F008047

General Info

Members Datasets Scaffolds Average Seq Length
101 77 202 213

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100007148|Ga0068864_10000714817
Length 237
Sequence LDAGAGEAAMNSPASDEVAALYVATNGCYFGLPGVDPWDQARDARLYAGPHPVVAHPPCERWGRYWSGGPSARVRRLKGDDGGCFAAALAAVRRWTGLLEHPEASHAWSHHGLNAPPRAGGWIPADFLGGWTCCVEQGHYGHRARKATWLYAFGVDLPELAWRSCGIKMRLDEGFNSKEERRRAVRTGACQRLSKNQRLATPEPFRDLLLSIARTKPRLRPGFPLENPGCGLGSEAA

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
47 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
48 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
49 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
50 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
51 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
60 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
61 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
62 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
63 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
68 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
71 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
72 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
73 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
76 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
77 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0
Rhizoplane 3.96
Rhizosphere 92.08
Stem 0
Stem Tuber 0
Unclassified 25.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100007148 3300005618 Bacteria 9167
2 rootL2_10051855 3300003322 Viruses 8307
3 Ga0065707_10105970 3300005295 Bacteria 2620
4 Ga0070683_100015956 3300005329 Bacteria 6608
5 Ga0068868_100031373 3300005338 Viruses 4081
6 Ga0070703_10025607 3300005406 Bacteria 1750
7 Ga0070713_100775159 3300005436 Bacteria 918
8 Ga0070700_100059131 3300005441 Unclassified 2411
9 Ga0070708_100000039 3300005445 Bacteria 85650
10 Ga0070684_100071418 3300005535 Viruses 3055
11 Ga0070697_100080590 3300005536 Bacteria 2682
12 Ga0068855_100000746 3300005563 Bacteria 39999
13 Ga0068857_100522760 3300005577 Bacteria 1115
14 Ga0068857_100719679 3300005577 Unclassified 949
15 Ga0068856_100078605 3300005614 Viruses 3271
16 Ga0068856_100363931 3300005614 Bacteria 1465
17 Ga0068864_100918548 3300005618 Unclassified 865
18 Ga0068863_100000754 3300005841 Bacteria 32393
19 Ga0068862_100050746 3300005844 Viruses 3546
20 Ga0068862_100084452 3300005844 Viruses 2758
21 Ga0068862_100116289 3300005844 Bacteria 2352
22 Ga0070712_100325884 3300006175 Unclassified 1250
23 Ga0097621_100000070 3300006237 Bacteria 52529
24 Ga0068871_100000093 3300006358 Bacteria 52499
25 Ga0075428_100300025 3300006844 Unclassified 1727
26 Ga0075429_100433265 3300006880 Bacteria 1152
27 Ga0075435_100000098 3300007076 Bacteria 46168
28 Ga0111539_11377372 3300009094 Bacteria 818
29 Ga0105245_10000361 3300009098 Bacteria 42531
30 Ga0105241_10003373 3300009174 Bacteria 11896
31 Ga0105248_10755738 3300009177 Unclassified 1097
32 Ga0157373_10064154 3300013100 Bacteria 2600
33 Ga0157370_10013179 3300013104 Bacteria 8525
34 Ga0163163_10492855 3300014325 Unclassified 1287
35 Ga0157376_10036617 3300014969 Bacteria 3976
36 Ga0207653_10092642 3300025885 Bacteria 1060
37 Ga0207654_10051236 3300025911 Unclassified 2375
38 Ga0207693_10301665 3300025915 Unclassified 1255
39 Ga0207663_10269582 3300025916 Bacteria 1260
40 Ga0207687_10000173 3300025927 Bacteria 42629
41 Ga0207664_10034133 3300025929 Viruses 3916
42 Ga0207661_10010318 3300025944 Bacteria 6720
43 Ga0207667_10000824 3300025949 Bacteria 40076
44 Ga0207708_10320896 3300026075 Bacteria 1264
45 Ga0207641_10015299 3300026088 Bacteria 6288
46 Ga0207676_10200333 3300026095 Bacteria 1763
47 Ga0207674_10029962 3300026116 Bacteria 5725
48 Ga0207674_10134419 3300026116 Unclassified 2436
49 Ga0268265_10006836 3300028380 Bacteria 7720
50 Ga0268265_10066793 3300028380 Bacteria 2781
51 Ga0268265_10977603 3300028380 Unclassified 835
52 Ga0265323_10002161 3300028653 Bacteria 9166
53 Ga0307509_10000853 3300031507 Bacteria 52545
54 Ga0307509_10001259 3300031507 Bacteria 42961
55 Ga0316577_10139326 3300031733 Unclassified 1366
56 Ga0373952_0041843 3300035092 Bacteria 1061
57 Ga0373936_0000573 3300035113 Bacteria 12658
58 Ga0373943_0175167 3300035170 Bacteria 1176
59 Ga0373935_0001280 3300035692 Bacteria 13856
60 Ga0373927_0207975 3300035695 Unclassified 1285
61 Ga0373937_0897679 3300036401 Bacteria 835
62 Ga0373925_0000140 3300037068 Bacteria 77172
63 Ga0395899_0022499 3300037312 Bacteria 4778
64 Ga0395899_0033345 3300037312 Bacteria 3867
65 Ga0395899_0382241 3300037312 Unclassified 935
66 Ga0395900_0218518 3300037418 Bacteria 1922
67 Ga0395900_0244061 3300037418 Bacteria 1800
68 Ga0395900_0491609 3300037418 Bacteria 1178
69 Ga0395900_0962727 3300037418 Unclassified 774
70 Ga0395898_0015872 3300037466 Bacteria 7717
71 Ga0395898_0022262 3300037466 Bacteria 6420
72 Ga0395898_0056149 3300037466 Viruses 3839
73 Ga0395898_0090632 3300037466 Viruses 2942
74 Ga0395898_0134921 3300037466 Bacteria 2363
75 Ga0395898_1020538 3300037466 Unclassified 762
76 Ga0395905_0003120 3300037471 Bacteria 17872
77 Ga0395905_0292841 3300037471 Bacteria 1514
78 Ga0395901_0116071 3300038443 Bacteria 2812
79 Ga0395901_0285026 3300038443 Bacteria 1715
80 Ga0395901_1106382 3300038443 Unclassified 762
81 Ga0451789_0500483 3300041443 Bacteria 1399
82 Ga0451802_1696109 3300041460 Bacteria 2784
83 Ga0451807_0710603 3300041486 Unclassified 3209
84 Ga0466969_0001408 3300044656 Bacteria 12965
85 Ga0466969_0156728 3300044656 Unclassified 1047
86 Ga0466972_0031256 3300044658 Unclassified 2619
87 Ga0453683_0083635 3300044673 Viruses 2000
88 Ga0466966_0005245 3300044684 Bacteria 8519
89 Ga0466961_0451137 3300044693 Unclassified 778
90 Ga0495641_0050471 3300046461 Bacteria 1901
91 Ga0495605_0035920 3300046474 Bacteria 2502
92 Ga0495628_0005495 3300046516 Bacteria 11093
93 Ga0495628_0037584 3300046516 Unclassified 3882
94 Ga0495586_0170143 3300046535 Unclassified 1231
95 Ga0495588_0052224 3300046674 Unclassified 2106
96 Ga0495658_0003349 3300046683 Bacteria 7946
97 Ga0495674_1003631 3300047319 Unclassified 639
98 Ga0496115_0554346 3300048918 Unclassified 918
99 nmdc:mga09592_354157_c1 3300050508 Bacteria 1270
100 nmdc:mga0rr50_105_c1 3300050513 Bacteria 46468
101 Ga0500644_0014723 3300053088 Bacteria 2214
102 Ga0068864_100007148
103 rootL2_10051855
104 Ga0065707_10105970
105 Ga0070683_100015956
106 Ga0068868_100031373
107 Ga0070703_10025607
108 Ga0070713_100775159
109 Ga0070700_100059131
110 Ga0070708_100000039
111 Ga0070684_100071418
112 Ga0070697_100080590
113 Ga0068855_100000746
114 Ga0068857_100522760
115 Ga0068857_100719679
116 Ga0068856_100078605
117 Ga0068856_100363931
118 Ga0068864_100918548
119 Ga0068863_100000754
120 Ga0068862_100050746
121 Ga0068862_100084452
122 Ga0068862_100116289
123 Ga0070712_100325884
124 Ga0097621_100000070
125 Ga0068871_100000093
126 Ga0075428_100300025
127 Ga0075429_100433265
128 Ga0075435_100000098
129 Ga0111539_11377372
130 Ga0105245_10000361
131 Ga0105241_10003373
132 Ga0105248_10755738
133 Ga0157373_10064154
134 Ga0157370_10013179
135 Ga0163163_10492855
136 Ga0157376_10036617
137 Ga0207653_10092642
138 Ga0207654_10051236
139 Ga0207693_10301665
140 Ga0207663_10269582
141 Ga0207687_10000173
142 Ga0207664_10034133
143 Ga0207661_10010318
144 Ga0207667_10000824
145 Ga0207708_10320896
146 Ga0207641_10015299
147 Ga0207676_10200333
148 Ga0207674_10029962
149 Ga0207674_10134419
150 Ga0268265_10006836
151 Ga0268265_10066793
152 Ga0268265_10977603
153 Ga0265323_10002161
154 Ga0307509_10000853
155 Ga0307509_10001259
156 Ga0316577_10139326
157 Ga0373952_0041843
158 Ga0373936_0000573
159 Ga0373943_0175167
160 Ga0373935_0001280
161 Ga0373927_0207975
162 Ga0373937_0897679
163 Ga0373925_0000140
164 Ga0395899_0022499
165 Ga0395899_0033345
166 Ga0395899_0382241
167 Ga0395900_0218518
168 Ga0395900_0244061
169 Ga0395900_0491609
170 Ga0395900_0962727
171 Ga0395898_0015872
172 Ga0395898_0022262
173 Ga0395898_0056149
174 Ga0395898_0090632
175 Ga0395898_0134921
176 Ga0395898_1020538
177 Ga0395905_0003120
178 Ga0395905_0292841
179 Ga0395901_0116071
180 Ga0395901_0285026
181 Ga0395901_1106382
182 Ga0451789_0500483
183 Ga0451802_1696109
184 Ga0451807_0710603
185 Ga0466969_0001408
186 Ga0466969_0156728
187 Ga0466972_0031256
188 Ga0453683_0083635
189 Ga0466966_0005245
190 Ga0466961_0451137
191 Ga0495641_0050471
192 Ga0495605_0035920
193 Ga0495628_0005495
194 Ga0495628_0037584
195 Ga0495586_0170143
196 Ga0495588_0052224
197 Ga0495658_0003349
198 Ga0495674_1003631
199 Ga0496115_0554346
200 nmdc:mga09592_354157_c1
201 nmdc:mga0rr50_105_c1
202 Ga0500644_0014723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r78-assembly1.cif.gz_A cryo-em structure of dnmt5 quaternary complex with hemimethylated dna, amp-pnp and sah 0.5799 39 141
7ubu-assembly1.cif.gz_A crystal structure of zmet2 in complex with hemimethylated cag dna and a histone h3kc9me2 peptide 0.4948 37 141
6w8v-assembly1.cif.gz_A crystal structure of mouse dnmt1 in complex with acg dna 0.4822 1 147
4ft4-assembly1.cif.gz_B crystal structure of zea mays zmet2 in complex h3(1-32)k9me2 peptide and sah 0.4732 37 141
7zqt-assembly1.cif.gz_A helicobacter pylori adhesin baba bound to neutralising human antibody. 0.4695 91 140
ID Description Score Start End Superfamily
af_I1KCC0_1123_1326_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.4969 1 150 3.40.50.150
af_I6YG32_8_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.4954 58 141 3.40.630.30
af_I1J8E3_201_591_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.48 37 150 3.40.50.150
af_Q9VKB3_3_179_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.4768 41 149 3.40.50.150
af_B1Q3J6_1074_1346_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.4761 1 150 3.40.50.150
ID Description Score Start End GO Terms
AF-Q2G4M7-F1-model_v4 Uncharacterized protein 0.8721 5 105
AF-A0A855K8Y1-F1-model_v4 deleted 0.8658 1 205
AF-A0A3N5HAF2-F1-model_v4 Uncharacterized protein 0.8626 2 204
AF-A0A5C7LG95-F1-model_v4 Uncharacterized protein 0.8542 1 202
AF-A0A855K8Y1-F1-model_v4 deleted 0.8451 1 205

Map