F010440

General Info

Members Datasets Scaffolds Average Seq Length
101 43 100 336

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0085977|Ga0451577_0085977_952_2058
Length 368
Sequence MKNISDMDNRYVIIMAGGVGSRFWPLSRREKPKQFLDILGTGETLLQQTFRRFKETCPEKNIFVVTSSDHKDLVIEQLGIDPTRVLGEPFRRNTAPCIAYGTFRILKENPKAVIAVTPADHLIVKEDKFCEVIKNCFEFAGKNDALVTIGIKPDRPETGYGYIQANKKKPVKDQENLLKVKTFTEKPNIDLAKIFQESGDFYWNSGIFIWKMKSIMDAFEKYMPDTFAAFGEGRNVFGTKQEQSFIGKTYAECRSISIDYGIMEKADNVYVMCSTDIGWSDLGTWTSLYEHSAVDRSGNAVVRGDLFTYDNKGNIFNIAPGKIAVIQGLKDYIVVDADDVLLIVKKDEEQNIKQYLDDVKKSTQEKFL

Samples

Sample ID Description Type Environment
1 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
2 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
9 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
10 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
11 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
12 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
13 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
14 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
15 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
16 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
17 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
18 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
19 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
20 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
21 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
22 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
23 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
24 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
25 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
26 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
27 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
28 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
29 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
30 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
31 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
32 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
33 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
34 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
35 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
36 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
37 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
38 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
39 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
40 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
41 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
42 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
43 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.92
Nodule 0
Rhizoplane 0
Rhizosphere 73.27
Stem 0
Stem Tuber 0
Unclassified 18.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001404 3300003316 Bacteria 17594
2 rootH1_10001404 3300003323 Bacteria 8713
3 rootH1_10190353 3300003316 Bacteria 1292
4 rootH2_10166600 3300003320 Bacteria 4060
5 rootL2_10002937 3300003322 Bacteria 8222
6 rootL2_10010296 3300003322 Bacteria 10920
7 rootL2_10057374 3300003322 Unclassified 4194
8 rootH1_10003442 3300003323 Bacteria 125253
9 rootH1_10017971 3300003323 Bacteria 2982
10 rootH1_10046526 3300003323 Bacteria 3201
11 rootH1_10055120 3300003323 Bacteria 2956
12 rootH1_10064744 3300003323 Bacteria 6408
13 Ga0065165_1001227 3300005262 Bacteria 29406
14 Ga0075428_100004143 3300006844 Bacteria 15960
15 Ga0111539_10000601 3300009094 Bacteria 46564
16 Ga0111539_10036312 3300009094 Bacteria 5960
17 Ga0157380_10050708 3300014326 Bacteria 3279
18 Ga0307515_10000133 3300028794 Bacteria 176091
19 Ga0307515_10104701 3300028794 Bacteria 3377
20 Ga0307515_10238583 3300028794 Unclassified 1594
21 Ga0265338_10003002 3300028800 Bacteria 24414
22 Ga0265338_10031817 3300028800 Bacteria 5163
23 Ga0265327_10001350 3300031251 Bacteria 31792
24 Ga0307513_10043376 3300031456 Bacteria 4941
25 Ga0307513_10104373 3300031456 Unclassified 2848
26 Ga0307408_100182045 3300031548 Bacteria 1686
27 Ga0316576_10002579 3300031727 Bacteria 10353
28 Ga0316576_10012026 3300031727 Bacteria 5702
29 Ga0316576_10023465 3300031727 Bacteria 4298
30 Ga0316576_10086517 3300031727 Bacteria 2331
31 Ga0316576_10201124 3300031727 Bacteria 1501
32 Ga0316578_10008584 3300031728 Bacteria 5209
33 Ga0316578_10127028 3300031728 Bacteria 1533
34 Ga0316577_10009270 3300031733 Bacteria 5294
35 Ga0307416_100000227 3300032002 Bacteria 29912
36 Ga0307414_10000021 3300032004 Bacteria 213521
37 Ga0307415_100001349 3300032126 Bacteria 11675
38 Ga0316574_0018425 3300035398 Bacteria 4103
39 Ga0316574_0151564 3300035398 Unclassified 1494
40 Ga0316582_0014385 3300036647 Unclassified 4489
41 Ga0316582_0062735 3300036647 Unclassified 2387
42 Ga0316584_0000631 3300036712 Bacteria 19084
43 Ga0316584_0001791 3300036712 Bacteria 13251
44 Ga0316584_0153536 3300036712 Unclassified 1713
45 Ga0395899_0000021 3300037312 Bacteria 391702
46 Ga0395900_0201366 3300037418 Unclassified 2014
47 Ga0400483_006213 3300039062 Bacteria 91642
48 Ga0451849_0210897 3300041505 Unclassified 1624
49 Ga0451577_0005238 3300042876 Bacteria 13338
50 Ga0451577_0017917 3300042876 Bacteria 6535
51 Ga0451577_0043226 3300042876 Bacteria 4036
52 Ga0451577_0085977 3300042876 Bacteria 2806
53 Ga0451577_0133408 3300042876 Bacteria 2229
54 Ga0451577_0160819 3300042876 Bacteria 2022
55 Ga0451577_0270686 3300042876 Bacteria 1538
56 Ga0451577_0289538 3300042876 Bacteria 1484
57 Ga0453683_0000092 3300044673 Bacteria 136648
58 Ga0453683_0000962 3300044673 Bacteria 27319
59 Ga0453683_0003510 3300044673 Bacteria 11521
60 Ga0453683_0205412 3300044673 Bacteria 1251
61 Ga0453684_0000141 3300044712 Bacteria 316572
62 Ga0453684_0000337 3300044712 Bacteria 195296
63 Ga0453684_0005324 3300044712 Bacteria 25639
64 Ga0453684_0006349 3300044712 Bacteria 22539
65 Ga0453684_0008808 3300044712 Bacteria 17900
66 Ga0453684_0014189 3300044712 Bacteria 12795
67 Ga0453684_0019649 3300044712 Bacteria 10266
68 Ga0453684_0027593 3300044712 Bacteria 8135
69 Ga0453684_0030787 3300044712 Bacteria 7568
70 Ga0453684_0041107 3300044712 Bacteria 6261
71 Ga0453684_0048165 3300044712 Bacteria 5641
72 Ga0453684_0073065 3300044712 Bacteria 4326
73 Ga0453684_0074889 3300044712 Bacteria 4259
74 Ga0453684_0089161 3300044712 Bacteria 3816
75 Ga0453684_0120010 3300044712 Bacteria 3177
76 Ga0453684_0197519 3300044712 Bacteria 2347
77 Ga0453684_0226267 3300044712 Unclassified 2163
78 Ga0453684_0489801 3300044712 Bacteria 1363
79 Ga0466971_0083672 3300044719 Unclassified 1457
80 Ga0466959_0006101 3300045049 Bacteria 8321
81 Ga0451576_0000371 3300045051 Bacteria 106687
82 Ga0451576_0000683 3300045051 Bacteria 69004
83 Ga0451576_0001394 3300045051 Bacteria 41542
84 Ga0451576_0010999 3300045051 Bacteria 10337
85 Ga0451576_0032310 3300045051 Bacteria 5575
86 Ga0451576_0047633 3300045051 Bacteria 4506
87 Ga0451576_0050579 3300045051 Bacteria 4358
88 Ga0451576_0144543 3300045051 Bacteria 2480
89 Ga0451576_0204143 3300045051 Unclassified 2064
90 Ga0466958_0234100 3300045836 Unclassified 1173
91 Ga0495638_0000040 3300046460 Bacteria 241883
92 nmdc:mga0qj67_251669_c1 3300050509 Bacteria 1433
93 nmdc:mga08y16_12934_c1 3300050511 Bacteria 8778
94 Ga0500556_0003125 3300053104 Bacteria 4944
95 Ga0500604_0000121 3300053151 Bacteria 23642
96 Ga0500616_0000013 3300053153 Bacteria 674172
97 Ga0500622_0000009 3300053156 Bacteria 419980
98 Ga0500622_0000096 3300053156 Bacteria 90621
99 Ga0500622_0001432 3300053156 Bacteria 19143
100 Ga0500627_0084381 3300053158 Bacteria 1418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10055120 rootH1_100551203 248
2 3300036647 Ga0316582_0062735 Ga0316582_0062735_1457_2374 261
3 3300035398 Ga0316574_0151564 Ga0316574_0151564_351_1292 266
4 3300036712 Ga0316584_0153536 Ga0316584_0153536_242_1183 266
5 3300050509 nmdc:mga0qj67_251669_c1 nmdc:mga0qj67_251669_c1_15_923 271
6 3300045051 Ga0451576_0204143 Ga0451576_0204143_812_1807 295
7 3300044712 Ga0453684_0226267 Ga0453684_0226267_510_1571 297
8 3300003322 rootL2_10057374 rootL2_100573744 298
9 3300028794 Ga0307515_10104701 Ga0307515_101047013 298
10 3300044673 Ga0453683_0205412 Ga0453683_0205412_165_1229 298
11 3300042876 Ga0451577_0043226 Ga0451577_0043226_2865_3953 303
12 3300042876 Ga0451577_0133408 Ga0451577_0133408_719_1786 303
13 3300044712 Ga0453684_0005324 Ga0453684_0005324_1136_2203 303
14 3300044712 Ga0453684_0074889 Ga0453684_0074889_166_1254 303
15 3300037312 Ga0395899_0000021 Ga0395899_0000021_368259_369290 305
16 3300037418 Ga0395900_0201366 Ga0395900_0201366_837_1868 305
17 3300003316 rootH1_10190353 rootH1_101903531 310
18 3300005262 Ga0065165_1001227 Ga0065165_10012273 310
19 3300042876 Ga0451577_0005238 Ga0451577_0005238_1125_2210 310
20 3300044712 Ga0453684_0000141 Ga0453684_0000141_56491_57543 310
21 3300044712 Ga0453684_0000337 Ga0453684_0000337_59704_60789 310
22 3300044712 Ga0453684_0048165 Ga0453684_0048165_607_1659 310
23 3300045051 Ga0451576_0010999 Ga0451576_0010999_2138_3223 310
24 3300045051 Ga0451576_0144543 Ga0451576_0144543_455_1540 310
25 3300028800 Ga0265338_10003002 Ga0265338_100030022 311
26 3300044673 Ga0453683_0003510 Ga0453683_0003510_3779_4867 311
27 3300044712 Ga0453684_0014189 Ga0453684_0014189_6839_7942 311
28 3300044712 Ga0453684_0041107 Ga0453684_0041107_4761_5849 311
29 3300045051 Ga0451576_0001394 Ga0451576_0001394_37893_38981 311
30 3300003322 rootL2_10002937 rootL2_100029375 312
31 3300003323 rootH1_10046526 rootH1_100465263 312
32 3300045051 Ga0451576_0047633 Ga0451576_0047633_2628_3713 312
33 3300039062 Ga0400483_006213 Ga0400483_006213_77023_78114 313
34 3300044712 Ga0453684_0489801 Ga0453684_0489801_256_1341 314
35 3300031251 Ga0265327_10001350 Ga0265327_1000135023 315
36 3300041505 Ga0451849_0210897 Ga0451849_0210897_409_1485 315
37 3300044712 Ga0453684_0073065 Ga0453684_0073065_717_1784 315
38 3300045051 Ga0451576_0050579 Ga0451576_0050579_816_1964 315
39 3300028800 Ga0265338_10031817 Ga0265338_100318174 316
40 3300031727 Ga0316576_10023465 Ga0316576_100234654 316
41 3300031728 Ga0316578_10127028 Ga0316578_101270281 316
42 3300044719 Ga0466971_0083672 Ga0466971_0083672_92_1150 316
43 3300045049 Ga0466959_0006101 Ga0466959_0006101_2898_3956 316
44 3300045836 Ga0466958_0234100 Ga0466958_0234100_26_1084 316
45 3300031727 Ga0316576_10002579 Ga0316576_100025797 317
46 3300044712 Ga0453684_0197519 Ga0453684_0197519_965_2032 317
47 3300045051 Ga0451576_0000371 Ga0451576_0000371_46924_47988 317
48 3300045051 Ga0451576_0032310 Ga0451576_0032310_1365_2429 317
49 3300009094 Ga0111539_10000601 Ga0111539_1000060114 318
50 3300036647 Ga0316582_0014385 Ga0316582_0014385_438_1505 318
51 3300036712 Ga0316584_0000631 Ga0316584_0000631_9822_10889 318
52 3300044673 Ga0453683_0000962 Ga0453683_0000962_17419_18483 318
53 3300044712 Ga0453684_0089161 Ga0453684_0089161_1752_2816 318
54 3300044712 Ga0453684_0120010 Ga0453684_0120010_1104_2168 318
55 3300014326 Ga0157380_10050708 Ga0157380_100507083 319
56 iso_pu_bacteria 2919692658 2919694217 320
57 iso_pu_bacteria 2884634485 2884637093 321
58 3300031548 Ga0307408_100182045 Ga0307408_1001820452 323
59 3300032002 Ga0307416_100000227 Ga0307416_1000002278 323
60 3300032126 Ga0307415_100001349 Ga0307415_10000134912 323
61 3300003320 rootH2_10166600 rootH2_101666003 324
62 3300028794 Ga0307515_10000133 Ga0307515_1000013386 324
63 3300028794 Ga0307515_10238583 Ga0307515_102385832 324
64 3300044673 Ga0453683_0000092 Ga0453683_0000092_17889_18977 324
65 3300044712 Ga0453684_0019649 Ga0453684_0019649_4885_5973 324
66 3300045051 Ga0451576_0000683 Ga0451576_0000683_2620_3708 324
67 3300031456 Ga0307513_10043376 Ga0307513_100433764 325
68 3300032004 Ga0307414_10000021 Ga0307414_10000021142 325
69 3300036712 Ga0316584_0001791 Ga0316584_0001791_9976_11070 325
70 3300042876 Ga0451577_0085977 Ga0451577_0085977_952_2058 325
71 3300042876 Ga0451577_0160819 Ga0451577_0160819_836_1918 325
72 3300044712 Ga0453684_0006349 Ga0453684_0006349_1677_2759 325
73 3300044712 Ga0453684_0027593 Ga0453684_0027593_4128_5213 325
74 3300031727 Ga0316576_10086517 Ga0316576_100865172 326
75 3300035398 Ga0316574_0018425 Ga0316574_0018425_1002_2090 326
76 3300003323 rootH1_10003442 rootH1_100034423 327
77 3300003323 rootH1_10017971 rootH1_100179712 327
78 3300003323 rootH1_10064744 rootH1_100647443 327
79 3300006844 Ga0075428_100004143 Ga0075428_1000041433 327
80 3300031727 Ga0316576_10012026 Ga0316576_100120264 327
81 3300031727 Ga0316576_10201124 Ga0316576_102011242 327
82 3300031728 Ga0316578_10008584 Ga0316578_100085842 327
83 3300031733 Ga0316577_10009270 Ga0316577_100092705 327
84 3300042876 Ga0451577_0017917 Ga0451577_0017917_3832_4923 327
85 3300042876 Ga0451577_0270686 Ga0451577_0270686_199_1290 327
86 3300042876 Ga0451577_0289538 Ga0451577_0289538_194_1288 327
87 3300044712 Ga0453684_0008808 Ga0453684_0008808_14119_15210 327
88 3300044712 Ga0453684_0030787 Ga0453684_0030787_4455_5549 327
89 3300046460 Ga0495638_0000040 Ga0495638_0000040_157878_158954 327
90 3300053104 Ga0500556_0003125 Ga0500556_0003125_1655_2731 327
91 3300053153 Ga0500616_0000013 Ga0500616_0000013_155473_156549 327
92 3300003316 rootH1_10001404 rootH1_100014042 328
93 3300003322 rootL2_10010296 rootL2_100102969 328
94 3300009094 Ga0111539_10036312 Ga0111539_100363123 328
95 3300031456 Ga0307513_10104373 Ga0307513_101043732 328
96 3300050511 nmdc:mga08y16_12934_c1 nmdc:mga08y16_12934_c1_623_1699 328
97 3300053151 Ga0500604_0000121 Ga0500604_0000121_1266_2345 328
98 3300053156 Ga0500622_0000009 Ga0500622_0000009_346943_348022 328
99 3300053156 Ga0500622_0000096 Ga0500622_0000096_77519_78598 328
100 3300053156 Ga0500622_0001432 Ga0500622_0001432_3433_4509 328
101 3300053158 Ga0500627_0084381 Ga0500627_0084381_68_1147 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22640

ManC_GMP_beta-helix

MannoseP isomerase/GMP-like beta-helix domain

304

358

0.86

PF00483

NTP_transferase

Nucleotidyl transferase

11

298

0.81

PF12804

NTP_transf_3

MobA-like NTP transferase domain

12

154

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cu2-assembly1.cif.gz_A-2 crystal structure of mannose-1-phosphate geranyltransferase from thermus thermophilus hb8 0.8261 4 319
2cu2-assembly1.cif.gz_A-2 crystal structure of mannose-1-phosphate geranyltransferase from thermus thermophilus hb8 0.7956 4 319
2qh5-assembly2.cif.gz_B crystal structure of mannose-6-phosphate isomerase from helicobacter pylori 0.7879 4 241
2qh5-assembly1.cif.gz_A crystal structure of mannose-6-phosphate isomerase from helicobacter pylori 0.7872 4 241
3okr-assembly2.cif.gz_C structure of mtb apo 2-c-methyl-d-erythritol 4-phosphate cytidyltransferase (ispd) 0.7872 5 145
ID Description Score Start End Superfamily
af_P24174_4_358_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8453 3 321 3.90.550.10
2cu2A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8261 4 319 3.90.550.10
af_P24174_4_358_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.821 3 321 3.90.550.10
2cu2A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7956 4 319 3.90.550.10
2qh5A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7872 4 241 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3L7UWM1-F1-model_v4 deleted 0.9793 5 114
AF-A0A7C1IZM1-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.978 4 125 GO:0004475
GO:0009298
AF-A0A5M5BV85-F1-model_v4 NTP transferase domain-containing protein 0.9777 4 153 GO:0004475
GO:0009298
AF-A0A520C348-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.9769 1 105 GO:0004475
GO:0009298
AF-A0A382PPD6-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9768 4 153 GO:0004475
GO:0009298

Feature Viewer

pLDDT pTM Quality
80.21 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map