F002094

General Info

Members Datasets Scaffolds Average Seq Length
100 85 100 129

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10605875|Ga0081455_106058752
Length 133
Sequence VALLIDTDLLIELERADDAAQIERLLGEEERAISVITVSELLHGVLRASGTIRVRRRAFVEHLLAGLEAIPITEPVARVHAEIWADLSGRGEPIGAHDLWIAATALAHELGVATRNAVHFGRVPGLRVVAASA

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
33 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
39 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
40 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
46 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
50 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
51 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
52 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
53 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
54 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
55 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
56 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
57 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
58 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
59 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
60 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
61 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
62 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
63 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
64 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
65 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
66 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
67 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
68 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
69 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
76 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
77 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
82 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
83 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
84 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
85 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12
Rhizosphere 86
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000676 3300002074 Bacteria 3674
2 JGI24034J26672_10000184 3300002239 Bacteria 8469
3 JGI25407J50210_10145801 3300003373 Unclassified 583
4 Ga0070670_100104727 3300005331 Bacteria 2437
5 Ga0070688_100001358 3300005365 Bacteria 12156
6 Ga0070711_100013920 3300005439 Bacteria 5060
7 Ga0070662_100000009 3300005457 Bacteria 142979
8 Ga0070685_10000010 3300005466 Bacteria 146946
9 Ga0070672_100000023 3300005543 Bacteria 68631
10 Ga0070693_100385036 3300005547 Bacteria 968
11 Ga0068852_100000104 3300005616 Bacteria 56243
12 Ga0081455_10605875 3300005937 Unclassified 713
13 Ga0081538_10002495 3300005981 Bacteria 17936
14 Ga0070712_100000007 3300006175 Bacteria 157653
15 Ga0070712_100003613 3300006175 Bacteria 9537
16 Ga0075433_10001528 3300006852 Bacteria 17083
17 Ga0075433_10030850 3300006852 Bacteria 4577
18 Ga0075434_100033678 3300006871 Bacteria 5057
19 Ga0068865_100000040 3300006881 Bacteria 72979
20 Ga0105240_10067612 3300009093 Bacteria 4429
21 Ga0105243_10076984 3300009148 Unclassified 2712
22 Ga0105239_10240256 3300010375 Bacteria 2033
23 Ga0157375_10000322 3300013308 Bacteria 42941
24 Ga0207695_10024934 3300025913 Bacteria 6711
25 Ga0207693_10000001 3300025915 Bacteria 469535
26 Ga0207663_10002483 3300025916 Bacteria 8880
27 Ga0207650_10219409 3300025925 Bacteria 1530
28 Ga0207659_11465427 3300025926 Unclassified 584
29 Ga0207706_10000001 3300025933 Bacteria 423014
30 Ga0207709_10045087 3300025935 Unclassified 2668
31 Ga0207704_10000079 3300025938 Bacteria 58183
32 Ga0207691_10000172 3300025940 Bacteria 60310
33 Ga0207698_10000015 3300026142 Bacteria 207368
34 Ga0265319_1000006 3300028563 Bacteria 228868
35 Ga0265318_10005828 3300028577 Bacteria 5741
36 Ga0265338_10100809 3300028800 Bacteria 2353
37 Ga0265330_10093887 3300031235 Unclassified 1287
38 Ga0265320_10029830 3300031240 Bacteria 2819
39 Ga0265320_10093243 3300031240 Bacteria 1393
40 Ga0265316_10028668 3300031344 Bacteria 4590
41 Ga0265316_10119308 3300031344 Bacteria 1993
42 Ga0265313_10172238 3300031595 Unclassified 914
43 Ga0265314_10012305 3300031711 Bacteria 6991
44 Ga0373929_0000003 3300035085 Bacteria 575058
45 Ga0395900_0045245 3300037418 Bacteria 4533
46 Ga0395898_0034424 3300037466 Bacteria 5048
47 Ga0395905_0008842 3300037471 Bacteria 9898
48 Ga0395901_0035260 3300038443 Bacteria 5168
49 Ga0436361_0308968 3300039447 Bacteria 2989
50 Ga0451807_2004923 3300041486 Unclassified 745
51 Ga0466965_0222543 3300044683 Bacteria 1006
52 Ga0466963_0044900 3300044694 Bacteria 2909
53 Ga0466967_0468460 3300045976 Bacteria 1233
54 Ga0466967_1769049 3300045976 Bacteria 615
55 Ga0495603_0006916 3300046455 Bacteria 6807
56 Ga0495641_0152848 3300046461 Bacteria 1032
57 Ga0495651_0321235 3300046462 Bacteria 1032
58 Ga0495651_0470256 3300046462 Unclassified 809
59 Ga0495653_0097167 3300046463 Unclassified 2140
60 Ga0495664_0000029 3300046477 Bacteria 96330
61 Ga0495628_0000058 3300046516 Bacteria 87600
62 Ga0495652_0000060 3300046529 Bacteria 111891
63 Ga0495652_0000061 3300046529 Bacteria 111729
64 Ga0495652_0035890 3300046529 Bacteria 4313
65 Ga0495586_0001585 3300046535 Bacteria 12509
66 Ga0495587_0155053 3300046536 Bacteria 1304
67 Ga0495587_0170665 3300046536 Bacteria 1236
68 Ga0495623_0683558 3300046679 Unclassified 527
69 Ga0495646_0291863 3300046680 Unclassified 864
70 Ga0495613_0000027 3300046689 Bacteria 146674
71 Ga0495624_0006879 3300046690 Bacteria 8028
72 Ga0495670_0031486 3300046691 Unclassified 2636
73 Ga0495604_0000058 3300047317 Bacteria 96955
74 Ga0495680_0000183 3300047322 Bacteria 66401
75 Ga0495684_0465118 3300047471 Unclassified 876
76 Ga0495602_0002468 3300048088 Bacteria 18842
77 Ga0496104_0000007 3300048907 Bacteria 524804
78 Ga0496105_0000002 3300048908 Bacteria 753215
79 Ga0496108_0000241 3300048911 Bacteria 48812
80 Ga0496109_0000203 3300048912 Bacteria 58779
81 Ga0496109_0001451 3300048912 Bacteria 19649
82 Ga0496110_0144572 3300048913 Bacteria 2151
83 Ga0496111_0764386 3300048914 Unclassified 700
84 Ga0496112_0000807 3300048915 Bacteria 22108
85 Ga0496112_0001115 3300048915 Bacteria 19955
86 Ga0496113_0000014 3300048916 Bacteria 79850
87 Ga0496113_0066623 3300048916 Bacteria 2728
88 Ga0496119_0021821 3300048922 Bacteria 4610
89 Ga0496125_0125499 3300048928 Bacteria 1820
90 Ga0501048_0947003 3300049582 Bacteria 619
91 Ga0501048_1235605 3300049582 Unclassified 537
92 Ga0501076_0381988 3300049592 Unclassified 1158
93 Ga0501080_0296521 3300049742 Bacteria 1467
94 nmdc:mga0a205_124_c1 3300050515 Bacteria 3735
95 nmdc:mga0a205_225631_c1 3300050515 Bacteria 1758
96 Ga0495601_0000017 3300053077 Bacteria 204209
97 Ga0495601_0606454 3300053077 Bacteria 702
98 Ga0495619_0000096 3300053085 Bacteria 66203
99 Ga0590077_043669 3300059426 Bacteria 999
100 Ga0501082_1088984 3300060353 Bacteria 699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10001528 Ga0075433_1000152815 111
2 3300006871 Ga0075434_100033678 Ga0075434_1000336783 111
3 3300037418 Ga0395900_0045245 Ga0395900_0045245_2175_2522 111
4 3300037466 Ga0395898_0034424 Ga0395898_0034424_2013_2360 111
5 3300037471 Ga0395905_0008842 Ga0395905_0008842_5473_5820 111
6 3300038443 Ga0395901_0035260 Ga0395901_0035260_2809_3156 111
7 3300045976 Ga0466967_1769049 Ga0466967_1769049_190_537 111
8 3300045976 Ga0466967_0468460 Ga0466967_0468460_761_1159 116
9 3300003373 JGI25407J50210_10145801 JGI25407J50210_101458012 118
10 3300005981 Ga0081538_10002495 Ga0081538_100024959 118
11 3300049582 Ga0501048_0947003 Ga0501048_0947003_14_394 120
12 3300049592 Ga0501076_0381988 Ga0501076_0381988_704_1084 120
13 3300025916 Ga0207663_10002483 Ga0207663_100024834 122
14 3300005937 Ga0081455_10605875 Ga0081455_106058752 129
15 3300028563 Ga0265319_1000006 Ga0265319_1000006165 129
16 3300028577 Ga0265318_10005828 Ga0265318_100058286 129
17 3300028800 Ga0265338_10100809 Ga0265338_101008092 129
18 3300031235 Ga0265330_10093887 Ga0265330_100938873 129
19 3300031240 Ga0265320_10029830 Ga0265320_100298305 129
20 3300031240 Ga0265320_10093243 Ga0265320_100932432 129
21 3300031344 Ga0265316_10028668 Ga0265316_100286686 129
22 3300031595 Ga0265313_10172238 Ga0265313_101722382 129
23 3300031711 Ga0265314_10012305 Ga0265314_100123052 129
24 3300039447 Ga0436361_0308968 Ga0436361_0308968_2505_2900 129
25 3300044694 Ga0466963_0044900 Ga0466963_0044900_1720_2121 129
26 3300048913 Ga0496110_0144572 Ga0496110_0144572_1713_2108 129
27 3300049582 Ga0501048_1235605 Ga0501048_1235605_97_489 129
28 3300060353 Ga0501082_1088984 Ga0501082_1088984_169_573 129
29 3300002074 JGI24748J21848_1000676 JGI24748J21848_10006764 130
30 3300002239 JGI24034J26672_10000184 JGI24034J26672_100001845 130
31 3300005331 Ga0070670_100104727 Ga0070670_1001047273 130
32 3300005365 Ga0070688_100001358 Ga0070688_10000135810 130
33 3300005439 Ga0070711_100013920 Ga0070711_1000139204 130
34 3300005457 Ga0070662_100000009 Ga0070662_100000009100 130
35 3300005466 Ga0070685_10000010 Ga0070685_1000001028 130
36 3300005543 Ga0070672_100000023 Ga0070672_10000002340 130
37 3300005547 Ga0070693_100385036 Ga0070693_1003850362 130
38 3300005616 Ga0068852_100000104 Ga0068852_10000010460 130
39 3300006175 Ga0070712_100000007 Ga0070712_10000000773 130
40 3300006175 Ga0070712_100003613 Ga0070712_10000361314 130
41 3300006852 Ga0075433_10030850 Ga0075433_100308505 130
42 3300006881 Ga0068865_100000040 Ga0068865_10000004017 130
43 3300009093 Ga0105240_10067612 Ga0105240_100676125 130
44 3300009148 Ga0105243_10076984 Ga0105243_100769842 130
45 3300010375 Ga0105239_10240256 Ga0105239_102402564 130
46 3300013308 Ga0157375_10000322 Ga0157375_100003227 130
47 3300025913 Ga0207695_10024934 Ga0207695_100249348 130
48 3300025915 Ga0207693_10000001 Ga0207693_10000001363 130
49 3300025925 Ga0207650_10219409 Ga0207650_102194093 130
50 3300025926 Ga0207659_11465427 Ga0207659_114654271 130
51 3300025933 Ga0207706_10000001 Ga0207706_1000000153 130
52 3300025935 Ga0207709_10045087 Ga0207709_100450875 130
53 3300025938 Ga0207704_10000079 Ga0207704_1000007949 130
54 3300025940 Ga0207691_10000172 Ga0207691_1000017244 130
55 3300026142 Ga0207698_10000015 Ga0207698_1000001525 130
56 3300031344 Ga0265316_10119308 Ga0265316_101193082 130
57 3300035085 Ga0373929_0000003 Ga0373929_0000003_360196_360600 130
58 3300041486 Ga0451807_2004923 Ga0451807_2004923_136_528 130
59 3300044683 Ga0466965_0222543 Ga0466965_0222543_205_606 130
60 3300046455 Ga0495603_0006916 Ga0495603_0006916_919_1311 130
61 3300046461 Ga0495641_0152848 Ga0495641_0152848_55_447 130
62 3300046462 Ga0495651_0321235 Ga0495651_0321235_579_971 130
63 3300046462 Ga0495651_0470256 Ga0495651_0470256_161_553 130
64 3300046463 Ga0495653_0097167 Ga0495653_0097167_1304_1696 130
65 3300046477 Ga0495664_0000029 Ga0495664_0000029_14272_14688 130
66 3300046516 Ga0495628_0000058 Ga0495628_0000058_71571_71963 130
67 3300046529 Ga0495652_0000060 Ga0495652_0000060_8490_8882 130
68 3300046529 Ga0495652_0000061 Ga0495652_0000061_103235_103627 130
69 3300046529 Ga0495652_0035890 Ga0495652_0035890_287_679 130
70 3300046535 Ga0495586_0001585 Ga0495586_0001585_5188_5580 130
71 3300046536 Ga0495587_0155053 Ga0495587_0155053_823_1215 130
72 3300046536 Ga0495587_0170665 Ga0495587_0170665_833_1225 130
73 3300046679 Ga0495623_0683558 Ga0495623_0683558_31_423 130
74 3300046680 Ga0495646_0291863 Ga0495646_0291863_296_688 130
75 3300046689 Ga0495613_0000027 Ga0495613_0000027_44873_45265 130
76 3300046690 Ga0495624_0006879 Ga0495624_0006879_4176_4568 130
77 3300046691 Ga0495670_0031486 Ga0495670_0031486_479_871 130
78 3300047317 Ga0495604_0000058 Ga0495604_0000058_47024_47416 130
79 3300047322 Ga0495680_0000183 Ga0495680_0000183_28440_28832 130
80 3300047471 Ga0495684_0465118 Ga0495684_0465118_152_544 130
81 3300048088 Ga0495602_0002468 Ga0495602_0002468_9777_10169 130
82 3300048907 Ga0496104_0000007 Ga0496104_0000007_244697_245089 130
83 3300048908 Ga0496105_0000002 Ga0496105_0000002_447636_448028 130
84 3300048911 Ga0496108_0000241 Ga0496108_0000241_44113_44505 130
85 3300048912 Ga0496109_0000203 Ga0496109_0000203_44113_44505 130
86 3300048912 Ga0496109_0001451 Ga0496109_0001451_12388_12780 130
87 3300048914 Ga0496111_0764386 Ga0496111_0764386_82_474 130
88 3300048915 Ga0496112_0000807 Ga0496112_0000807_11511_11903 130
89 3300048915 Ga0496112_0001115 Ga0496112_0001115_6572_6973 130
90 3300048916 Ga0496113_0000014 Ga0496113_0000014_23302_23703 130
91 3300048916 Ga0496113_0066623 Ga0496113_0066623_978_1373 130
92 3300048922 Ga0496119_0021821 Ga0496119_0021821_3633_4025 130
93 3300048928 Ga0496125_0125499 Ga0496125_0125499_14_406 130
94 3300049742 Ga0501080_0296521 Ga0501080_0296521_180_581 130
95 3300050515 nmdc:mga0a205_124_c1 nmdc:mga0a205_124_c1_1290_1682 130
96 3300050515 nmdc:mga0a205_225631_c1 nmdc:mga0a205_225631_c1_83_484 130
97 3300053077 Ga0495601_0000017 Ga0495601_0000017_83454_83846 130
98 3300053077 Ga0495601_0606454 Ga0495601_0606454_77_505 130
99 3300053085 Ga0495619_0000096 Ga0495619_0000096_2107_2499 130
100 3300059426 Ga0590077_043669 Ga0590077_043669_361_765 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

3

126

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.9367 1 129
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.9078 1 129
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.892 1 130
6ifm-assembly1.cif.gz_C crystal structure of dna bound vapbc from salmonella typhimurium 0.8907 1 129
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.8903 1 129
ID Description Score Start End Superfamily
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9367 1 129 3.40.50.1010
af_O07783_4_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9307 1 130 3.40.50.1010
af_O07783_4_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9237 1 130 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9078 1 129 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.892 1 130 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A0C1QKM7-F1-model_v4 Putative ribonuclease VapC (EC 3.1.-.-) 0.9922 30 130 GO:0004518
GO:0046872
AF-A0A2M7F5K1-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9801 30 130 GO:0004518
GO:0046872
AF-A0A7X1PF99-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9795 1 128 GO:0000287
GO:0004540
GO:0090729
AF-A0A2V9EVA8-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9713 32 130 GO:0004518
GO:0046872
AF-A0A557RTV2-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9673 32 130 GO:0004518
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.25 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map