0068857_100001809
117 Ga0068859_100231009
118 Ga0068859_100231578
119 Ga0068863_100092812
120 Ga0081455_10117458
121 Ga0068871_100159042
122 Ga0075430_100122883
123 Ga0075431_100034270
124 Ga0075429_100193437
125 Ga0097620_100231003
126 Ga0097620_100231570
127 Ga0105240_10001350
128 Ga0111539_10000399
129 Ga0111539_10032949
130 Ga0111539_10162724
131 Ga0111539_10346099
132 Ga0105248_10230419
133 Ga0157374_10094700
134 Ga0157375_10000068
135 Ga0163163_10125463
136 Ga0207695_10022614
137 Ga0207700_10141467
138 Ga0207670_10021902
139 Ga0207641_10105166
140 Ga0207676_10111699
141 Ga0207674_10014475
142 Ga0207683_10158516
143 Ga0207428_10020211
144 Ga0265337_1001382
145 Ga0265328_10003036
146 Ga0265328_10010826
147 Ga0265329_10001840
148 Ga0265331_10001372
149 Ga0265327_10002360
150 Ga0265327_10020146
151 Ga0265327_10033352
152 Ga0265316_10122046
153 Ga0265314_10001244
154 Ga0307407_10039360
155 Ga0373926_0005695
156 Ga0373951_0001643
157 Ga0373954_0046242
158 Ga0373931_0094694
159 Ga0373935_0006885
160 Ga0373947_0038543
161 Ga0373925_0004864
162 Ga0451853_4100682
163 Ga0451577_0008643
164 Ga0451577_0027721
165 Ga0451577_0043164
166 Ga0453683_0043886
167 Ga0453684_0000655
168 Ga0453684_0007038
169 Ga0453684_0033818
170 Ga0453684_0120286
171 Ga0451576_0006909
172 Ga0451576_0011471
173 Ga0451576_0049094
174 Ga0451576_0110478
175 Ga0451576_0116500
176 Ga0451576_0149724
177 Ga0451576_0196520
178 Ga0451576_0213475
179 Ga0495651_0194192
180 Ga0495582_0032701
181 Ga0495628_0100094
182 Ga0495630_0000024
183 Ga0495630_0094262
184 Ga0495666_0010240
185 Ga0495666_0012063
186 Ga0495640_0142202
187 Ga0495586_0000006
188 Ga0495634_0020401
189 Ga0495674_0022279
190 Ga0495674_0076343
191 Ga0495676_0091932
192 Ga0496122_0000587
193 Ga0496123_0002406
194 Ga0501080_0051201
195 Ga0501083_0003474
196 Ga0501035_0109768
197 Ga0501044_0138990
198 nmdc:mga09592_89826_c1
199 nmdc:mga08y16_118836_c1
200 nmdc:mga08y16_203519_c1
201 nmdc:mga08y16_3424_c1
202 nmdc:mga08y16_41507_c1
203 2883359121
204 2891089920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01555

N6_N4_Mtase

DNA methylase

56

170

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hek-assembly2.cif.gz_A crystal structure of m1.hpyavi 0.8675 85 142
6isv-assembly1.cif.gz_B structure of acetophenone reductase from geotrichum candidum nbrc 4597 in complex with nad 0.812 90 139
3pii-assembly1.cif.gz_A crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide 0.8045 98 141
1g60-assembly1.cif.gz_A crystal structure of methyltransferase mboiia (moraxella bovis) 0.795 294 431
3wnq-assembly1.cif.gz_A crystal structure of (r)-carbonyl reductase h49a mutant from candida parapsilosis in complex with 2-hydroxyacetophenone 0.7798 100 141
ID Description Score Start End Superfamily
af_A0A1D6MEH1_3_91_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8026 99 141 3.40.50.150
af_Q54VE3_24_203_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8005 79 139 3.40.50.150
5mmsC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7843 87 141 3.40.50.1100
5d86A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7829 87 141 3.40.50.1100
af_P9WLY9_5_208_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7722 87 367 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V6FAU6-F1-model_v4 site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113) 0.9656 27 431 GO:0003677
GO:0008170
GO:0009307
GO:0015667
GO:0032259
AF-A0A7X4D4E6-F1-model_v4 deleted 0.9542 25 388
AF-A0A6B1I1G3-F1-model_v4 Methyltransferase (EC 2.1.1.-) 0.9519 20 396 GO:0003677
GO:0008170
GO:0032259
AF-A0A7X4D4E6-F1-model_v4 deleted 0.9439 25 388
AF-A0A1F4BLE8-F1-model_v4 DNA modification methylase 0.9437 77 430 GO:0003677
GO:0008170
GO:0032259

Map