F494064

General Info

Members Datasets Scaffolds Average Seq Length
1452 507 1128 434

Family's Representative Sequence

Representative Sequence 2124908027|MRS2a_Contig_772|MRS2a_00629050
Length 532
Sequence MNARAQQPAPNHQHPASYYAASSLPQPDHPVLTGDLVADVCVVGGGFSGLNTALELAERGFSVILLEAHKIGWGASGRNGGQLIRGVGHGLDQFANVVGADGVRQMKLMGLEAVEIVRQRVERFQIPCDLTWGYCDLANKPRDLEGFAEDAEELRSLGYRYETRLLQASEMHSVVGSDRYVGGLIDMGSGHLHPLNLALGEAAAAQQLGVKLFEQSAVTRIDYGPEVKVYTAQGSVRAKTLVLGCNAYLNELNPELGGKVLPAGSYIIATEPLSEALAHSLLPQNMAVCDQRVALDYYRLSADRRLLFGGACHYSGRDPKDIAAYMQPKMLEVFPQLAGVKIDYQWGGMIGIGANRLPQIGRLKDQPNVYYAQAYSGHGVNATHLRGSCWLKLSVASRVEGLICLPGCRISPFLAASICARRCWRWGXCGIGLKSWSDTFSVPVLASSRAGSLPQWICERHRSPVGASLLAMGSTQIXXNGLSPSSRACSRSSSNALRVCRRCQNRPQRLRPDGALRMTASRAPLFCPAASS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231024 Pseudomonas sp. GM84 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
22 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
23 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
24 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
25 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
26 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
27 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
28 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
29 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
30 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
31 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
32 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
33 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
34 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
35 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
36 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
37 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
38 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
39 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
40 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
41 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
42 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
43 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
44 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
45 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
46 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
47 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
48 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
49 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
50 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
51 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
52 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
53 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
54 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
55 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
56 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
57 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
58 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
59 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
60 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
61 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
62 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
63 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
64 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
65 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
66 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
67 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
68 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
69 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
70 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
71 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
72 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
73 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
74 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
75 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
76 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
77 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
78 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
79 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
80 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
81 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
82 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
83 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
84 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
85 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
86 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
87 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
88 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
89 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
90 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
91 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
92 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
93 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
94 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
95 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
96 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
97 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
98 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
99 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
100 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
101 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
102 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
103 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
104 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
105 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
106 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
107 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
108 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
109 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
110 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
111 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
112 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
113 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
114 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
115 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
116 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
117 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
118 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
119 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
120 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
121 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
122 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
123 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
124 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
125 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
126 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
127 2765235841 Pseudomonas putida AA7 Isolate Unclassified
128 2773857670 Pseudomonas sp. 478 Isolate Unclassified
129 2773857673 Pseudomonas sp. 443 Isolate Unclassified
130 2784132063 Pseudomonas sp. 424 Isolate Unclassified
131 2784132072 Pseudomonas sp. 460 Isolate Unclassified
132 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
133 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
134 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
135 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
136 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
137 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
138 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
139 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
140 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
141 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
142 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
143 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
144 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
145 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
146 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
147 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
148 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
149 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
150 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
151 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
152 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
153 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
154 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
155 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
156 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
157 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
158 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
159 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
160 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
161 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
162 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
163 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
164 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
165 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
166 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
167 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
168 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
169 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
170 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
171 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
172 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
173 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
174 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
175 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
176 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
177 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
178 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
179 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
180 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
181 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
182 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
183 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
184 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
185 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
186 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
187 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
188 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
189 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
190 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
191 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
192 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
193 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
194 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
195 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
196 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
197 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
198 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
199 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
200 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
201 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
202 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
203 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
204 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
205 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
206 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
207 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
208 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
209 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
210 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
211 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
212 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
213 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
214 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
215 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
216 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
217 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
218 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
219 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
220 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
221 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
222 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
223 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
224 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
225 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
226 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
227 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
228 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
229 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
230 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
231 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
232 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
233 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
234 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
235 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
236 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
237 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
238 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
239 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
240 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
241 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
242 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
243 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
244 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
245 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
246 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
247 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
248 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
249 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
250 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
251 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
252 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
253 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
254 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
255 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
256 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
257 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
258 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
259 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
260 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
261 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
262 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
263 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
264 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
265 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
266 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
267 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
268 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
269 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
270 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
271 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
272 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
273 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
274 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
275 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
276 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
277 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
278 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
279 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
280 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
281 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
282 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
289 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
290 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
292 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
294 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
295 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
296 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
316 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
317 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
320 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
322 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
323 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
324 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
325 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
326 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
327 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
328 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
329 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
330 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
331 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
332 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
333 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
334 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
335 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
336 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
337 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
338 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
339 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
340 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
341 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
342 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
343 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
344 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
345 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
346 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
347 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
348 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
349 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
350 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
351 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
352 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
353 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
354 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
355 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
356 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
357 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
358 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
359 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
360 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
361 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
362 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
363 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
364 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
365 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
366 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
367 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
368 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
369 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
370 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
371 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
372 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
373 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
374 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
375 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
376 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
377 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
378 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
379 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
380 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
381 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
382 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
383 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
384 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
385 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
386 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
387 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
388 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
389 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
392 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
393 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
394 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
395 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
396 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
397 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
398 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
399 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
400 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
401 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
402 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
403 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
404 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
405 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
406 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
407 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
408 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
409 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
410 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
411 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
412 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
413 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
414 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
415 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
416 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
417 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
418 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
419 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
420 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
421 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
422 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
423 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
424 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
425 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
426 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
427 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
428 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
429 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
430 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
431 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
432 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
433 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
434 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
435 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
436 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
437 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
438 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
439 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
440 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
441 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
442 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
443 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
444 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
445 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
446 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
447 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
448 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
449 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
450 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
451 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
452 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
453 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
454 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
455 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
456 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
457 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
458 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
459 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
460 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
461 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
462 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
463 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
464 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
465 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
466 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
467 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
468 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
469 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
472 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
473 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
474 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
475 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
476 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
477 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
478 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
479 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
480 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
481 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
482 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
483 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
484 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
485 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
486 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
487 8052494512 Pseudomonas putida LD6 Isolate Unclassified
488 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
489 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
490 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
491 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
492 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
493 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
494 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
495 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
496 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
497 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
498 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
499 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
500 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
501 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
502 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
503 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
504 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
505 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
506 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
507 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.69
Metatranscriptomes 0
Isolates 22.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.37
Nodule 2.2
Rhizoplane 5.85
Rhizosphere 72.11
Stem 0
Stem Tuber 0
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6919 2124908027 Bacteria 4672
2 MRS2a_Contig_772 2124908027 Bacteria 25215
3 MRS2a_Contig_826 2124908027 Bacteria 14575
4 JGI24741J21665_1002879 3300001915 Bacteria 4318
5 JGI25162J39368_1000455 3300002737 Bacteria 32067
6 JGI25162J39368_1000473 3300002737 Bacteria 30930
7 JGI25163J39215_1000583 3300002771 Bacteria 10247
8 JGI25163J39215_1000741 3300002771 Bacteria 8295
9 JGI25164J39214_1000311 3300002772 Bacteria 32067
10 JGI25164J39214_1000323 3300002772 Bacteria 30930
11 JGI25165J46597_1000581 3300003214 Bacteria 32067
12 JGI25165J46597_1000599 3300003214 Bacteria 30930
13 Ga0055538_1000012 3300003751 Bacteria 353826
14 Ga0055538_1000212 3300003751 Bacteria 33996
15 Ga0055539_1000017 3300003752 Bacteria 353873
16 Ga0055539_1000256 3300003752 Bacteria 33996
17 Ga0055533_1000021 3300003756 Bacteria 353826
18 Ga0055533_1000245 3300003756 Bacteria 33996
19 Ga0055532_1000119 3300003758 Bacteria 83382
20 Ga0055532_1000268 3300003758 Bacteria 33996
21 Ga0055525_1000255 3300003759 Bacteria 51028
22 Ga0055525_1000343 3300003759 Bacteria 33996
23 Ga0055535_1004418 3300003761 Bacteria 3426
24 Ga0055536_1000005 3300003781 Bacteria 383598
25 Ga0055536_1000081 3300003781 Bacteria 81966
26 Ga0055536_1002554 3300003781 Bacteria 10174
27 Ga0055536_1002668 3300003781 Bacteria 9898
28 Ga0055530_10000001 3300003791 Bacteria 383067
29 Ga0055530_10001391 3300003791 Bacteria 17874
30 Ga0055530_10002969 3300003791 Bacteria 10205
31 Ga0055540_1000304 3300003792 Bacteria 43625
32 Ga0055540_1000389 3300003792 Bacteria 36345
33 Ga0055540_1001018 3300003792 Bacteria 17979
34 Ga0055531_10001049 3300003794 Bacteria 21794
35 Ga0055541_1000012 3300003841 Bacteria 353826
36 Ga0055541_1000154 3300003841 Bacteria 33830
37 Ga0058692_1011167 3300003856 Bacteria 2186
38 Ga0065714_10002290 3300005288 Bacteria 27568
39 Ga0065714_10004145 3300005288 Bacteria 7565
40 Ga0065714_10005015 3300005288 Bacteria 4234
41 Ga0065714_10007402 3300005288 Bacteria 3531
42 Ga0065714_10010936 3300005288 Bacteria 2370
43 Ga0065714_10065119 3300005288 Bacteria 12772
44 Ga0065714_10065643 3300005288 Bacteria 9058
45 Ga0065704_10002475 3300005289 Bacteria 5156
46 Ga0065712_10002648 3300005290 Bacteria 7834
47 Ga0070670_100003464 3300005331 Bacteria 13103
48 Ga0070661_100000399 3300005344 Bacteria 33668
49 Ga0070661_100002246 3300005344 Bacteria 13253
50 Ga0070669_100000443 3300005353 Bacteria 31632
51 Ga0070669_100000444 3300005353 Bacteria 31573
52 Ga0070662_100000528 3300005457 Bacteria 23086
53 Ga0070662_100018119 3300005457 Bacteria 4759
54 Ga0068853_100000031 3300005539 Bacteria 116269
55 Ga0070665_100025573 3300005548 Bacteria 5947
56 Ga0070665_100107316 3300005548 Bacteria 2794
57 Ga0070664_100000824 3300005564 Bacteria 23877
58 Ga0070664_100003217 3300005564 Bacteria 13205
59 Ga0070664_100007402 3300005564 Bacteria 8858
60 Ga0068857_100087463 3300005577 Bacteria 2787
61 Ga0068854_100012873 3300005578 Bacteria 5479
62 Ga0068851_10000007 3300005834 Bacteria 244101
63 Ga0075364_10064263 3300006051 Bacteria 2409
64 Ga0075432_10000334 3300006058 Bacteria 13403
65 Ga0075432_10000773 3300006058 Bacteria 9957
66 Ga0099823_1038992 3300006944 Bacteria 3513
67 Ga0079104_1000344 3300006946 Bacteria 55781
68 Ga0099826_10012111 3300006948 Bacteria 6496
69 Ga0105251_10000004 3300009011 Bacteria 285212
70 Ga0105251_10002300 3300009011 Bacteria 15141
71 Ga0105251_10002854 3300009011 Bacteria 13052
72 Ga0105251_10003012 3300009011 Bacteria 12567
73 Ga0105251_10005159 3300009011 Bacteria 8630
74 Ga0105251_10015775 3300009011 Bacteria 4113
75 Ga0105251_10026579 3300009011 Bacteria 2946
76 Ga0105251_10071381 3300009011 Bacteria 1615
77 Ga0105244_10000139 3300009036 Bacteria 75461
78 Ga0105244_10001537 3300009036 Bacteria 18357
79 Ga0105244_10002214 3300009036 Bacteria 14817
80 Ga0105244_10002930 3300009036 Bacteria 12593
81 Ga0105244_10005154 3300009036 Bacteria 8757
82 Ga0105244_10005226 3300009036 Bacteria 8675
83 Ga0105244_10007074 3300009036 Bacteria 7177
84 Ga0105244_10007197 3300009036 Bacteria 7098
85 Ga0105244_10009163 3300009036 Bacteria 6109
86 Ga0105244_10009709 3300009036 Bacteria 5886
87 Ga0105244_10016239 3300009036 Bacteria 4246
88 Ga0105244_10020823 3300009036 Bacteria 3635
89 Ga0105244_10034824 3300009036 Bacteria 2649
90 Ga0105244_10068333 3300009036 Bacteria 1776
91 Ga0105244_10068334 3300009036 Bacteria 1776
92 Ga0105244_10100062 3300009036 Bacteria 1419
93 Ga0105250_10000313 3300009092 Bacteria 37875
94 Ga0105250_10000370 3300009092 Bacteria 33590
95 Ga0105250_10002236 3300009092 Bacteria 9850
96 Ga0105250_10002436 3300009092 Bacteria 9345
97 Ga0105250_10004570 3300009092 Bacteria 6343
98 Ga0105250_10016083 3300009092 Bacteria 3053
99 Ga0105250_10036448 3300009092 Bacteria 1974
100 Ga0105243_10001692 3300009148 Bacteria 18995
101 Ga0105243_10001894 3300009148 Bacteria 17846
102 Ga0105243_10003559 3300009148 Bacteria 12574
103 Ga0105243_10008247 3300009148 Bacteria 8001
104 Ga0105243_10013524 3300009148 Bacteria 6173
105 Ga0105243_10020818 3300009148 Bacteria 4977
106 Ga0105243_10023362 3300009148 Bacteria 4708
107 Ga0105243_10039101 3300009148 Bacteria 3697
108 Ga0105243_10051457 3300009148 Bacteria 3258
109 Ga0105242_10015806 3300009176 Bacteria 5863
110 Ga0105242_10078425 3300009176 Bacteria 2757
111 Ga0105248_10020149 3300009177 Bacteria 7389
112 Ga0105237_10001264 3300009545 Bacteria 33746
113 Ga0105237_10004302 3300009545 Bacteria 16509
114 Ga0105237_10030481 3300009545 Bacteria 5477
115 Ga0105249_10049268 3300009553 Bacteria 3841
116 Ga0105246_10000963 3300011119 Bacteria 16470
117 Ga0105246_10015157 3300011119 Bacteria 4862
118 Ga0157345_1000140 3300012498 Bacteria 13082
119 Ga0157373_10004749 3300013100 Bacteria 10224
120 Ga0157373_10005232 3300013100 Bacteria 9738
121 Ga0157373_10006394 3300013100 Bacteria 8799
122 Ga0157373_10006630 3300013100 Bacteria 8627
123 Ga0157373_10007273 3300013100 Bacteria 8252
124 Ga0157373_10036934 3300013100 Bacteria 3505
125 Ga0157373_10044236 3300013100 Bacteria 3179
126 Ga0157373_10053420 3300013100 Bacteria 2873
127 Ga0157373_10074655 3300013100 Bacteria 2392
128 Ga0157371_10000109 3300013102 Bacteria 124990
129 Ga0157371_10002295 3300013102 Bacteria 18434
130 Ga0157371_10002723 3300013102 Bacteria 16648
131 Ga0157370_10000265 3300013104 Bacteria 66558
132 Ga0157370_10026465 3300013104 Bacteria 5728
133 Ga0157370_10145356 3300013104 Bacteria 2208
134 Ga0157370_10189007 3300013104 Bacteria 1912
135 Ga0157370_10201840 3300013104 Bacteria 1844
136 Ga0157370_10243054 3300013104 Bacteria 1665
137 Ga0157369_10003641 3300013105 Bacteria 18277
138 Ga0157369_10009951 3300013105 Bacteria 10864
139 Ga0157369_10011326 3300013105 Bacteria 10130
140 Ga0157369_10011887 3300013105 Bacteria 9889
141 Ga0157369_10012591 3300013105 Bacteria 9596
142 Ga0157369_10022760 3300013105 Bacteria 6987
143 Ga0157369_10055281 3300013105 Bacteria 4285
144 Ga0163162_10002676 3300013306 Bacteria 16896
145 Ga0163162_10056436 3300013306 Bacteria 3955
146 Ga0157372_10001716 3300013307 Bacteria 23777
147 Ga0157372_10003275 3300013307 Bacteria 17501
148 Ga0157375_10000140 3300013308 Bacteria 72172
149 Ga0157375_10006355 3300013308 Bacteria 10296
150 Ga0157375_10009063 3300013308 Bacteria 8713
151 Ga0157375_10009164 3300013308 Bacteria 8674
152 Ga0157375_10083666 3300013308 Bacteria 3236
153 Ga0157375_10139730 3300013308 Bacteria 2548
154 Ga0182008_10000177 3300014497 Bacteria 49865
155 Ga0182008_10000348 3300014497 Bacteria 35954
156 Ga0182008_10001204 3300014497 Bacteria 17819
157 Ga0182008_10001374 3300014497 Bacteria 16472
158 Ga0182008_10003993 3300014497 Bacteria 8730
159 Ga0182008_10004861 3300014497 Bacteria 7764
160 Ga0182008_10015053 3300014497 Bacteria 4044
161 Ga0182008_10017595 3300014497 Bacteria 3707
162 Ga0182008_10023001 3300014497 Bacteria 3188
163 Ga0182008_10040561 3300014497 Bacteria 2324
164 Ga0182008_10049542 3300014497 Bacteria 2085
165 Ga0182006_1001181 3300015261 Bacteria 16406
166 Ga0182006_1001182 3300015261 Bacteria 16351
167 Ga0182006_1002537 3300015261 Bacteria 9923
168 Ga0182006_1006107 3300015261 Bacteria 5632
169 Ga0182007_10000904 3300015262 Bacteria 16414
170 Ga0182007_10003313 3300015262 Bacteria 7631
171 Ga0182007_10018153 3300015262 Bacteria 2554
172 Ga0182005_1000664 3300015265 Bacteria 16296
173 Ga0182005_1006644 3300015265 Bacteria 3515
174 Ga0182005_1018694 3300015265 Bacteria 1915
175 Ga0163161_10005440 3300017792 Bacteria 8843
176 Ga0163161_10006189 3300017792 Bacteria 8291
177 Ga0163161_10006403 3300017792 Bacteria 8153
178 Ga0163161_10057087 3300017792 Bacteria 2836
179 Ga0209435_100498 3300025206 Bacteria 7728
180 Ga0209760_100027 3300025207 Bacteria 153290
181 Ga0209760_100119 3300025207 Bacteria 54278
182 Ga0209784_100007 3300025224 Bacteria 747715
183 Ga0209784_100065 3300025224 Bacteria 155963
184 Ga0209566_100009 3300025225 Bacteria 554018
185 Ga0209566_100081 3300025225 Bacteria 155963
186 Ga0209674_100021 3300025226 Bacteria 629811
187 Ga0209674_100101 3300025226 Bacteria 155963
188 Ga0209147_100009 3300025229 Bacteria 747409
189 Ga0209147_100152 3300025229 Bacteria 100822
190 Ga0209563_100018 3300025230 Bacteria 747850
191 Ga0209563_100098 3300025230 Bacteria 155963
192 Ga0207427_100005 3300025231 Bacteria 797999
193 Ga0207427_100006 3300025231 Bacteria 785415
194 Ga0209437_100013 3300025233 Bacteria 785457
195 Ga0209437_100018 3300025233 Bacteria 694400
196 Ga0209258_100249 3300025242 Bacteria 98135
197 Ga0209258_100583 3300025242 Bacteria 30568
198 Ga0209646_1000298 3300025246 Bacteria 41044
199 Ga0209677_100012 3300025253 Bacteria 554018
200 Ga0209677_100059 3300025253 Bacteria 155963
201 Ga0209759_1006542 3300025256 Bacteria 3896
202 Ga0209759_1009310 3300025256 Bacteria 2977
203 Ga0209233_1000021 3300025261 Bacteria 798078
204 Ga0209233_1000022 3300025261 Bacteria 785415
205 Ga0209675_1010605 3300025291 Bacteria 3131
206 Ga0209676_1000003 3300025292 Bacteria 1454178
207 Ga0209676_1000015 3300025292 Bacteria 784458
208 Ga0209676_1000030 3300025292 Bacteria 506421
209 Ga0209676_1000041 3300025292 Bacteria 424583
210 Ga0209676_1003143 3300025292 Bacteria 10549
211 Ga0209676_1004777 3300025292 Bacteria 7378
212 Ga0209050_1000004 3300025298 Bacteria 1600040
213 Ga0209050_1000024 3300025298 Bacteria 533389
214 Ga0209050_1000030 3300025298 Bacteria 463381
215 Ga0209050_1000332 3300025298 Bacteria 94224
216 Ga0209051_1000006 3300025303 Bacteria 1015785
217 Ga0209051_1000012 3300025303 Bacteria 595474
218 Ga0209051_1000660 3300025303 Bacteria 38923
219 Ga0209051_1000672 3300025303 Bacteria 38341
220 Ga0209051_1009208 3300025303 Bacteria 5113
221 Ga0209257_1000262 3300025304 Bacteria 121021
222 Ga0207656_10000015 3300025321 Bacteria 125447
223 Ga0207656_10000401 3300025321 Bacteria 14549
224 Ga0207696_1000016 3300025711 Bacteria 502467
225 Ga0207696_1000031 3300025711 Bacteria 384169
226 Ga0207696_1000041 3300025711 Bacteria 311695
227 Ga0207696_1000044 3300025711 Bacteria 300953
228 Ga0207696_1000050 3300025711 Bacteria 276983
229 Ga0207696_1000080 3300025711 Bacteria 199217
230 Ga0207696_1000982 3300025711 Bacteria 17247
231 Ga0207696_1001880 3300025711 Bacteria 10746
232 Ga0207696_1001924 3300025711 Bacteria 10560
233 Ga0207696_1002163 3300025711 Bacteria 9857
234 Ga0207696_1002804 3300025711 Bacteria 8273
235 Ga0207696_1006618 3300025711 Bacteria 4645
236 Ga0207696_1007233 3300025711 Bacteria 4366
237 Ga0207655_1000033 3300025728 Bacteria 377066
238 Ga0207655_1000137 3300025728 Bacteria 140084
239 Ga0207655_1000401 3300025728 Bacteria 60151
240 Ga0207655_1000597 3300025728 Bacteria 44104
241 Ga0207655_1000785 3300025728 Bacteria 34742
242 Ga0207655_1001006 3300025728 Bacteria 28697
243 Ga0207655_1001169 3300025728 Bacteria 25503
244 Ga0207655_1002265 3300025728 Bacteria 15868
245 Ga0207655_1003606 3300025728 Bacteria 11447
246 Ga0207655_1003871 3300025728 Bacteria 10892
247 Ga0207655_1006458 3300025728 Bacteria 7764
248 Ga0207655_1007506 3300025728 Bacteria 7064
249 Ga0207655_1016789 3300025728 Bacteria 3983
250 Ga0207655_1019393 3300025728 Bacteria 3557
251 Ga0207655_1023693 3300025728 Bacteria 3035
252 Ga0207655_1028142 3300025728 Bacteria 2657
253 Ga0207655_1033171 3300025728 Bacteria 2345
254 Ga0207655_1044111 3300025728 Bacteria 1877
255 Ga0207713_1000013 3300025735 Bacteria 475751
256 Ga0207713_1000249 3300025735 Bacteria 68771
257 Ga0207713_1000784 3300025735 Bacteria 29393
258 Ga0207713_1001349 3300025735 Bacteria 20007
259 Ga0207713_1001718 3300025735 Bacteria 16895
260 Ga0207713_1002502 3300025735 Bacteria 13326
261 Ga0207713_1002588 3300025735 Bacteria 13059
262 Ga0207713_1003204 3300025735 Bacteria 11298
263 Ga0207713_1005239 3300025735 Bacteria 8171
264 Ga0207713_1006121 3300025735 Bacteria 7397
265 Ga0207713_1006749 3300025735 Bacteria 6930
266 Ga0207713_1008038 3300025735 Bacteria 6130
267 Ga0207713_1014938 3300025735 Bacteria 4006
268 Ga0207713_1016771 3300025735 Bacteria 3706
269 Ga0207713_1019864 3300025735 Bacteria 3273
270 Ga0207713_1044720 3300025735 Bacteria 1815
271 Ga0207671_10000027 3300025914 Bacteria 264907
272 Ga0207671_10000394 3300025914 Bacteria 61087
273 Ga0207649_10000012 3300025920 Bacteria 265674
274 Ga0207649_10000251 3300025920 Bacteria 43152
275 Ga0207681_10000138 3300025923 Bacteria 60354
276 Ga0207681_10000919 3300025923 Bacteria 19216
277 Ga0207650_10000282 3300025925 Bacteria 52392
278 Ga0207650_10000639 3300025925 Bacteria 27847
279 Ga0207650_10000642 3300025925 Bacteria 27786
280 Ga0207706_10000312 3300025933 Bacteria 52431
281 Ga0207706_10003763 3300025933 Bacteria 14474
282 Ga0207706_10005467 3300025933 Bacteria 11844
283 Ga0207686_10000976 3300025934 Bacteria 17010
284 Ga0207709_10000061 3300025935 Bacteria 199097
285 Ga0207709_10000558 3300025935 Bacteria 31766
286 Ga0207709_10001853 3300025935 Bacteria 14085
287 Ga0207709_10006575 3300025935 Bacteria 6527
288 Ga0207709_10006679 3300025935 Bacteria 6467
289 Ga0207709_10016447 3300025935 Bacteria 4113
290 Ga0207679_10000015 3300025945 Bacteria 265674
291 Ga0207679_10000016 3300025945 Bacteria 253494
292 Ga0207712_10030674 3300025961 Bacteria 3616
293 Ga0207640_10195393 3300025981 Bacteria 1528
294 Ga0207639_10000146 3300026041 Bacteria 53109
295 Ga0209281_1000016 3300027111 Bacteria 588107
296 Ga0209281_1000019 3300027111 Bacteria 576164
297 Ga0209281_1003168 3300027111 Bacteria 5683
298 Ga0209389_1000213 3300027296 Bacteria 40739
299 Ga0209389_1011140 3300027296 Bacteria 8143
300 Ga0209371_1000228 3300027312 Bacteria 72315
301 Ga0209371_1000311 3300027312 Bacteria 54076
302 Ga0209983_1000420 3300027665 Bacteria 9150
303 Ga0207428_10020685 3300027907 Bacteria 5583
304 Ga0207428_10020703 3300027907 Bacteria 5581
305 Ga0207428_10069133 3300027907 Bacteria 2777
306 Ga0207428_10073243 3300027907 Bacteria 2688
307 Ga0268266_10013641 3300028379 Bacteria 6998
308 Ga0268266_10102622 3300028379 Bacteria 2523
309 Ga0268266_10193164 3300028379 Bacteria 1859
310 Ga0268256_1000188 3300030500 Bacteria 72315
311 Ga0268256_1000268 3300030500 Bacteria 54076
312 Ga0307511_10050707 3300030521 Bacteria 3338
313 Ga0316179_1114947 3300030734 Bacteria 2829
314 Ga0316178_1116522 3300030735 Bacteria 17358
315 Ga0316183_1208517 3300030742 Bacteria 4181
316 Ga0316181_1047742 3300030744 Bacteria 7643
317 Ga0307509_10059125 3300031507 Bacteria 4056
318 Ga0307408_100000002 3300031548 Bacteria 827227
319 Ga0307408_100001670 3300031548 Bacteria 16338
320 Ga0307408_100002042 3300031548 Bacteria 14535
321 Ga0307408_100002990 3300031548 Bacteria 11699
322 Ga0307408_100021267 3300031548 Bacteria 4389
323 Ga0307408_100041439 3300031548 Bacteria 3264
324 Ga0307516_10060509 3300031730 Bacteria 3679
325 Ga0307405_10000558 3300031731 Bacteria 14172
326 Ga0307405_10001502 3300031731 Bacteria 9874
327 Ga0307405_10001741 3300031731 Bacteria 9292
328 Ga0307405_10006005 3300031731 Bacteria 5932
329 Ga0307405_10014768 3300031731 Bacteria 4209
330 Ga0307406_10084995 3300031901 Bacteria 2114
331 Ga0307407_10003064 3300031903 Bacteria 6741
332 Ga0307412_10001108 3300031911 Bacteria 15436
333 Ga0307412_10010757 3300031911 Bacteria 5278
334 Ga0307412_10013568 3300031911 Bacteria 4781
335 Ga0307412_10024458 3300031911 Bacteria 3728
336 Ga0307412_10046517 3300031911 Bacteria 2843
337 Ga0307409_100011629 3300031995 Bacteria 5562
338 Ga0307416_100010057 3300032002 Bacteria 6230
339 Ga0307416_100043412 3300032002 Bacteria 3520
340 Ga0307414_10018757 3300032004 Bacteria 4268
341 Ga0307414_10029138 3300032004 Bacteria 3589
342 Ga0307414_10154137 3300032004 Bacteria 1816
343 Ga0307411_10007715 3300032005 Bacteria 5511
344 Ga0307411_10136977 3300032005 Bacteria 1799
345 Ga0307510_10011676 3300033180 Bacteria 10430
346 Ga0439436_0000209 3300041404 Bacteria 14107
347 Ga0439438_000268 3300041405 Bacteria 23335
348 Ga0439438_001540 3300041405 Bacteria 10164
349 Ga0439438_002122 3300041405 Bacteria 8553
350 Ga0439438_002508 3300041405 Bacteria 7796
351 Ga0439438_005241 3300041405 Bacteria 4807
352 Ga0439438_006909 3300041405 Bacteria 3947
353 Ga0439438_008831 3300041405 Bacteria 3305
354 Ga0439438_016183 3300041405 Bacteria 2173
355 Ga0439438_016940 3300041405 Bacteria 2109
356 Ga0439447_000263 3300041407 Bacteria 18510
357 Ga0439447_001667 3300041407 Bacteria 8146
358 Ga0439447_002742 3300041407 Bacteria 6364
359 Ga0439447_004837 3300041407 Bacteria 4569
360 Ga0439447_008410 3300041407 Bacteria 3195
361 Ga0439447_025954 3300041407 Bacteria 1506
362 Ga0439447_025956 3300041407 Bacteria 1505
363 Ga0439466_0000196 3300041411 Bacteria 24028
364 Ga0439466_0001640 3300041411 Bacteria 8765
365 Ga0439466_0001877 3300041411 Bacteria 8227
366 Ga0439466_0002770 3300041411 Bacteria 6861
367 Ga0439466_0007333 3300041411 Bacteria 4177
368 Ga0439466_0008160 3300041411 Bacteria 3947
369 Ga0439466_0010748 3300041411 Bacteria 3398
370 Ga0439465_0007730 3300041413 Bacteria 3411
371 Ga0439432_000414 3300042006 Bacteria 15843
372 Ga0439432_001275 3300042006 Bacteria 9531
373 Ga0439432_002030 3300042006 Bacteria 7659
374 Ga0439432_002901 3300042006 Bacteria 6386
375 Ga0439432_008165 3300042006 Bacteria 3683
376 Ga0439432_009729 3300042006 Bacteria 3344
377 Ga0439432_012525 3300042006 Bacteria 2899
378 Ga0439432_020332 3300042006 Bacteria 2208
379 Ga0439451_000263 3300042009 Bacteria 10176
380 Ga0439451_000396 3300042009 Bacteria 8501
381 Ga0439451_000612 3300042009 Bacteria 6772
382 Ga0439451_003618 3300042009 Bacteria 3128
383 Ga0439451_012527 3300042009 Bacteria 1710
384 Ga0439452_000431 3300042010 Bacteria 24140
385 Ga0439452_000432 3300042010 Bacteria 24103
386 Ga0439452_000778 3300042010 Bacteria 15127
387 Ga0439452_001055 3300042010 Bacteria 12160
388 Ga0439452_001508 3300042010 Bacteria 9422
389 Ga0439452_002404 3300042010 Bacteria 6934
390 Ga0439452_003176 3300042010 Bacteria 5818
391 Ga0439452_007890 3300042010 Bacteria 3228
392 Ga0439452_011136 3300042010 Bacteria 2593
393 Ga0439452_025141 3300042010 Bacteria 1514
394 Ga0439456_000217 3300042013 Bacteria 15800
395 Ga0439456_000230 3300042013 Bacteria 15066
396 Ga0439456_003818 3300042013 Bacteria 3062
397 Ga0439456_004841 3300042013 Bacteria 2728
398 Ga0439456_005410 3300042013 Bacteria 2589
399 Ga0439463_000664 3300042016 Bacteria 9540
400 Ga0439463_000844 3300042016 Bacteria 8413
401 Ga0439463_000897 3300042016 Bacteria 8196
402 Ga0439463_009210 3300042016 Bacteria 2430
403 Ga0450911_000593 3300042115 Bacteria 11010
404 Ga0450911_001546 3300042115 Bacteria 5218
405 Ga0450911_002315 3300042115 Bacteria 3809
406 Ga0450919_000016 3300042121 Bacteria 13849
407 Ga0450920_001883 3300042122 Bacteria 3520
408 Ga0450922_000428 3300042124 Bacteria 4525
409 Ga0450922_000700 3300042124 Bacteria 3473
410 Ga0450922_001832 3300042124 Bacteria 2051
411 Ga0450890_000105 3300042127 Bacteria 13991
412 Ga0450900_004183 3300042136 Bacteria 1647
413 Ga0450902_003347 3300042137 Bacteria 2338
414 Ga0450902_006958 3300042137 Bacteria 1740
415 Ga0450903_003125 3300042138 Bacteria 2885
416 Ga0450903_003253 3300042138 Bacteria 2822
417 Ga0450904_000705 3300042139 Bacteria 5921
418 Ga0450904_001179 3300042139 Bacteria 3954
419 Ga0450905_001141 3300042142 Bacteria 3356
420 Ga0450905_001569 3300042142 Bacteria 2921
421 Ga0450905_005539 3300042142 Bacteria 1697
422 Ga0450906_000291 3300042145 Bacteria 10032
423 Ga0450906_002121 3300042145 Bacteria 4337
424 Ga0450906_002870 3300042145 Bacteria 3749
425 Ga0450907_000099 3300042146 Bacteria 33397
426 Ga0450907_001296 3300042146 Bacteria 5573
427 Ga0450910_000496 3300042147 Bacteria 4666
428 Ga0439446_0000434 3300042156 Bacteria 8177
429 Ga0439446_0001439 3300042156 Bacteria 5420
430 Ga0439446_0004699 3300042156 Bacteria 3470
431 Ga0450908_000465 3300042184 Bacteria 7822
432 Ga0450909_000144 3300042185 Bacteria 7491
433 Ga0439434_0000131 3300042435 Bacteria 19982
434 Ga0439434_0002096 3300042435 Bacteria 5771
435 Ga0439434_0018685 3300042435 Bacteria 2076
436 Ga0439464_0004808 3300042439 Bacteria 3463
437 Ga0439464_0006464 3300042439 Bacteria 3053
438 Ga0439464_0012983 3300042439 Bacteria 2225
439 Ga0439460_0000031 3300042461 Bacteria 19851
440 Ga0450918_002222 3300042531 Bacteria 3690
441 Ga0450893_0001104 3300042532 Bacteria 4064
442 Ga0451577_0008829 3300042876 Bacteria 9758
443 Ga0439440_0000059 3300042993 Bacteria 13716
444 Ga0439440_0006168 3300042993 Bacteria 2403
445 Ga0439440_0016130 3300042993 Bacteria 1630
446 Ga0495617_001186 3300046452 Bacteria 11737
447 Ga0495617_005421 3300046452 Bacteria 4521
448 Ga0495617_007723 3300046452 Bacteria 3719
449 Ga0495617_010220 3300046452 Bacteria 3214
450 Ga0495617_011907 3300046452 Bacteria 2966
451 Ga0495617_017329 3300046452 Bacteria 2433
452 Ga0495617_022294 3300046452 Bacteria 2140
453 Ga0495617_022863 3300046452 Bacteria 2113
454 Ga0495627_001405 3300046453 Bacteria 14244
455 Ga0495627_001548 3300046453 Bacteria 13129
456 Ga0495627_001808 3300046453 Bacteria 11401
457 Ga0495627_009288 3300046453 Bacteria 3626
458 Ga0495627_010278 3300046453 Bacteria 3409
459 Ga0495627_012352 3300046453 Bacteria 3034
460 Ga0495627_013440 3300046453 Bacteria 2879
461 Ga0495627_042420 3300046453 Bacteria 1394
462 Ga0495603_0002844 3300046455 Bacteria 10222
463 Ga0495603_0027341 3300046455 Bacteria 3443
464 Ga0495603_0108129 3300046455 Bacteria 1623
465 Ga0495590_0002297 3300046457 Bacteria 7967
466 Ga0495590_0011391 3300046457 Bacteria 3326
467 Ga0495590_0011875 3300046457 Bacteria 3245
468 Ga0495591_000164 3300046458 Bacteria 70760
469 Ga0495591_002064 3300046458 Bacteria 11613
470 Ga0495591_002326 3300046458 Bacteria 10724
471 Ga0495591_002516 3300046458 Bacteria 10126
472 Ga0495591_003610 3300046458 Bacteria 7883
473 Ga0495591_006629 3300046458 Bacteria 5072
474 Ga0495591_007796 3300046458 Bacteria 4479
475 Ga0495591_010026 3300046458 Bacteria 3711
476 Ga0495591_011064 3300046458 Bacteria 3441
477 Ga0495591_011872 3300046458 Bacteria 3273
478 Ga0495591_012542 3300046458 Bacteria 3151
479 Ga0495591_014173 3300046458 Bacteria 2880
480 Ga0495591_014543 3300046458 Bacteria 2824
481 Ga0495591_015205 3300046458 Bacteria 2728
482 Ga0495591_017502 3300046458 Bacteria 2459
483 Ga0495591_020452 3300046458 Bacteria 2186
484 Ga0495591_024684 3300046458 Bacteria 1901
485 Ga0495629_0022308 3300046459 Bacteria 4514
486 Ga0495638_0004365 3300046460 Bacteria 10712
487 Ga0495638_0016310 3300046460 Bacteria 4978
488 Ga0495638_0027054 3300046460 Bacteria 3714
489 Ga0495638_0031662 3300046460 Bacteria 3397
490 Ga0495638_0031947 3300046460 Bacteria 3380
491 Ga0495638_0033473 3300046460 Bacteria 3287
492 Ga0495638_0037741 3300046460 Bacteria 3072
493 Ga0495638_0058866 3300046460 Bacteria 2380
494 Ga0495638_0064911 3300046460 Bacteria 2248
495 Ga0495653_0002141 3300046463 Bacteria 15581
496 Ga0495653_0058239 3300046463 Bacteria 2937
497 Ga0495653_0067680 3300046463 Bacteria 2680
498 Ga0495653_0090950 3300046463 Bacteria 2231
499 Ga0495650_0001236 3300046471 Bacteria 26554
500 Ga0495650_0005323 3300046471 Bacteria 8402
501 Ga0495650_0012694 3300046471 Bacteria 4513
502 Ga0495650_0013273 3300046471 Bacteria 4368
503 Ga0495650_0017550 3300046471 Bacteria 3586
504 Ga0495650_0019168 3300046471 Bacteria 3378
505 Ga0495650_0019487 3300046471 Bacteria 3336
506 Ga0495650_0021364 3300046471 Bacteria 3130
507 Ga0495650_0021672 3300046471 Bacteria 3096
508 Ga0495582_0004303 3300046473 Bacteria 8004
509 Ga0495605_0000100 3300046474 Bacteria 109002
510 Ga0495605_0000319 3300046474 Bacteria 50232
511 Ga0495605_0002634 3300046474 Bacteria 11010
512 Ga0495605_0003081 3300046474 Bacteria 10059
513 Ga0495605_0028498 3300046474 Bacteria 2882
514 Ga0495605_0029337 3300046474 Bacteria 2832
515 Ga0495605_0050481 3300046474 Bacteria 2029
516 Ga0495605_0056382 3300046474 Bacteria 1895
517 Ga0495639_0019840 3300046475 Bacteria 2934
518 Ga0495584_0001139 3300046491 Bacteria 16451
519 Ga0495584_0003222 3300046491 Bacteria 9061
520 Ga0495584_0008518 3300046491 Bacteria 5309
521 Ga0495584_0009681 3300046491 Bacteria 4959
522 Ga0495584_0010909 3300046491 Bacteria 4664
523 Ga0495584_0013853 3300046491 Bacteria 4109
524 Ga0495584_0019261 3300046491 Bacteria 3466
525 Ga0495584_0051129 3300046491 Bacteria 2081
526 Ga0495584_0070800 3300046491 Bacteria 1752
527 Ga0495585_0002264 3300046492 Bacteria 13916
528 Ga0495585_0004605 3300046492 Bacteria 8909
529 Ga0495585_0006230 3300046492 Bacteria 7432
530 Ga0495585_0016595 3300046492 Bacteria 4266
531 Ga0495585_0019809 3300046492 Bacteria 3874
532 Ga0495585_0023036 3300046492 Bacteria 3573
533 Ga0495585_0026429 3300046492 Bacteria 3314
534 Ga0495585_0028422 3300046492 Bacteria 3189
535 Ga0495585_0032470 3300046492 Bacteria 2957
536 Ga0495594_0006978 3300046499 Bacteria 5804
537 Ga0495594_0040814 3300046499 Bacteria 2541
538 Ga0495594_0045888 3300046499 Bacteria 2399
539 Ga0495594_0062171 3300046499 Bacteria 2067
540 Ga0495596_0000889 3300046500 Bacteria 18026
541 Ga0495596_0016905 3300046500 Bacteria 3026
542 Ga0495596_0042177 3300046500 Bacteria 1798
543 Ga0495607_0000268 3300046501 Bacteria 55932
544 Ga0495607_0000762 3300046501 Bacteria 30848
545 Ga0495607_0001310 3300046501 Bacteria 22178
546 Ga0495607_0001456 3300046501 Bacteria 21080
547 Ga0495607_0003886 3300046501 Bacteria 11253
548 Ga0495607_0006315 3300046501 Bacteria 8354
549 Ga0495607_0011385 3300046501 Bacteria 5923
550 Ga0495607_0018596 3300046501 Bacteria 4427
551 Ga0495607_0024734 3300046501 Bacteria 3740
552 Ga0495607_0026926 3300046501 Bacteria 3562
553 Ga0495607_0031738 3300046501 Bacteria 3231
554 Ga0495607_0039433 3300046501 Bacteria 2820
555 Ga0495607_0039668 3300046501 Bacteria 2811
556 Ga0495607_0074332 3300046501 Bacteria 1886
557 Ga0495607_0074348 3300046501 Bacteria 1886
558 Ga0495607_0090468 3300046501 Bacteria 1659
559 Ga0495583_0000174 3300046506 Bacteria 109079
560 Ga0495583_0000896 3300046506 Bacteria 35612
561 Ga0495583_0001759 3300046506 Bacteria 20656
562 Ga0495583_0003267 3300046506 Bacteria 12603
563 Ga0495583_0005506 3300046506 Bacteria 8576
564 Ga0495583_0006241 3300046506 Bacteria 7844
565 Ga0495583_0012834 3300046506 Bacteria 4713
566 Ga0495583_0015243 3300046506 Bacteria 4189
567 Ga0495583_0020637 3300046506 Bacteria 3407
568 Ga0495606_0002158 3300046507 Bacteria 23683
569 Ga0495606_0004529 3300046507 Bacteria 13818
570 Ga0495606_0007338 3300046507 Bacteria 9908
571 Ga0495606_0007398 3300046507 Bacteria 9848
572 Ga0495606_0020957 3300046507 Bacteria 4799
573 Ga0495606_0026838 3300046507 Bacteria 4095
574 Ga0495606_0032452 3300046507 Bacteria 3616
575 Ga0495606_0034040 3300046507 Bacteria 3503
576 Ga0495606_0034279 3300046507 Bacteria 3486
577 Ga0495606_0057796 3300046507 Bacteria 2496
578 Ga0495606_0069402 3300046507 Bacteria 2225
579 Ga0495606_0087144 3300046507 Bacteria 1928
580 Ga0495606_0100509 3300046507 Bacteria 1761
581 Ga0495610_0003363 3300046512 Bacteria 12538
582 Ga0495610_0004453 3300046512 Bacteria 10352
583 Ga0495610_0005824 3300046512 Bacteria 8663
584 Ga0495610_0006220 3300046512 Bacteria 8280
585 Ga0495610_0006307 3300046512 Bacteria 8206
586 Ga0495610_0007028 3300046512 Bacteria 7607
587 Ga0495610_0013259 3300046512 Bacteria 4904
588 Ga0495610_0013475 3300046512 Bacteria 4857
589 Ga0495610_0016703 3300046512 Bacteria 4214
590 Ga0495610_0019927 3300046512 Bacteria 3738
591 Ga0495610_0021621 3300046512 Bacteria 3532
592 Ga0495610_0022553 3300046512 Bacteria 3441
593 Ga0495610_0030625 3300046512 Bacteria 2816
594 Ga0495610_0042269 3300046512 Bacteria 2281
595 Ga0495616_0001510 3300046513 Bacteria 16069
596 Ga0495616_0005455 3300046513 Bacteria 7822
597 Ga0495616_0006028 3300046513 Bacteria 7386
598 Ga0495616_0015002 3300046513 Bacteria 4316
599 Ga0495616_0022640 3300046513 Bacteria 3391
600 Ga0495616_0022940 3300046513 Bacteria 3363
601 Ga0495616_0024427 3300046513 Bacteria 3242
602 Ga0495616_0036103 3300046513 Bacteria 2552
603 Ga0495616_0039730 3300046513 Bacteria 2407
604 Ga0495620_0000018 3300046515 Bacteria 150595
605 Ga0495620_0000032 3300046515 Bacteria 119164
606 Ga0495620_0000085 3300046515 Bacteria 77879
607 Ga0495620_0000602 3300046515 Bacteria 22486
608 Ga0495620_0000779 3300046515 Bacteria 19566
609 Ga0495620_0002764 3300046515 Bacteria 10104
610 Ga0495620_0003670 3300046515 Bacteria 8764
611 Ga0495620_0005805 3300046515 Bacteria 6852
612 Ga0495620_0005943 3300046515 Bacteria 6762
613 Ga0495620_0013612 3300046515 Bacteria 4160
614 Ga0495620_0020288 3300046515 Bacteria 3248
615 Ga0495620_0023778 3300046515 Bacteria 2923
616 Ga0495620_0027696 3300046515 Bacteria 2648
617 Ga0495620_0029897 3300046515 Bacteria 2515
618 Ga0495631_0002297 3300046518 Bacteria 10911
619 Ga0495631_0002951 3300046518 Bacteria 9418
620 Ga0495631_0003356 3300046518 Bacteria 8785
621 Ga0495631_0005177 3300046518 Bacteria 6869
622 Ga0495631_0009209 3300046518 Bacteria 4944
623 Ga0495631_0012698 3300046518 Bacteria 4106
624 Ga0495631_0047547 3300046518 Bacteria 1883
625 Ga0495632_0000122 3300046519 Bacteria 78827
626 Ga0495632_0000902 3300046519 Bacteria 26015
627 Ga0495632_0001812 3300046519 Bacteria 17207
628 Ga0495632_0003822 3300046519 Bacteria 10473
629 Ga0495632_0003845 3300046519 Bacteria 10446
630 Ga0495632_0004095 3300046519 Bacteria 10054
631 Ga0495632_0004762 3300046519 Bacteria 9140
632 Ga0495632_0005460 3300046519 Bacteria 8401
633 Ga0495632_0008353 3300046519 Bacteria 6366
634 Ga0495632_0010599 3300046519 Bacteria 5442
635 Ga0495632_0012697 3300046519 Bacteria 4843
636 Ga0495632_0014447 3300046519 Bacteria 4466
637 Ga0495632_0028575 3300046519 Bacteria 2909
638 Ga0495632_0029030 3300046519 Bacteria 2883
639 Ga0495632_0030668 3300046519 Bacteria 2788
640 Ga0495632_0053175 3300046519 Bacteria 1989
641 Ga0495632_0059041 3300046519 Bacteria 1867
642 Ga0495632_0062098 3300046519 Bacteria 1811
643 Ga0495632_0063631 3300046519 Bacteria 1785
644 Ga0495637_0000216 3300046520 Bacteria 44389
645 Ga0495637_0000234 3300046520 Bacteria 43108
646 Ga0495637_0002465 3300046520 Bacteria 10224
647 Ga0495637_0004255 3300046520 Bacteria 7436
648 Ga0495637_0005039 3300046520 Bacteria 6789
649 Ga0495637_0006981 3300046520 Bacteria 5626
650 Ga0495637_0007815 3300046520 Bacteria 5279
651 Ga0495637_0010171 3300046520 Bacteria 4559
652 Ga0495637_0011226 3300046520 Bacteria 4310
653 Ga0495637_0011854 3300046520 Bacteria 4177
654 Ga0495637_0012873 3300046520 Bacteria 3989
655 Ga0495637_0021107 3300046520 Bacteria 2988
656 Ga0495637_0023844 3300046520 Bacteria 2772
657 Ga0495637_0024067 3300046520 Bacteria 2756
658 Ga0495637_0025087 3300046520 Bacteria 2690
659 Ga0495637_0026815 3300046520 Bacteria 2582
660 Ga0495637_0026935 3300046520 Bacteria 2575
661 Ga0495643_0000202 3300046522 Bacteria 93066
662 Ga0495643_0000382 3300046522 Bacteria 58639
663 Ga0495643_0000394 3300046522 Bacteria 57413
664 Ga0495643_0000773 3300046522 Bacteria 35740
665 Ga0495643_0001724 3300046522 Bacteria 18933
666 Ga0495643_0007180 3300046522 Bacteria 7223
667 Ga0495643_0008143 3300046522 Bacteria 6671
668 Ga0495643_0020519 3300046522 Bacteria 3808
669 Ga0495643_0026045 3300046522 Bacteria 3305
670 Ga0495643_0027293 3300046522 Bacteria 3211
671 Ga0495643_0034115 3300046522 Bacteria 2809
672 Ga0495643_0034779 3300046522 Bacteria 2777
673 Ga0495643_0037884 3300046522 Bacteria 2642
674 Ga0495643_0059159 3300046522 Bacteria 2037
675 Ga0495643_0061014 3300046522 Bacteria 2000
676 Ga0495643_0088996 3300046522 Bacteria 1595
677 Ga0495644_0000865 3300046523 Bacteria 12523
678 Ga0495644_0000944 3300046523 Bacteria 12026
679 Ga0495644_0002842 3300046523 Bacteria 6862
680 Ga0495644_0008836 3300046523 Bacteria 3873
681 Ga0495644_0009119 3300046523 Bacteria 3821
682 Ga0495648_0000279 3300046524 Bacteria 57851
683 Ga0495648_0000452 3300046524 Bacteria 44450
684 Ga0495648_0001464 3300046524 Bacteria 23091
685 Ga0495648_0003973 3300046524 Bacteria 12794
686 Ga0495648_0004380 3300046524 Bacteria 12079
687 Ga0495648_0004753 3300046524 Bacteria 11496
688 Ga0495648_0004830 3300046524 Bacteria 11376
689 Ga0495648_0005359 3300046524 Bacteria 10677
690 Ga0495648_0007583 3300046524 Bacteria 8665
691 Ga0495648_0009755 3300046524 Bacteria 7394
692 Ga0495648_0020124 3300046524 Bacteria 4668
693 Ga0495648_0021676 3300046524 Bacteria 4445
694 Ga0495648_0027627 3300046524 Bacteria 3795
695 Ga0495648_0027776 3300046524 Bacteria 3781
696 Ga0495648_0036414 3300046524 Bacteria 3175
697 Ga0495648_0044175 3300046524 Bacteria 2784
698 Ga0495648_0050296 3300046524 Bacteria 2547
699 Ga0495648_0051137 3300046524 Bacteria 2519
700 Ga0495648_0057040 3300046524 Bacteria 2345
701 Ga0495648_0057611 3300046524 Bacteria 2328
702 Ga0495648_0061608 3300046524 Bacteria 2227
703 Ga0495648_0096088 3300046524 Bacteria 1647
704 Ga0495648_0102286 3300046524 Bacteria 1578
705 Ga0495666_0037661 3300046526 Bacteria 2352
706 Ga0495642_0000195 3300046528 Bacteria 35717
707 Ga0495642_0001107 3300046528 Bacteria 12454
708 Ga0495642_0001293 3300046528 Bacteria 11290
709 Ga0495654_0000205 3300046530 Bacteria 56831
710 Ga0495654_0002431 3300046530 Bacteria 11995
711 Ga0495654_0003040 3300046530 Bacteria 10444
712 Ga0495654_0003698 3300046530 Bacteria 9290
713 Ga0495654_0006849 3300046530 Bacteria 6430
714 Ga0495654_0008904 3300046530 Bacteria 5516
715 Ga0495654_0009336 3300046530 Bacteria 5377
716 Ga0495654_0009824 3300046530 Bacteria 5228
717 Ga0495654_0014368 3300046530 Bacteria 4213
718 Ga0495654_0015579 3300046530 Bacteria 4034
719 Ga0495654_0015858 3300046530 Bacteria 3994
720 Ga0495654_0017732 3300046530 Bacteria 3737
721 Ga0495654_0019743 3300046530 Bacteria 3521
722 Ga0495654_0021272 3300046530 Bacteria 3376
723 Ga0495654_0021888 3300046530 Bacteria 3324
724 Ga0495654_0023223 3300046530 Bacteria 3213
725 Ga0495654_0023673 3300046530 Bacteria 3178
726 Ga0495654_0025663 3300046530 Bacteria 3034
727 Ga0495654_0030004 3300046530 Bacteria 2769
728 Ga0495654_0036636 3300046530 Bacteria 2464
729 Ga0495654_0040109 3300046530 Bacteria 2335
730 Ga0495654_0040180 3300046530 Bacteria 2332
731 Ga0495654_0047411 3300046530 Bacteria 2112
732 Ga0495654_0049793 3300046530 Bacteria 2050
733 Ga0495654_0063358 3300046530 Bacteria 1770
734 Ga0495586_0014283 3300046535 Bacteria 4219
735 Ga0495587_0064252 3300046536 Bacteria 2144
736 Ga0495609_0000088 3300046538 Bacteria 109269
737 Ga0495609_0000453 3300046538 Bacteria 33476
738 Ga0495609_0003663 3300046538 Bacteria 8711
739 Ga0495609_0003975 3300046538 Bacteria 8264
740 Ga0495609_0012374 3300046538 Bacteria 4047
741 Ga0495609_0014015 3300046538 Bacteria 3775
742 Ga0495609_0040278 3300046538 Bacteria 2102
743 Ga0495597_0000121 3300046542 Bacteria 70801
744 Ga0495597_0003235 3300046542 Bacteria 9679
745 Ga0495597_0003575 3300046542 Bacteria 8967
746 Ga0495597_0024797 3300046542 Bacteria 2765
747 Ga0495597_0033787 3300046542 Bacteria 2313
748 Ga0495597_0038072 3300046542 Bacteria 2157
749 Ga0495597_0038565 3300046542 Bacteria 2140
750 Ga0495597_0060164 3300046542 Bacteria 1657
751 Ga0495597_0071701 3300046542 Bacteria 1491
752 Ga0495645_0092826 3300046543 Bacteria 2155
753 Ga0495622_0003731 3300046557 Bacteria 7126
754 Ga0495622_0005594 3300046557 Bacteria 5828
755 Ga0495622_0015700 3300046557 Bacteria 3521
756 Ga0495633_0000205 3300046558 Bacteria 74797
757 Ga0495633_0015255 3300046558 Bacteria 3990
758 Ga0495656_0015058 3300046615 Bacteria 2911
759 Ga0495668_0004162 3300046616 Bacteria 10439
760 Ga0495668_0005775 3300046616 Bacteria 8273
761 Ga0495668_0015565 3300046616 Bacteria 4437
762 Ga0495668_0020639 3300046616 Bacteria 3787
763 Ga0495668_0038011 3300046616 Bacteria 2691
764 Ga0495668_0042078 3300046616 Bacteria 2543
765 Ga0495668_0054741 3300046616 Bacteria 2204
766 Ga0495634_0001603 3300046642 Bacteria 19794
767 Ga0495634_0099615 3300046642 Bacteria 1879
768 Ga0495611_0000738 3300046648 Bacteria 18454
769 Ga0495611_0001237 3300046648 Bacteria 13142
770 Ga0495611_0001857 3300046648 Bacteria 10061
771 Ga0495611_0018966 3300046648 Bacteria 2953
772 Ga0495611_0057384 3300046648 Bacteria 1764
773 Ga0495625_0000061 3300046660 Bacteria 179140
774 Ga0495625_0006962 3300046660 Bacteria 9973
775 Ga0495625_0009246 3300046660 Bacteria 8269
776 Ga0495625_0010546 3300046660 Bacteria 7633
777 Ga0495625_0032946 3300046660 Bacteria 3836
778 Ga0495625_0039660 3300046660 Bacteria 3437
779 Ga0495625_0060857 3300046660 Bacteria 2674
780 Ga0495625_0076939 3300046660 Bacteria 2332
781 Ga0495635_0005130 3300046663 Bacteria 9113
782 Ga0495635_0022929 3300046663 Bacteria 4351
783 Ga0495659_0000905 3300046664 Bacteria 10532
784 Ga0495659_0002360 3300046664 Bacteria 6095
785 Ga0495659_0017480 3300046664 Bacteria 2377
786 Ga0495661_0000050 3300046665 Bacteria 143435
787 Ga0495661_0000356 3300046665 Bacteria 49895
788 Ga0495661_0001427 3300046665 Bacteria 20043
789 Ga0495661_0002975 3300046665 Bacteria 12790
790 Ga0495661_0004643 3300046665 Bacteria 9881
791 Ga0495661_0005906 3300046665 Bacteria 8652
792 Ga0495661_0019756 3300046665 Bacteria 4410
793 Ga0495661_0027223 3300046665 Bacteria 3672
794 Ga0495661_0032076 3300046665 Bacteria 3324
795 Ga0495661_0034096 3300046665 Bacteria 3205
796 Ga0495661_0047062 3300046665 Bacteria 2628
797 Ga0495661_0114221 3300046665 Bacteria 1500
798 Ga0495588_0007883 3300046674 Bacteria 4864
799 Ga0495588_0035206 3300046674 Bacteria 2536
800 Ga0495657_0065244 3300046675 Bacteria 2395
801 Ga0495623_0030677 3300046679 Bacteria 3458
802 Ga0495623_0061475 3300046679 Bacteria 2355
803 Ga0495646_0037444 3300046680 Bacteria 3000
804 Ga0495646_0044560 3300046680 Bacteria 2712
805 Ga0495669_0018475 3300046684 Bacteria 2998
806 Ga0495669_0024082 3300046684 Bacteria 2652
807 Ga0495613_0073034 3300046689 Bacteria 2500
808 Ga0495624_0024612 3300046690 Bacteria 3959
809 Ga0495670_0000936 3300046691 Bacteria 14128
810 Ga0495670_0009608 3300046691 Bacteria 4751
811 Ga0495670_0019579 3300046691 Bacteria 3333
812 Ga0495670_0031152 3300046691 Bacteria 2650
813 Ga0495670_0034238 3300046691 Bacteria 2529
814 Ga0495670_0043525 3300046691 Bacteria 2240
815 Ga0495670_0044402 3300046691 Bacteria 2219
816 Ga0495671_0000523 3300046692 Bacteria 29247
817 Ga0495671_0000831 3300046692 Bacteria 22044
818 Ga0495671_0001233 3300046692 Bacteria 17527
819 Ga0495671_0002442 3300046692 Bacteria 11730
820 Ga0495671_0005417 3300046692 Bacteria 7468
821 Ga0495671_0007589 3300046692 Bacteria 6168
822 Ga0495671_0017510 3300046692 Bacteria 3813
823 Ga0495671_0024154 3300046692 Bacteria 3169
824 Ga0495671_0028266 3300046692 Bacteria 2891
825 Ga0495671_0030378 3300046692 Bacteria 2767
826 Ga0495671_0046395 3300046692 Bacteria 2172
827 Ga0495671_0051228 3300046692 Bacteria 2053
828 Ga0495671_0067597 3300046692 Bacteria 1757
829 Ga0495649_0000391 3300046694 Bacteria 38039
830 Ga0495649_0000559 3300046694 Bacteria 31486
831 Ga0495649_0004173 3300046694 Bacteria 9482
832 Ga0495649_0007090 3300046694 Bacteria 6889
833 Ga0495649_0011361 3300046694 Bacteria 5224
834 Ga0495649_0015776 3300046694 Bacteria 4295
835 Ga0495649_0015829 3300046694 Bacteria 4286
836 Ga0495649_0019995 3300046694 Bacteria 3757
837 Ga0495649_0021047 3300046694 Bacteria 3656
838 Ga0495649_0021977 3300046694 Bacteria 3572
839 Ga0495649_0022442 3300046694 Bacteria 3532
840 Ga0495649_0023674 3300046694 Bacteria 3429
841 Ga0495649_0024342 3300046694 Bacteria 3376
842 Ga0495649_0026405 3300046694 Bacteria 3228
843 Ga0495649_0030686 3300046694 Bacteria 2967
844 Ga0495649_0033554 3300046694 Bacteria 2825
845 Ga0495649_0057180 3300046694 Bacteria 2104
846 Ga0495649_0062909 3300046694 Bacteria 1994
847 Ga0495649_0093992 3300046694 Bacteria 1596
848 Ga0495589_0000623 3300046794 Bacteria 23411
849 Ga0495589_0003341 3300046794 Bacteria 8706
850 Ga0495589_0003559 3300046794 Bacteria 8424
851 Ga0495589_0018112 3300046794 Bacteria 3613
852 Ga0495589_0018616 3300046794 Bacteria 3560
853 Ga0495589_0020689 3300046794 Bacteria 3364
854 Ga0495589_0025370 3300046794 Bacteria 3008
855 Ga0495589_0029514 3300046794 Bacteria 2764
856 Ga0495589_0030037 3300046794 Bacteria 2738
857 Ga0495600_0051646 3300046809 Bacteria 2683
858 Ga0495660_0000813 3300046810 Bacteria 23314
859 Ga0495660_0001072 3300046810 Bacteria 19628
860 Ga0495660_0004511 3300046810 Bacteria 8419
861 Ga0495660_0009661 3300046810 Bacteria 5622
862 Ga0495660_0016091 3300046810 Bacteria 4314
863 Ga0495660_0016866 3300046810 Bacteria 4208
864 Ga0495660_0017059 3300046810 Bacteria 4181
865 Ga0495660_0030578 3300046810 Bacteria 3032
866 Ga0495660_0030959 3300046810 Bacteria 3011
867 Ga0495660_0035800 3300046810 Bacteria 2771
868 Ga0495660_0054263 3300046810 Bacteria 2171
869 Ga0495660_0054831 3300046810 Bacteria 2159
870 Ga0495660_0082788 3300046810 Bacteria 1679
871 Ga0495660_0102189 3300046810 Bacteria 1474
872 Ga0495581_0026005 3300047315 Bacteria 3394
873 Ga0495581_0032916 3300047315 Bacteria 3000
874 Ga0495604_0010283 3300047317 Bacteria 7412
875 Ga0495604_0023972 3300047317 Bacteria 4870
876 Ga0495604_0060124 3300047317 Bacteria 2910
877 Ga0495604_0070477 3300047317 Bacteria 2647
878 Ga0495636_0004764 3300047318 Bacteria 5321
879 Ga0495674_0036832 3300047319 Bacteria 4399
880 Ga0495672_0001713 3300047320 Bacteria 21249
881 Ga0495672_0004738 3300047320 Bacteria 10984
882 Ga0495672_0006772 3300047320 Bacteria 8782
883 Ga0495672_0008160 3300047320 Bacteria 7769
884 Ga0495672_0010811 3300047320 Bacteria 6477
885 Ga0495672_0012642 3300047320 Bacteria 5875
886 Ga0495672_0017803 3300047320 Bacteria 4740
887 Ga0495672_0019171 3300047320 Bacteria 4520
888 Ga0495672_0019509 3300047320 Bacteria 4469
889 Ga0495672_0028127 3300047320 Bacteria 3562
890 Ga0495672_0033582 3300047320 Bacteria 3177
891 Ga0495672_0040095 3300047320 Bacteria 2842
892 Ga0495672_0044618 3300047320 Bacteria 2658
893 Ga0495672_0056873 3300047320 Bacteria 2273
894 Ga0495676_0000011 3300047321 Bacteria 242612
895 Ga0495676_0018322 3300047321 Bacteria 6173
896 Ga0495676_0040214 3300047321 Bacteria 3861
897 Ga0495676_0057316 3300047321 Bacteria 3074
898 Ga0495680_0003692 3300047322 Bacteria 14948
899 Ga0495680_0020550 3300047322 Bacteria 5551
900 Ga0495680_0085442 3300047322 Bacteria 2376
901 Ga0495680_0115741 3300047322 Bacteria 1983
902 Ga0495683_0000055 3300047323 Bacteria 119199
903 Ga0495683_0000070 3300047323 Bacteria 108186
904 Ga0495683_0001936 3300047323 Bacteria 12923
905 Ga0495683_0002474 3300047323 Bacteria 11140
906 Ga0495683_0013037 3300047323 Bacteria 4353
907 Ga0495683_0019923 3300047323 Bacteria 3461
908 Ga0495683_0020473 3300047323 Bacteria 3412
909 Ga0495683_0027209 3300047323 Bacteria 2925
910 Ga0495683_0033597 3300047323 Bacteria 2609
911 Ga0495683_0035728 3300047323 Bacteria 2525
912 Ga0495683_0038596 3300047323 Bacteria 2417
913 Ga0495683_0060205 3300047323 Bacteria 1882
914 Ga0495687_001949 3300047443 Bacteria 17670
915 Ga0495687_004868 3300047443 Bacteria 8818
916 Ga0495687_006493 3300047443 Bacteria 7150
917 Ga0495687_007391 3300047443 Bacteria 6475
918 Ga0495675_0114547 3300047444 Bacteria 1681
919 Ga0495677_0006695 3300047445 Bacteria 4337
920 Ga0495679_000028 3300047446 Bacteria 192300
921 Ga0495679_000112 3300047446 Bacteria 73847
922 Ga0495679_001085 3300047446 Bacteria 16491
923 Ga0495679_002474 3300047446 Bacteria 9390
924 Ga0495679_003915 3300047446 Bacteria 7033
925 Ga0495679_010995 3300047446 Bacteria 3520
926 Ga0495679_011890 3300047446 Bacteria 3342
927 Ga0495679_012627 3300047446 Bacteria 3204
928 Ga0495679_016337 3300047446 Bacteria 2688
929 Ga0495679_016379 3300047446 Bacteria 2684
930 Ga0495679_019447 3300047446 Bacteria 2386
931 Ga0495685_009090 3300047447 Bacteria 3312
932 Ga0495673_0002023 3300047469 Bacteria 14906
933 Ga0495673_0002787 3300047469 Bacteria 11943
934 Ga0495673_0002881 3300047469 Bacteria 11694
935 Ga0495673_0002928 3300047469 Bacteria 11531
936 Ga0495673_0003210 3300047469 Bacteria 10919
937 Ga0495673_0003577 3300047469 Bacteria 10195
938 Ga0495673_0004883 3300047469 Bacteria 8280
939 Ga0495673_0006615 3300047469 Bacteria 6793
940 Ga0495673_0015997 3300047469 Bacteria 3847
941 Ga0495673_0017046 3300047469 Bacteria 3698
942 Ga0495673_0017983 3300047469 Bacteria 3575
943 Ga0495673_0021092 3300047469 Bacteria 3225
944 Ga0495673_0025150 3300047469 Bacteria 2863
945 Ga0495673_0029015 3300047469 Bacteria 2614
946 Ga0495673_0031018 3300047469 Bacteria 2505
947 Ga0495673_0031900 3300047469 Bacteria 2463
948 Ga0495673_0034470 3300047469 Bacteria 2339
949 Ga0495681_0001577 3300047470 Bacteria 16961
950 Ga0495681_0001819 3300047470 Bacteria 15684
951 Ga0495681_0002096 3300047470 Bacteria 14502
952 Ga0495681_0002803 3300047470 Bacteria 12334
953 Ga0495681_0003177 3300047470 Bacteria 11478
954 Ga0495681_0006194 3300047470 Bacteria 7890
955 Ga0495681_0009440 3300047470 Bacteria 6013
956 Ga0495681_0010282 3300047470 Bacteria 5672
957 Ga0495681_0013400 3300047470 Bacteria 4759
958 Ga0495681_0017013 3300047470 Bacteria 4053
959 Ga0495681_0018331 3300047470 Bacteria 3859
960 Ga0495681_0019939 3300047470 Bacteria 3648
961 Ga0495681_0022191 3300047470 Bacteria 3403
962 Ga0495681_0023661 3300047470 Bacteria 3257
963 Ga0495681_0023884 3300047470 Bacteria 3234
964 Ga0495681_0026779 3300047470 Bacteria 2993
965 Ga0495681_0029554 3300047470 Bacteria 2803
966 Ga0495681_0030176 3300047470 Bacteria 2764
967 Ga0495684_0086477 3300047471 Bacteria 2376
968 Ga0495686_0007308 3300047472 Bacteria 8297
969 Ga0495686_0018468 3300047472 Bacteria 4678
970 Ga0495686_0028199 3300047472 Bacteria 3657
971 Ga0495686_0038352 3300047472 Bacteria 3064
972 Ga0495593_0024794 3300047673 Bacteria 3320
973 Ga0495593_0026184 3300047673 Bacteria 3223
974 Ga0495593_0032095 3300047673 Bacteria 2865
975 Ga0495593_0036563 3300047673 Bacteria 2662
976 Ga0495602_0050339 3300048088 Bacteria 3722
977 Ga0495626_0000024 3300048091 Bacteria 214179
978 Ga0495626_0001637 3300048091 Bacteria 17372
979 Ga0495626_0002640 3300048091 Bacteria 12179
980 Ga0495626_0002807 3300048091 Bacteria 11669
981 Ga0495626_0003080 3300048091 Bacteria 10932
982 Ga0495626_0003418 3300048091 Bacteria 10207
983 Ga0495626_0012330 3300048091 Bacteria 4485
984 Ga0495626_0014388 3300048091 Bacteria 4083
985 Ga0495626_0020772 3300048091 Bacteria 3267
986 Ga0495626_0024030 3300048091 Bacteria 2992
987 Ga0495626_0028377 3300048091 Bacteria 2714
988 Ga0495626_0036459 3300048091 Bacteria 2342
989 Ga0495626_0060977 3300048091 Bacteria 1717
990 Ga0496102_0001804 3300048905 Bacteria 18522
991 Ga0496103_0016839 3300048906 Bacteria 4365
992 Ga0496107_0100991 3300048910 Bacteria 2115
993 Ga0496111_0140402 3300048914 Bacteria 1790
994 Ga0496114_0018103 3300048917 Bacteria 5692
995 Ga0496116_0001804 3300048919 Bacteria 23238
996 Ga0496116_0002819 3300048919 Bacteria 17844
997 Ga0496116_0007235 3300048919 Bacteria 9894
998 Ga0496116_0013490 3300048919 Bacteria 6583
999 Ga0496116_0030868 3300048919 Bacteria 3844
1000 Ga0496116_0056262 3300048919 Bacteria 2579
1001 Ga0496117_0000391 3300048920 Bacteria 75232
1002 Ga0496117_0000693 3300048920 Bacteria 53679
1003 Ga0496117_0001466 3300048920 Bacteria 33965
1004 Ga0496117_0003578 3300048920 Bacteria 17933
1005 Ga0496117_0004592 3300048920 Bacteria 15091
1006 Ga0496117_0004735 3300048920 Bacteria 14775
1007 Ga0496117_0008652 3300048920 Bacteria 9629
1008 Ga0496117_0009923 3300048920 Bacteria 8762
1009 Ga0496117_0013606 3300048920 Bacteria 7087
1010 Ga0496117_0023769 3300048920 Bacteria 4870
1011 Ga0496117_0028614 3300048920 Bacteria 4313
1012 Ga0496117_0038813 3300048920 Bacteria 3523
1013 Ga0496117_0039527 3300048920 Bacteria 3481
1014 Ga0496117_0049882 3300048920 Bacteria 2972
1015 Ga0496117_0054296 3300048920 Bacteria 2807
1016 Ga0496117_0097258 3300048920 Bacteria 1875
1017 Ga0496118_0001896 3300048921 Bacteria 29823
1018 Ga0496118_0003081 3300048921 Bacteria 21376
1019 Ga0496118_0009066 3300048921 Bacteria 10138
1020 Ga0496118_0011726 3300048921 Bacteria 8518
1021 Ga0496118_0029398 3300048921 Bacteria 4608
1022 Ga0496118_0033981 3300048921 Bacteria 4171
1023 Ga0496118_0035976 3300048921 Bacteria 4011
1024 Ga0496118_0042757 3300048921 Bacteria 3571
1025 Ga0496118_0043491 3300048921 Bacteria 3529
1026 Ga0496118_0056636 3300048921 Bacteria 2945
1027 Ga0496118_0057054 3300048921 Bacteria 2930
1028 Ga0496119_0000016 3300048922 Bacteria 309806
1029 Ga0496119_0000564 3300048922 Bacteria 49944
1030 Ga0496119_0056248 3300048922 Bacteria 2384
1031 Ga0496119_0073337 3300048922 Bacteria 1996
1032 Ga0496120_0000718 3300048923 Bacteria 48575
1033 Ga0496120_0002909 3300048923 Bacteria 16361
1034 Ga0496120_0005281 3300048923 Bacteria 10365
1035 Ga0496120_0023811 3300048923 Bacteria 3828
1036 Ga0496120_0084507 3300048923 Bacteria 1710
1037 Ga0496121_0003293 3300048924 Bacteria 23201
1038 Ga0496121_0004784 3300048924 Bacteria 17860
1039 Ga0496121_0052261 3300048924 Bacteria 3434
1040 Ga0496121_0054357 3300048924 Bacteria 3346
1041 Ga0496121_0058302 3300048924 Bacteria 3193
1042 Ga0496121_0072805 3300048924 Bacteria 2757
1043 Ga0496121_0100362 3300048924 Bacteria 2234
1044 Ga0496122_0002337 3300048925 Bacteria 27356
1045 Ga0496122_0009161 3300048925 Bacteria 10481
1046 Ga0496122_0012153 3300048925 Bacteria 8612
1047 Ga0496122_0025649 3300048925 Bacteria 5111
1048 Ga0496122_0032284 3300048925 Bacteria 4334
1049 Ga0496122_0032813 3300048925 Bacteria 4285
1050 Ga0496122_0057697 3300048925 Bacteria 2880
1051 Ga0496122_0058463 3300048925 Bacteria 2854
1052 Ga0496122_0070575 3300048925 Bacteria 2495
1053 Ga0496122_0071527 3300048925 Bacteria 2471
1054 Ga0496122_0079331 3300048925 Bacteria 2294
1055 Ga0496123_0000178 3300048926 Bacteria 128587
1056 Ga0496123_0009661 3300048926 Bacteria 8650
1057 Ga0496123_0026944 3300048926 Bacteria 4293
1058 Ga0496123_0035575 3300048926 Bacteria 3545
1059 Ga0496123_0048860 3300048926 Bacteria 2842
1060 Ga0496123_0052528 3300048926 Bacteria 2703
1061 Ga0496123_0060981 3300048926 Bacteria 2428
1062 Ga0496124_0000073 3300048927 Bacteria 219306
1063 Ga0496124_0001034 3300048927 Bacteria 44037
1064 Ga0496124_0005438 3300048927 Bacteria 14324
1065 Ga0496124_0006006 3300048927 Bacteria 13390
1066 Ga0496124_0006363 3300048927 Bacteria 12884
1067 Ga0496124_0008402 3300048927 Bacteria 10799
1068 Ga0496124_0009118 3300048927 Bacteria 10254
1069 Ga0496124_0010734 3300048927 Bacteria 9235
1070 Ga0496124_0039823 3300048927 Bacteria 4070
1071 Ga0496124_0048691 3300048927 Bacteria 3620
1072 Ga0496124_0049432 3300048927 Bacteria 3587
1073 Ga0496124_0054471 3300048927 Bacteria 3385
1074 Ga0496124_0056014 3300048927 Bacteria 3328
1075 Ga0496124_0067741 3300048927 Bacteria 2969
1076 Ga0496125_0000201 3300048928 Bacteria 126007
1077 Ga0496125_0002275 3300048928 Bacteria 25467
1078 Ga0496125_0006131 3300048928 Bacteria 13118
1079 Ga0496125_0006926 3300048928 Bacteria 12134
1080 Ga0496125_0027979 3300048928 Bacteria 5099
1081 Ga0496125_0028759 3300048928 Bacteria 5010
1082 Ga0496125_0030596 3300048928 Bacteria 4813
1083 Ga0496125_0036087 3300048928 Bacteria 4323
1084 Ga0496125_0038568 3300048928 Bacteria 4132
1085 Ga0496125_0045564 3300048928 Bacteria 3688
1086 Ga0496125_0045826 3300048928 Bacteria 3675
1087 Ga0496125_0055196 3300048928 Bacteria 3239
1088 Ga0496125_0057067 3300048928 Bacteria 3165
1089 Ga0496125_0057767 3300048928 Bacteria 3139
1090 Ga0496126_0015279 3300048929 Bacteria 7728
1091 Ga0496126_0035219 3300048929 Bacteria 4693
1092 Ga0496126_0036198 3300048929 Bacteria 4617
1093 Ga0496126_0046709 3300048929 Bacteria 3968
1094 Ga0496126_0145079 3300048929 Bacteria 2039
1095 Ga0495678_000160 3300049459 Bacteria 80551
1096 Ga0495678_001251 3300049459 Bacteria 20674
1097 Ga0495678_001438 3300049459 Bacteria 18734
1098 Ga0495678_001969 3300049459 Bacteria 14794
1099 Ga0495678_003377 3300049459 Bacteria 9935
1100 Ga0495678_003435 3300049459 Bacteria 9812
1101 Ga0495678_004268 3300049459 Bacteria 8353
1102 Ga0495678_007645 3300049459 Bacteria 5575
1103 Ga0495678_008771 3300049459 Bacteria 5067
1104 Ga0495678_011789 3300049459 Bacteria 4169
1105 Ga0495678_016342 3300049459 Bacteria 3395
1106 Ga0495678_018980 3300049459 Bacteria 3078
1107 Ga0495678_019936 3300049459 Bacteria 2980
1108 Ga0495678_031695 3300049459 Bacteria 2200
1109 Ga0495678_033627 3300049459 Bacteria 2115
1110 Ga0495682_0000128 3300049460 Bacteria 65703
1111 Ga0495682_0000620 3300049460 Bacteria 23857
1112 Ga0495682_0007806 3300049460 Bacteria 4238
1113 Ga0495682_0008086 3300049460 Bacteria 4154
1114 Ga0495682_0017975 3300049460 Bacteria 2663
1115 Ga0495682_0023806 3300049460 Bacteria 2284
1116 Ga0495682_0037911 3300049460 Bacteria 1772
1117 Ga0501032_0121317 3300049569 Bacteria 1728
1118 Ga0501034_0000143 3300049571 Bacteria 133317
1119 Ga0501034_0108804 3300049571 Bacteria 2763
1120 Ga0501241_002487 3300049758 Bacteria 3560
1121 Ga0501226_000049 3300049853 Bacteria 53390
1122 Ga0501226_001205 3300049853 Bacteria 3354
1123 nmdc:mga03683_11726_c2 3300050489 Bacteria 2165
1124 nmdc:mga00v17_54882_c2 3300050491 Bacteria 2050
1125 Ga0500572_003741 3300053111 Bacteria 3453
1126 Ga0500659_0009689 3300053135 Bacteria 5283
1127 Ga0500634_0001488 3300053161 Bacteria 9157
1128 Ga0500634_0014641 3300053161 Bacteria 4141

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003781 Ga0055536_1000005 Ga0055536_1000005213 425
2 3300003791 Ga0055530_10000001 Ga0055530_10000001118 425
3 3300003792 Ga0055540_1000389 Ga0055540_100038923 425
4 3300013102 Ga0157371_10000109 Ga0157371_1000010915 425
5 3300025292 Ga0209676_1000003 Ga0209676_1000003424 425
6 3300025298 Ga0209050_1000004 Ga0209050_1000004406 425
7 3300025303 Ga0209051_1000006 Ga0209051_1000006568 425
8 iso_pu_bacteria 2554235231 2555246791 425
9 3300009036 Ga0105244_10034824 Ga0105244_100348243 426
10 3300013105 Ga0157369_10003641 Ga0157369_1000364117 426
11 3300025256 Ga0209759_1009310 Ga0209759_10093103 426
12 3300025735 Ga0207713_1006749 Ga0207713_10067493 426
13 3300031548 Ga0307408_100000002 Ga0307408_100000002516 426
14 3300042439 Ga0439464_0012983 Ga0439464_0012983_651_1964 426
15 3300046453 Ga0495627_012352 Ga0495627_012352_1160_2440 426
16 3300046453 Ga0495627_042420 Ga0495627_042420_60_1340 426
17 3300046458 Ga0495591_002064 Ga0495591_002064_6451_7731 426
18 3300046458 Ga0495591_014543 Ga0495591_014543_1120_2400 426
19 3300046471 Ga0495650_0013273 Ga0495650_0013273_147_1427 426
20 3300046474 Ga0495605_0000100 Ga0495605_0000100_7258_8538 426
21 3300046499 Ga0495594_0006978 Ga0495594_0006978_738_2018 426
22 3300046506 Ga0495583_0000174 Ga0495583_0000174_100538_101818 426
23 3300046515 Ga0495620_0000085 Ga0495620_0000085_7174_8454 426
24 3300046518 Ga0495631_0005177 Ga0495631_0005177_5407_6687 426
25 3300046524 Ga0495648_0004830 Ga0495648_0004830_4704_5984 426
26 3300046530 Ga0495654_0049793 Ga0495654_0049793_675_1955 426
27 3300046538 Ga0495609_0000088 Ga0495609_0000088_100726_102006 426
28 3300046542 Ga0495597_0003235 Ga0495597_0003235_1878_3158 426
29 3300046558 Ga0495633_0000205 Ga0495633_0000205_66257_67537 426
30 3300046648 Ga0495611_0000738 Ga0495611_0000738_16474_17754 426
31 3300046665 Ga0495661_0005906 Ga0495661_0005906_107_1387 426
32 3300046691 Ga0495670_0043525 Ga0495670_0043525_95_1375 426
33 3300046692 Ga0495671_0067597 Ga0495671_0067597_363_1643 426
34 3300046794 Ga0495589_0003559 Ga0495589_0003559_6978_8258 426
35 3300046810 Ga0495660_0004511 Ga0495660_0004511_6797_8077 426
36 3300047323 Ga0495683_0000070 Ga0495683_0000070_99677_100957 426
37 3300047446 Ga0495679_000112 Ga0495679_000112_7230_8510 426
38 3300047470 Ga0495681_0010282 Ga0495681_0010282_1097_2377 426
39 3300048925 Ga0496122_0012153 Ga0496122_0012153_4832_6112 426
40 3300048926 Ga0496123_0052528 Ga0496123_0052528_298_1578 426
41 3300049459 Ga0495678_000160 Ga0495678_000160_71957_73237 426
42 iso_pu_bacteria 2511231018 2511339140 426
43 iso_pu_bacteria 2511231019 2511343132 426
44 iso_pu_bacteria 2511231024 2511373533 426
45 iso_pu_bacteria 2511231024 2511373544 426
46 iso_pu_bacteria 2511231024 2511377031 426
47 iso_pu_bacteria 2554235231 2555247993 426
48 iso_pu_bacteria 2554235341 2555672945 426
49 iso_pu_bacteria 2597489888 2597866735 426
50 iso_pu_bacteria 2597489889 2597870237 426
51 iso_pu_bacteria 2599185160 2599355849 426
52 iso_pu_bacteria 2599185161 2599362749 426
53 iso_pu_bacteria 2599185162 2599368945 426
54 iso_pu_bacteria 2599185163 2599375858 426
55 iso_pu_bacteria 2599185164 2599380955 426
56 iso_pu_bacteria 2599185165 2599387529 426
57 iso_pu_bacteria 2599185166 2599394716 426
58 iso_pu_bacteria 2599185167 2599399252 426
59 iso_pu_bacteria 2599185167 2599400901 426
60 iso_pu_bacteria 2599185168 2599406481 426
61 iso_pu_bacteria 2599185179 2599449754 426
62 iso_pu_bacteria 2599185179 2599453646 426
63 iso_pu_bacteria 2599185181 2599462683 426
64 iso_pu_bacteria 2599185182 2599467895 426
65 iso_pu_bacteria 2599185186 2599491700 426
66 iso_pu_bacteria 2599185189 2599505858 426
67 iso_pu_bacteria 2599185189 2599509014 426
68 iso_pu_bacteria 2599185190 2599511828 426
69 iso_pu_bacteria 2599185190 2599513745 426
70 iso_pu_bacteria 2599185191 2599516812 426
71 iso_pu_bacteria 2599185191 2599518925 426
72 iso_pu_bacteria 2599185288 2599879148 426
73 iso_pu_bacteria 2599185288 2599881029 426
74 iso_pu_bacteria 2599185290 2599892802 426
75 iso_pu_bacteria 2599185290 2599893331 426
76 iso_pu_bacteria 2599185303 2599948906 426
77 iso_pu_bacteria 2599185303 2599949692 426
78 iso_pu_bacteria 2599185356 2600215307 426
79 iso_pu_bacteria 2600254931 2600362858 426
80 iso_pu_bacteria 2600255296 2601691509 426
81 iso_pu_bacteria 2600255296 2601693094 426
82 iso_pu_bacteria 2600255313 2601775473 426
83 iso_pu_bacteria 2619619299 2621296738 426
84 iso_pu_bacteria 2619619299 2621300206 426
85 iso_pu_bacteria 2643221565 2643843069 426
86 iso_pu_bacteria 2643221571 2643870606 426
87 iso_pu_bacteria 2643221571 2643872373 426
88 iso_pu_bacteria 2643221713 2644620837 426
89 iso_pu_bacteria 2643221713 2644624663 426
90 iso_pu_bacteria 2667528171 2671099390 426
91 iso_pu_bacteria 2675903420 2677895962 426
92 iso_pu_bacteria 2675903420 2677897261 426
93 iso_pu_bacteria 2721755607 2723248324 426
94 iso_pu_bacteria 2721755607 2723251471 426
95 iso_pu_bacteria 2738541265 2738671557 426
96 iso_pu_bacteria 2738541265 2738675097 426
97 iso_pu_bacteria 2738541282 2738749951 426
98 iso_pu_bacteria 2738541282 2738753387 426
99 iso_pu_bacteria 2738541294 2738807364 426
100 iso_pu_bacteria 2738541294 2738810552 426
101 iso_pu_bacteria 2738541303 2738858991 426
102 iso_pu_bacteria 2738541303 2738862299 426
103 iso_pu_bacteria 2738541309 2738894724 426
104 iso_pu_bacteria 2738541309 2738897912 426
105 iso_pu_bacteria 2765235841 2765584186 426
106 iso_pu_bacteria 2765235841 2765586676 426
107 iso_pu_bacteria 2806310737 2807408222 426
108 iso_pu_bacteria 2806310737 2807410869 426
109 iso_pu_bacteria 2806310745 2807456537 426
110 iso_pu_bacteria 2806310745 2807459210 426
111 iso_pu_bacteria 2808606377 2808928326 426
112 iso_pu_bacteria 2808606381 2808950491 426
113 iso_pu_bacteria 2808606382 2808959966 426
114 iso_pu_bacteria 2808606385 2808976260 426
115 iso_pu_bacteria 2808606385 2808978558 426
116 iso_pu_bacteria 2808606388 2808993915 426
117 iso_pu_bacteria 2808606388 2808994279 426
118 iso_pu_bacteria 2808606445 2809217311 426
119 iso_pu_bacteria 2816332298 2817491552 426
120 iso_pu_bacteria 2816332298 2817494149 426
121 iso_pu_bacteria 2818991464 2819704536 426
122 iso_pu_bacteria 2834028612 2834030259 426
123 iso_pu_bacteria 2834028612 2834031060 426
124 iso_pu_bacteria 2842826826 2842828662 426
125 iso_pu_bacteria 2842826826 2842830883 426
126 iso_pu_bacteria 2842837860 2842838005 426
127 iso_pu_bacteria 2842837860 2842840301 426
128 iso_pu_bacteria 2844665904 2844667208 426
129 iso_pu_bacteria 2852612431 2852616460 426
130 iso_pu_bacteria 2852612431 2852617411 426
131 iso_pu_bacteria 2852667396 2852671428 426
132 iso_pu_bacteria 2852667396 2852672470 426
133 iso_pu_bacteria 2908446538 2908450208 426
134 iso_pu_bacteria 2908446538 2908452724 426
135 iso_pu_bacteria 2917070673 2917076845 426
136 iso_pu_bacteria 2919155634 2919155988 426
137 iso_pu_bacteria 2919155634 2919156241 426
138 iso_pu_bacteria 2929189879 2929195256 426
139 iso_pu_bacteria 2931390751 2931390761 426
140 iso_pu_bacteria 2931390751 2931394378 426
141 iso_pu_bacteria 2935353572 2935358188 426
142 iso_pu_bacteria 2945928738 2945930808 426
143 iso_pu_bacteria 2945961074 2945966977 426
144 iso_pu_bacteria 2946006987 2946010327 426
145 iso_pu_bacteria 2946006987 2946013157 426
146 iso_pu_bacteria 2946027586 2946031263 426
147 iso_pu_bacteria 2947233263 2947234535 426
148 iso_pu_bacteria 2947233263 2947238234 426
149 iso_pu_bacteria 3007419365 3007419383 426
150 iso_pu_bacteria 3007511990 3007517288 426
151 iso_pu_bacteria 3007619802 3007624602 426
152 iso_pu_bacteria 3007803356 3007808451 426
153 iso_pu_bacteria 3007872151 3007875136 426
154 iso_pu_bacteria 3007872151 3007876698 426
155 iso_pu_bacteria 637000220 637323376 426
156 iso_pu_bacteria 8011350971 8011353335 426
157 iso_pu_bacteria 8052494512 8052494747 426
158 iso_pu_bacteria 8052494512 8052497422 426
159 iso_pu_bacteria 8054285046 8054286290 426
160 iso_pu_bacteria 8054285046 8054290417 426
161 iso_pu_bacteria 8054347763 8054349477 426
162 iso_pu_bacteria 8054347763 8054351489 426
163 iso_pu_bacteria 8054503363 8054503373 426
164 iso_pu_bacteria 8054929484 8054929790 426
165 iso_pu_bacteria 8054929484 8054931224 426
166 iso_pu_bacteria 8055817908 8055820401 426
167 iso_pu_bacteria 8055817908 8055824017 426
168 iso_pu_bacteria 8056115690 8056116447 426
169 iso_pu_bacteria 8056115690 8056118656 426
170 iso_pu_bacteria 8056120720 8056123535 426
171 iso_pu_bacteria 8056120720 8056125783 426
172 iso_pu_bacteria 8056131705 8056131715 426
173 iso_pu_bacteria 8056137416 8056140261 426
174 iso_pu_bacteria 8056137416 8056142901 426
175 iso_pu_bacteria 8056148874 8056151384 426
176 iso_pu_bacteria 8056148874 8056155020 426
177 iso_pu_bacteria 8056161164 8056163732 426
178 iso_pu_bacteria 8056177738 8056182103 426
179 3300046492 Ga0495585_0006230 Ga0495585_0006230_5398_6711 427
180 3300046665 Ga0495661_0000050 Ga0495661_0000050_132546_133859 427
181 iso_pu_bacteria 2842805378 2842807845 427
182 iso_pu_bacteria 2912963787 2912965081 427
183 iso_pu_bacteria 2939651529 2939653443 427
184 iso_pu_bacteria 2945961074 2945962658 427
185 3300046518 Ga0495631_0012698 Ga0495631_0012698_2518_3804 428
186 3300046665 Ga0495661_0004643 Ga0495661_0004643_6670_7956 428
187 3300047446 Ga0495679_001085 Ga0495679_001085_12462_13748 428
188 3300047469 Ga0495673_0002023 Ga0495673_0002023_8362_9672 428
189 3300049460 Ga0495682_0000128 Ga0495682_0000128_42346_43635 428
190 3300053161 Ga0500634_0001488 Ga0500634_0001488_5522_6808 428
191 iso_pu_bacteria 2511231006 2511267199 428
192 iso_pu_bacteria 2512047018 2512326149 428
193 iso_pu_bacteria 2582580891 2583792625 428
194 iso_pu_bacteria 2597489887 2597858268 428
195 iso_pu_bacteria 2599185185 2599486248 428
196 iso_pu_bacteria 2599185257 2599802873 428
197 iso_pu_bacteria 2671180172 2671769505 428
198 iso_pu_bacteria 2740892503 2743737761 428
199 iso_pu_bacteria 2923153595 2923156806 428
200 iso_pu_bacteria 2984286254 2984289284 428
201 iso_pu_bacteria 3007395558 3007396211 428
202 iso_pu_bacteria 3007419365 3007422033 428
203 iso_pu_bacteria 8015687852 8015691031 428
204 iso_pu_bacteria 8055770955 8055774172 428
205 3300015262 Ga0182007_10000904 Ga0182007_100009048 429
206 3300042009 Ga0439451_000396 Ga0439451_000396_2188_3486 429
207 3300046458 Ga0495591_007796 Ga0495591_007796_1823_3112 429
208 3300046491 Ga0495584_0051129 Ga0495584_0051129_241_1533 429
209 3300046501 Ga0495607_0011385 Ga0495607_0011385_3340_4629 429
210 3300046506 Ga0495583_0006241 Ga0495583_0006241_2782_4071 429
211 3300046518 Ga0495631_0009209 Ga0495631_0009209_582_1871 429
212 3300046520 Ga0495637_0000216 Ga0495637_0000216_7653_8942 429
213 3300046522 Ga0495643_0007180 Ga0495643_0007180_2206_3495 429
214 3300046524 Ga0495648_0009755 Ga0495648_0009755_3667_4956 429
215 3300046530 Ga0495654_0025663 Ga0495654_0025663_1622_2911 429
216 3300046557 Ga0495622_0005594 Ga0495622_0005594_3925_5223 429
217 3300046616 Ga0495668_0042078 Ga0495668_0042078_449_1738 429
218 3300046648 Ga0495611_0057384 Ga0495611_0057384_37_1326 429
219 3300046665 Ga0495661_0019756 Ga0495661_0019756_804_2093 429
220 3300046692 Ga0495671_0002442 Ga0495671_0002442_7638_8927 429
221 3300046810 Ga0495660_0009661 Ga0495660_0009661_143_1432 429
222 3300047320 Ga0495672_0004738 Ga0495672_0004738_7390_8679 429
223 3300047469 Ga0495673_0003577 Ga0495673_0003577_7633_8922 429
224 3300047469 Ga0495673_0006615 Ga0495673_0006615_1272_2561 429
225 3300049459 Ga0495678_001251 Ga0495678_001251_4600_5892 429
226 3300049459 Ga0495678_001438 Ga0495678_001438_7839_9128 429
227 3300049459 Ga0495678_003377 Ga0495678_003377_2534_3823 429
228 iso_pu_bacteria 2923525760 2923529952 429
229 3300001915 JGI24741J21665_1002879 JGI24741J21665_10028794 430
230 3300002737 JGI25162J39368_1000455 JGI25162J39368_100045522 430
231 3300002771 JGI25163J39215_1000583 JGI25163J39215_10005834 430
232 3300002772 JGI25164J39214_1000311 JGI25164J39214_100031122 430
233 3300003214 JGI25165J46597_1000581 JGI25165J46597_100058122 430
234 3300003751 Ga0055538_1000012 Ga0055538_1000012280 430
235 3300003751 Ga0055538_1000212 Ga0055538_100021212 430
236 3300003752 Ga0055539_1000017 Ga0055539_1000017280 430
237 3300003752 Ga0055539_1000256 Ga0055539_100025612 430
238 3300003756 Ga0055533_1000021 Ga0055533_1000021280 430
239 3300003756 Ga0055533_1000245 Ga0055533_100024512 430
240 3300003758 Ga0055532_1000119 Ga0055532_100011946 430
241 3300003758 Ga0055532_1000268 Ga0055532_100026812 430
242 3300003759 Ga0055525_1000255 Ga0055525_10002559 430
243 3300003759 Ga0055525_1000343 Ga0055525_100034312 430
244 3300003761 Ga0055535_1004418 Ga0055535_10044183 430
245 3300003841 Ga0055541_1000012 Ga0055541_1000012280 430
246 3300003841 Ga0055541_1000154 Ga0055541_100015418 430
247 3300005288 Ga0065714_10007402 Ga0065714_100074024 430
248 3300005288 Ga0065714_10065643 Ga0065714_100656434 430
249 3300005289 Ga0065704_10002475 Ga0065704_100024753 430
250 3300005331 Ga0070670_100003464 Ga0070670_1000034647 430
251 3300005344 Ga0070661_100000399 Ga0070661_10000039930 430
252 3300005344 Ga0070661_100002246 Ga0070661_1000022467 430
253 3300005353 Ga0070669_100000444 Ga0070669_10000044422 430
254 3300005457 Ga0070662_100000528 Ga0070662_10000052815 430
255 3300005539 Ga0068853_100000031 Ga0068853_10000003162 430
256 3300005548 Ga0070665_100107316 Ga0070665_1001073163 430
257 3300005564 Ga0070664_100000824 Ga0070664_10000082419 430
258 3300005564 Ga0070664_100003217 Ga0070664_1000032179 430
259 3300005564 Ga0070664_100007402 Ga0070664_1000074028 430
260 3300005577 Ga0068857_100087463 Ga0068857_1000874632 430
261 3300005578 Ga0068854_100012873 Ga0068854_1000128734 430
262 3300005834 Ga0068851_10000007 Ga0068851_10000007167 430
263 3300006944 Ga0099823_1038992 Ga0099823_10389923 430
264 3300009011 Ga0105251_10000004 Ga0105251_1000000438 430
265 3300009011 Ga0105251_10002854 Ga0105251_100028547 430
266 3300009011 Ga0105251_10003012 Ga0105251_100030127 430
267 3300009011 Ga0105251_10005159 Ga0105251_100051593 430
268 3300009011 Ga0105251_10015775 Ga0105251_100157752 430
269 3300009011 Ga0105251_10026579 Ga0105251_100265793 430
270 3300009036 Ga0105244_10001537 Ga0105244_100015374 430
271 3300009036 Ga0105244_10002214 Ga0105244_100022142 430
272 3300009036 Ga0105244_10002930 Ga0105244_100029308 430
273 3300009036 Ga0105244_10005154 Ga0105244_100051543 430
274 3300009036 Ga0105244_10005226 Ga0105244_100052266 430
275 3300009036 Ga0105244_10009163 Ga0105244_100091633 430
276 3300009036 Ga0105244_10009709 Ga0105244_100097094 430
277 3300009036 Ga0105244_10016239 Ga0105244_100162393 430
278 3300009092 Ga0105250_10000313 Ga0105250_100003134 430
279 3300009092 Ga0105250_10000370 Ga0105250_100003703 430
280 3300009092 Ga0105250_10002436 Ga0105250_100024368 430
281 3300009092 Ga0105250_10004570 Ga0105250_100045705 430
282 3300009092 Ga0105250_10016083 Ga0105250_100160833 430
283 3300009148 Ga0105243_10001692 Ga0105243_100016928 430
284 3300009148 Ga0105243_10003559 Ga0105243_1000355913 430
285 3300009148 Ga0105243_10008247 Ga0105243_100082476 430
286 3300009148 Ga0105243_10020818 Ga0105243_100208184 430
287 3300009148 Ga0105243_10039101 Ga0105243_100391014 430
288 3300009148 Ga0105243_10051457 Ga0105243_100514572 430
289 3300009176 Ga0105242_10015806 Ga0105242_100158062 430
290 3300009176 Ga0105242_10078425 Ga0105242_100784252 430
291 3300009177 Ga0105248_10020149 Ga0105248_100201494 430
292 3300009545 Ga0105237_10001264 Ga0105237_1000126431 430
293 3300009545 Ga0105237_10004302 Ga0105237_100043028 430
294 3300009545 Ga0105237_10030481 Ga0105237_100304814 430
295 3300009553 Ga0105249_10049268 Ga0105249_100492681 430
296 3300013100 Ga0157373_10006394 Ga0157373_100063944 430
297 3300013100 Ga0157373_10006630 Ga0157373_100066303 430
298 3300013100 Ga0157373_10007273 Ga0157373_100072733 430
299 3300013100 Ga0157373_10036934 Ga0157373_100369343 430
300 3300013100 Ga0157373_10044236 Ga0157373_100442363 430
301 3300013100 Ga0157373_10074655 Ga0157373_100746553 430
302 3300013102 Ga0157371_10002723 Ga0157371_1000272310 430
303 3300013104 Ga0157370_10026465 Ga0157370_100264656 430
304 3300013105 Ga0157369_10009951 Ga0157369_100099518 430
305 3300013105 Ga0157369_10011326 Ga0157369_100113269 430
306 3300013105 Ga0157369_10012591 Ga0157369_100125914 430
307 3300013105 Ga0157369_10022760 Ga0157369_100227606 430
308 3300013105 Ga0157369_10055281 Ga0157369_100552812 430
309 3300013307 Ga0157372_10001716 Ga0157372_1000171612 430
310 3300013308 Ga0157375_10000140 Ga0157375_1000014052 430
311 3300013308 Ga0157375_10006355 Ga0157375_100063554 430
312 3300013308 Ga0157375_10009063 Ga0157375_100090638 430
313 3300013308 Ga0157375_10009164 Ga0157375_100091643 430
314 3300013308 Ga0157375_10083666 Ga0157375_100836662 430
315 3300014497 Ga0182008_10000348 Ga0182008_1000034817 430
316 3300014497 Ga0182008_10001204 Ga0182008_1000120411 430
317 3300014497 Ga0182008_10001374 Ga0182008_1000137410 430
318 3300014497 Ga0182008_10003993 Ga0182008_100039933 430
319 3300014497 Ga0182008_10004861 Ga0182008_100048616 430
320 3300014497 Ga0182008_10040561 Ga0182008_100405612 430
321 3300015261 Ga0182006_1001182 Ga0182006_100118210 430
322 3300015262 Ga0182007_10003313 Ga0182007_100033136 430
323 3300015265 Ga0182005_1006644 Ga0182005_10066441 430
324 3300017792 Ga0163161_10006189 Ga0163161_100061893 430
325 3300017792 Ga0163161_10006403 Ga0163161_100064037 430
326 3300017792 Ga0163161_10057087 Ga0163161_100570872 430
327 3300025206 Ga0209435_100498 Ga0209435_1004983 430
328 3300025207 Ga0209760_100119 Ga0209760_10011944 430
329 3300025224 Ga0209784_100007 Ga0209784_100007278 430
330 3300025224 Ga0209784_100065 Ga0209784_100065132 430
331 3300025225 Ga0209566_100009 Ga0209566_100009278 430
332 3300025225 Ga0209566_100081 Ga0209566_100081132 430
333 3300025226 Ga0209674_100021 Ga0209674_100021278 430
334 3300025226 Ga0209674_100101 Ga0209674_100101132 430
335 3300025229 Ga0209147_100009 Ga0209147_100009278 430
336 3300025229 Ga0209147_100152 Ga0209147_10015218 430
337 3300025230 Ga0209563_100018 Ga0209563_100018278 430
338 3300025230 Ga0209563_100098 Ga0209563_100098132 430
339 3300025231 Ga0207427_100005 Ga0207427_100005436 430
340 3300025233 Ga0209437_100018 Ga0209437_100018346 430
341 3300025242 Ga0209258_100249 Ga0209258_10024951 430
342 3300025242 Ga0209258_100583 Ga0209258_10058312 430
343 3300025246 Ga0209646_1000298 Ga0209646_10002989 430
344 3300025253 Ga0209677_100012 Ga0209677_100012278 430
345 3300025253 Ga0209677_100059 Ga0209677_100059132 430
346 3300025256 Ga0209759_1006542 Ga0209759_10065422 430
347 3300025261 Ga0209233_1000021 Ga0209233_1000021436 430
348 3300025292 Ga0209676_1003143 Ga0209676_10031435 430
349 3300025321 Ga0207656_10000015 Ga0207656_1000001564 430
350 3300025321 Ga0207656_10000401 Ga0207656_100004011 430
351 3300025711 Ga0207696_1000016 Ga0207696_1000016401 430
352 3300025711 Ga0207696_1000041 Ga0207696_1000041226 430
353 3300025711 Ga0207696_1000044 Ga0207696_1000044186 430
354 3300025711 Ga0207696_1000050 Ga0207696_10000504 430
355 3300025711 Ga0207696_1000080 Ga0207696_100008019 430
356 3300025711 Ga0207696_1002804 Ga0207696_10028044 430
357 3300025711 Ga0207696_1007233 Ga0207696_10072334 430
358 3300025728 Ga0207655_1000033 Ga0207655_1000033183 430
359 3300025728 Ga0207655_1000137 Ga0207655_1000137115 430
360 3300025728 Ga0207655_1000401 Ga0207655_100040148 430
361 3300025728 Ga0207655_1000597 Ga0207655_10005978 430
362 3300025728 Ga0207655_1001169 Ga0207655_100116922 430
363 3300025728 Ga0207655_1002265 Ga0207655_100226511 430
364 3300025728 Ga0207655_1003606 Ga0207655_10036065 430
365 3300025728 Ga0207655_1044111 Ga0207655_10441111 430
366 3300025735 Ga0207713_1000013 Ga0207713_100001383 430
367 3300025735 Ga0207713_1000249 Ga0207713_100024927 430
368 3300025735 Ga0207713_1002502 Ga0207713_10025027 430
369 3300025735 Ga0207713_1002588 Ga0207713_10025887 430
370 3300025735 Ga0207713_1003204 Ga0207713_10032045 430
371 3300025735 Ga0207713_1005239 Ga0207713_10052396 430
372 3300025735 Ga0207713_1006121 Ga0207713_10061215 430
373 3300025735 Ga0207713_1014938 Ga0207713_10149383 430
374 3300025735 Ga0207713_1019864 Ga0207713_10198642 430
375 3300025914 Ga0207671_10000027 Ga0207671_10000027207 430
376 3300025914 Ga0207671_10000394 Ga0207671_1000039430 430
377 3300025920 Ga0207649_10000012 Ga0207649_10000012219 430
378 3300025920 Ga0207649_10000251 Ga0207649_1000025130 430
379 3300025923 Ga0207681_10000138 Ga0207681_1000013846 430
380 3300025925 Ga0207650_10000282 Ga0207650_1000028210 430
381 3300025925 Ga0207650_10000639 Ga0207650_100006398 430
382 3300025925 Ga0207650_10000642 Ga0207650_100006429 430
383 3300025933 Ga0207706_10000312 Ga0207706_1000031246 430
384 3300025933 Ga0207706_10005467 Ga0207706_1000546712 430
385 3300025934 Ga0207686_10000976 Ga0207686_100009769 430
386 3300025935 Ga0207709_10000558 Ga0207709_100005589 430
387 3300025935 Ga0207709_10001853 Ga0207709_1000185313 430
388 3300025935 Ga0207709_10006575 Ga0207709_100065753 430
389 3300025935 Ga0207709_10006679 Ga0207709_100066794 430
390 3300025945 Ga0207679_10000015 Ga0207679_10000015219 430
391 3300025945 Ga0207679_10000016 Ga0207679_1000001630 430
392 3300025961 Ga0207712_10030674 Ga0207712_100306744 430
393 3300025981 Ga0207640_10195393 Ga0207640_101953932 430
394 3300026041 Ga0207639_10000146 Ga0207639_1000014610 430
395 3300027296 Ga0209389_1000213 Ga0209389_100021328 430
396 3300027296 Ga0209389_1011140 Ga0209389_10111403 430
397 3300027312 Ga0209371_1000311 Ga0209371_10003113 430
398 3300028379 Ga0268266_10102622 Ga0268266_101026223 430
399 3300030500 Ga0268256_1000268 Ga0268256_10002683 430
400 3300030521 Ga0307511_10050707 Ga0307511_100507073 430
401 3300031507 Ga0307509_10059125 Ga0307509_100591253 430
402 3300031731 Ga0307405_10001741 Ga0307405_100017413 430
403 3300031731 Ga0307405_10006005 Ga0307405_100060053 430
404 3300041405 Ga0439438_000268 Ga0439438_000268_13257_14549 430
405 3300041407 Ga0439447_000263 Ga0439447_000263_9771_11063 430
406 3300041411 Ga0439466_0002770 Ga0439466_0002770_4220_5515 430
407 3300041411 Ga0439466_0010748 Ga0439466_0010748_1256_2548 430
408 3300042006 Ga0439432_000414 Ga0439432_000414_7588_8880 430
409 3300042006 Ga0439432_008165 Ga0439432_008165_567_1859 430
410 3300042009 Ga0439451_003618 Ga0439451_003618_946_2238 430
411 3300042010 Ga0439452_000778 Ga0439452_000778_12077_13378 430
412 3300042115 Ga0450911_002315 Ga0450911_002315_1330_2631 430
413 3300042136 Ga0450900_004183 Ga0450900_004183_331_1623 430
414 3300042137 Ga0450902_006958 Ga0450902_006958_58_1350 430
415 3300042142 Ga0450905_001141 Ga0450905_001141_1540_2832 430
416 3300042142 Ga0450905_001569 Ga0450905_001569_856_2151 430
417 3300042142 Ga0450905_005539 Ga0450905_005539_87_1379 430
418 3300046453 Ga0495627_001808 Ga0495627_001808_7289_8581 430
419 3300046453 Ga0495627_010278 Ga0495627_010278_178_1476 430
420 3300046458 Ga0495591_002326 Ga0495591_002326_6105_7397 430
421 3300046458 Ga0495591_011064 Ga0495591_011064_222_1520 430
422 3300046459 Ga0495629_0022308 Ga0495629_0022308_2671_3972 430
423 3300046460 Ga0495638_0027054 Ga0495638_0027054_1331_2632 430
424 3300046473 Ga0495582_0004303 Ga0495582_0004303_5959_7260 430
425 3300046475 Ga0495639_0019840 Ga0495639_0019840_1135_2436 430
426 3300046491 Ga0495584_0003222 Ga0495584_0003222_6417_7718 430
427 3300046491 Ga0495584_0013853 Ga0495584_0013853_970_2271 430
428 3300046492 Ga0495585_0002264 Ga0495585_0002264_4244_5545 430
429 3300046499 Ga0495594_0040814 Ga0495594_0040814_579_1880 430
430 3300046501 Ga0495607_0003886 Ga0495607_0003886_6175_7467 430
431 3300046501 Ga0495607_0090468 Ga0495607_0090468_334_1629 430
432 3300046506 Ga0495583_0001759 Ga0495583_0001759_17026_18318 430
433 3300046507 Ga0495606_0007398 Ga0495606_0007398_6141_7433 430
434 3300046507 Ga0495606_0026838 Ga0495606_0026838_253_1548 430
435 3300046507 Ga0495606_0034040 Ga0495606_0034040_1989_3287 430
436 3300046512 Ga0495610_0003363 Ga0495610_0003363_1539_2834 430
437 3300046512 Ga0495610_0004453 Ga0495610_0004453_668_1969 430
438 3300046512 Ga0495610_0005824 Ga0495610_0005824_7053_8345 430
439 3300046512 Ga0495610_0022553 Ga0495610_0022553_394_1689 430
440 3300046512 Ga0495610_0030625 Ga0495610_0030625_1422_2732 430
441 3300046515 Ga0495620_0000018 Ga0495620_0000018_36072_37367 430
442 3300046515 Ga0495620_0000032 Ga0495620_0000032_52221_53513 430
443 3300046515 Ga0495620_0003670 Ga0495620_0003670_2392_3684 430
444 3300046515 Ga0495620_0013612 Ga0495620_0013612_403_1698 430
445 3300046519 Ga0495632_0000122 Ga0495632_0000122_642_1937 430
446 3300046519 Ga0495632_0001812 Ga0495632_0001812_13969_15261 430
447 3300046519 Ga0495632_0004762 Ga0495632_0004762_2428_3720 430
448 3300046519 Ga0495632_0059041 Ga0495632_0059041_408_1709 430
449 3300046519 Ga0495632_0062098 Ga0495632_0062098_139_1437 430
450 3300046522 Ga0495643_0000394 Ga0495643_0000394_37401_38696 430
451 3300046522 Ga0495643_0000773 Ga0495643_0000773_7782_9074 430
452 3300046522 Ga0495643_0001724 Ga0495643_0001724_10410_11702 430
453 3300046522 Ga0495643_0088996 Ga0495643_0088996_113_1411 430
454 3300046524 Ga0495648_0000279 Ga0495648_0000279_54727_56022 430
455 3300046524 Ga0495648_0001464 Ga0495648_0001464_20127_21419 430
456 3300046524 Ga0495648_0004753 Ga0495648_0004753_3049_4344 430
457 3300046530 Ga0495654_0000205 Ga0495654_0000205_38524_39816 430
458 3300046530 Ga0495654_0002431 Ga0495654_0002431_6545_7837 430
459 3300046530 Ga0495654_0009336 Ga0495654_0009336_3339_4631 430
460 3300046530 Ga0495654_0015579 Ga0495654_0015579_1913_3205 430
461 3300046530 Ga0495654_0023223 Ga0495654_0023223_557_1852 430
462 3300046535 Ga0495586_0014283 Ga0495586_0014283_2248_3549 430
463 3300046536 Ga0495587_0064252 Ga0495587_0064252_351_1652 430
464 3300046542 Ga0495597_0033787 Ga0495597_0033787_105_1406 430
465 3300046543 Ga0495645_0092826 Ga0495645_0092826_655_1956 430
466 3300046642 Ga0495634_0099615 Ga0495634_0099615_292_1593 430
467 3300046663 Ga0495635_0022929 Ga0495635_0022929_1159_2460 430
468 3300046665 Ga0495661_0001427 Ga0495661_0001427_18275_19573 430
469 3300046665 Ga0495661_0002975 Ga0495661_0002975_7370_8662 430
470 3300046680 Ga0495646_0037444 Ga0495646_0037444_1173_2474 430
471 3300046694 Ga0495649_0000559 Ga0495649_0000559_9014_10306 430
472 3300046694 Ga0495649_0057180 Ga0495649_0057180_717_2018 430
473 3300046794 Ga0495589_0025370 Ga0495589_0025370_165_1463 430
474 3300046810 Ga0495660_0016091 Ga0495660_0016091_2137_3429 430
475 3300046810 Ga0495660_0054831 Ga0495660_0054831_87_1388 430
476 3300047315 Ga0495581_0032916 Ga0495581_0032916_1124_2425 430
477 3300047317 Ga0495604_0023972 Ga0495604_0023972_1768_3069 430
478 3300047322 Ga0495680_0003692 Ga0495680_0003692_7948_9249 430
479 3300047322 Ga0495680_0085442 Ga0495680_0085442_497_1798 430
480 3300047446 Ga0495679_002474 Ga0495679_002474_1130_2422 430
481 3300047446 Ga0495679_003915 Ga0495679_003915_1933_3225 430
482 3300047446 Ga0495679_016379 Ga0495679_016379_202_1500 430
483 3300047469 Ga0495673_0002881 Ga0495673_0002881_1237_2529 430
484 3300047470 Ga0495681_0001577 Ga0495681_0001577_7117_8412 430
485 3300047470 Ga0495681_0002803 Ga0495681_0002803_6254_7555 430
486 3300047470 Ga0495681_0009440 Ga0495681_0009440_2314_3606 430
487 3300047470 Ga0495681_0026779 Ga0495681_0026779_1378_2679 430
488 3300047470 Ga0495681_0030176 Ga0495681_0030176_335_1627 430
489 3300047472 Ga0495686_0007308 Ga0495686_0007308_1238_2539 430
490 3300047673 Ga0495593_0032095 Ga0495593_0032095_963_2264 430
491 3300047673 Ga0495593_0036563 Ga0495593_0036563_840_2141 430
492 3300048917 Ga0496114_0018103 Ga0496114_0018103_4303_5598 430
493 3300048919 Ga0496116_0002819 Ga0496116_0002819_9285_10577 430
494 3300048920 Ga0496117_0000391 Ga0496117_0000391_72321_73616 430
495 3300048920 Ga0496117_0000693 Ga0496117_0000693_44617_45909 430
496 3300048920 Ga0496117_0001466 Ga0496117_0001466_30261_31559 430
497 3300048920 Ga0496117_0003578 Ga0496117_0003578_9518_10810 430
498 3300048920 Ga0496117_0004592 Ga0496117_0004592_6517_7809 430
499 3300048920 Ga0496117_0004735 Ga0496117_0004735_11833_13128 430
500 3300048920 Ga0496117_0008652 Ga0496117_0008652_1944_3236 430
501 3300048920 Ga0496117_0009923 Ga0496117_0009923_5434_6726 430
502 3300048920 Ga0496117_0028614 Ga0496117_0028614_2060_3352 430
503 3300048920 Ga0496117_0039527 Ga0496117_0039527_973_2265 430
504 3300048920 Ga0496117_0049882 Ga0496117_0049882_948_2240 430
505 3300048920 Ga0496117_0054296 Ga0496117_0054296_1150_2445 430
506 3300048921 Ga0496118_0001896 Ga0496118_0001896_26615_27910 430
507 3300048921 Ga0496118_0003081 Ga0496118_0003081_9028_10320 430
508 3300048921 Ga0496118_0009066 Ga0496118_0009066_3606_4898 430
509 3300048921 Ga0496118_0011726 Ga0496118_0011726_6888_8180 430
510 3300048921 Ga0496118_0033981 Ga0496118_0033981_948_2240 430
511 3300048921 Ga0496118_0035976 Ga0496118_0035976_948_2240 430
512 3300048921 Ga0496118_0057054 Ga0496118_0057054_304_1599 430
513 3300048922 Ga0496119_0000016 Ga0496119_0000016_44826_46121 430
514 3300048922 Ga0496119_0000564 Ga0496119_0000564_45101_46393 430
515 3300048922 Ga0496119_0056248 Ga0496119_0056248_88_1380 430
516 3300048922 Ga0496119_0073337 Ga0496119_0073337_438_1736 430
517 3300048923 Ga0496120_0000718 Ga0496120_0000718_18563_19855 430
518 3300048923 Ga0496120_0002909 Ga0496120_0002909_5908_7203 430
519 3300048923 Ga0496120_0005281 Ga0496120_0005281_2492_3784 430
520 3300048923 Ga0496120_0023811 Ga0496120_0023811_222_1520 430
521 3300048924 Ga0496121_0004784 Ga0496121_0004784_9245_10537 430
522 3300048924 Ga0496121_0052261 Ga0496121_0052261_970_2262 430
523 3300048924 Ga0496121_0058302 Ga0496121_0058302_1849_3141 430
524 3300048924 Ga0496121_0100362 Ga0496121_0100362_835_2130 430
525 3300048925 Ga0496122_0002337 Ga0496122_0002337_15719_17011 430
526 3300048925 Ga0496122_0009161 Ga0496122_0009161_7283_8575 430
527 3300048925 Ga0496122_0025649 Ga0496122_0025649_2557_3849 430
528 3300048925 Ga0496122_0058463 Ga0496122_0058463_359_1651 430
529 3300048925 Ga0496122_0070575 Ga0496122_0070575_641_1933 430
530 3300048925 Ga0496122_0071527 Ga0496122_0071527_166_1458 430
531 3300048926 Ga0496123_0000178 Ga0496123_0000178_103308_104600 430
532 3300048926 Ga0496123_0009661 Ga0496123_0009661_5396_6688 430
533 3300048926 Ga0496123_0026944 Ga0496123_0026944_1855_3147 430
534 3300048926 Ga0496123_0048860 Ga0496123_0048860_609_1901 430
535 3300048927 Ga0496124_0001034 Ga0496124_0001034_41093_42388 430
536 3300048927 Ga0496124_0005438 Ga0496124_0005438_5610_6902 430
537 3300048927 Ga0496124_0006006 Ga0496124_0006006_7054_8346 430
538 3300048927 Ga0496124_0006363 Ga0496124_0006363_4192_5484 430
539 3300048927 Ga0496124_0008402 Ga0496124_0008402_8340_9632 430
540 3300048927 Ga0496124_0039823 Ga0496124_0039823_2316_3614 430
541 3300048927 Ga0496124_0048691 Ga0496124_0048691_157_1452 430
542 3300048927 Ga0496124_0054471 Ga0496124_0054471_35_1327 430
543 3300048928 Ga0496125_0000201 Ga0496125_0000201_40235_41530 430
544 3300048928 Ga0496125_0002275 Ga0496125_0002275_7207_8499 430
545 3300048928 Ga0496125_0006131 Ga0496125_0006131_4429_5721 430
546 3300048928 Ga0496125_0006926 Ga0496125_0006926_3985_5277 430
547 3300048928 Ga0496125_0027979 Ga0496125_0027979_2167_3459 430
548 3300048928 Ga0496125_0028759 Ga0496125_0028759_3669_4961 430
549 3300048928 Ga0496125_0036087 Ga0496125_0036087_2059_3351 430
550 3300048928 Ga0496125_0038568 Ga0496125_0038568_2362_3660 430
551 3300048928 Ga0496125_0045564 Ga0496125_0045564_274_1566 430
552 3300048928 Ga0496125_0045826 Ga0496125_0045826_1673_2965 430
553 3300048928 Ga0496125_0057067 Ga0496125_0057067_506_1801 430
554 3300048929 Ga0496126_0015279 Ga0496126_0015279_5531_6823 430
555 3300048929 Ga0496126_0035219 Ga0496126_0035219_3201_4496 430
556 3300048929 Ga0496126_0036198 Ga0496126_0036198_1280_2575 430
557 3300048929 Ga0496126_0046709 Ga0496126_0046709_777_2069 430
558 3300048929 Ga0496126_0145079 Ga0496126_0145079_211_1503 430
559 3300049459 Ga0495678_033627 Ga0495678_033627_374_1675 430
560 3300049571 Ga0501034_0000143 Ga0501034_0000143_14903_16195 430
561 3300053135 Ga0500659_0009689 Ga0500659_0009689_1409_2701 430
562 3300053161 Ga0500634_0014641 Ga0500634_0014641_1074_2366 430
563 iso_pu_bacteria 2511231014 2511315335 430
564 iso_pu_bacteria 2511231015 2511321656 430
565 iso_pu_bacteria 2738543015 2739260515 430
566 iso_pu_bacteria 2904550169 2904551465 430
567 iso_pu_bacteria 2912963787 2912968987 430
568 iso_pu_bacteria 2919493220 2919496827 430
569 iso_pu_bacteria 2919543075 2919546401 430
570 iso_pu_bacteria 2939651529 2939654247 430
571 iso_pu_bacteria 3007855910 3007859299 430
572 3300013104 Ga0157370_10000265 Ga0157370_1000026523 431
573 3300042013 Ga0439456_000217 Ga0439456_000217_2397_3695 431
574 3300047320 Ga0495672_0012642 Ga0495672_0012642_1710_3008 431
575 iso_pu_bacteria 2511231012 2511302001 431
576 iso_pu_bacteria 2511231017 2511335490 431
577 iso_pu_bacteria 2511231020 2511351005 431
578 iso_pu_bacteria 2599185318 2600036086 431
579 iso_pu_bacteria 2643221589 2643956203 431
580 iso_pu_bacteria 2643221602 2644020323 431
581 iso_pu_bacteria 2738543004 2739199161 431
582 iso_pu_bacteria 2939636861 2939640693 431
583 iso_pu_bacteria 3007395558 3007399284 431
584 iso_pu_bacteria 651053060 651174402 431
585 iso_pu_bacteria 8056125926 8056125936 431
586 iso_pu_bacteria 2511231010 2511289911 432
587 iso_pu_bacteria 2511231011 2511294405 432
588 iso_pu_bacteria 2511231023 2511371697 432
589 iso_pu_bacteria 2511231031 2511416532 432
590 iso_pu_bacteria 2600255283 2601627552 432
591 iso_pu_bacteria 2600255318 2601798451 432
592 iso_pu_bacteria 2603880185 2606077345 432
593 iso_pu_bacteria 2603880199 2606129409 432
594 iso_pu_bacteria 2623620443 2624483521 432
595 iso_pu_bacteria 2713897148 2715749728 432
596 iso_pu_bacteria 2713897149 2715754742 432
597 iso_pu_bacteria 2718217725 2718636725 432
598 iso_pu_bacteria 2738541271 2738690451 432
599 iso_pu_bacteria 2738543016 2739266225 432
600 iso_pu_bacteria 2738543020 2739288788 432
601 iso_pu_bacteria 2738543021 2739294100 432
602 iso_pu_bacteria 2738543025 2739312397 432
603 iso_pu_bacteria 2773857673 2774135453 432
604 iso_pu_bacteria 2784132063 2784261706 432
605 iso_pu_bacteria 2818991456 2819655240 432
606 iso_pu_bacteria 2842832357 2842833568 432
607 iso_pu_bacteria 2842843487 2842845792 432
608 iso_pu_bacteria 2844665904 2844670488 432
609 iso_pu_bacteria 2852657418 2852659804 432
610 iso_pu_bacteria 2878029506 2878029520 432
611 iso_pu_bacteria 2880230671 2880236105 432
612 iso_pu_bacteria 2904518522 2904518844 432
613 iso_pu_bacteria 2919063839 2919065404 432
614 iso_pu_bacteria 2919385768 2919389086 432
615 iso_pu_bacteria 2919487758 2919488064 432
616 iso_pu_bacteria 2969304461 2969310313 432
617 iso_pu_bacteria 2974289157 2974293974 432
618 iso_pu_bacteria 2998139840 2998139853 432
619 iso_pu_bacteria 3007614139 3007619434 432
620 iso_pu_bacteria 3007718800 3007719549 432
621 iso_pu_bacteria 3007861166 3007864997 432
622 iso_pu_bacteria 8019769354 8019769661 432
623 iso_pu_bacteria 8029995093 8029995401 432
624 iso_pu_bacteria 8056166840 8056171201 432
625 iso_pu_bacteria 8056172158 8056177307 432
626 iso_pu_bacteria 8056569372 8056570578 432
627 iso_pu_bacteria 8057798959 8057800283 432
628 iso_pu_bacteria 8057798959 8057802052 432
629 3300046452 Ga0495617_017329 Ga0495617_017329_770_2071 433
630 3300046453 Ga0495627_001405 Ga0495627_001405_11011_12312 433
631 3300046460 Ga0495638_0016310 Ga0495638_0016310_2074_3375 433
632 3300046471 Ga0495650_0017550 Ga0495650_0017550_1299_2600 433
633 3300046501 Ga0495607_0039668 Ga0495607_0039668_531_1832 433
634 3300046507 Ga0495606_0087144 Ga0495606_0087144_520_1821 433
635 3300046518 Ga0495631_0003356 Ga0495631_0003356_5777_7078 433
636 3300046519 Ga0495632_0008353 Ga0495632_0008353_1091_2392 433
637 3300046519 Ga0495632_0029030 Ga0495632_0029030_628_1929 433
638 3300046519 Ga0495632_0063631 Ga0495632_0063631_199_1500 433
639 3300046520 Ga0495637_0005039 Ga0495637_0005039_2897_4198 433
640 3300046520 Ga0495637_0012873 Ga0495637_0012873_1176_2477 433
641 3300046530 Ga0495654_0006849 Ga0495654_0006849_3406_4707 433
642 3300046530 Ga0495654_0019743 Ga0495654_0019743_1219_2520 433
643 3300046692 Ga0495671_0007589 Ga0495671_0007589_1028_2329 433
644 3300047320 Ga0495672_0033582 Ga0495672_0033582_235_1536 433
645 iso_pu_bacteria 2511231004 2511252680 433
646 iso_pu_bacteria 2511231006 2511268900 433
647 iso_pu_bacteria 2511231007 2511269986 433
648 iso_pu_bacteria 2511231008 2511279250 433
649 iso_pu_bacteria 2511231016 2511325011 433
650 iso_pu_bacteria 2511231021 2511353649 433
651 iso_pu_bacteria 2511231022 2511364195 433
652 iso_pu_bacteria 2511231156 2511827752 433
653 iso_pu_bacteria 2512047018 2512326562 433
654 iso_pu_bacteria 2554235132 2554818414 433
655 iso_pu_bacteria 2582580891 2583795611 433
656 iso_pu_bacteria 2597489887 2597860995 433
657 iso_pu_bacteria 2599185155 2599327616 433
658 iso_pu_bacteria 2599185185 2599485771 433
659 iso_pu_bacteria 2599185188 2599500368 433
660 iso_pu_bacteria 2599185212 2599615950 433
661 iso_pu_bacteria 2599185248 2599768038 433
662 iso_pu_bacteria 2599185257 2599804550 433
663 iso_pu_bacteria 2599185289 2599885475 433
664 iso_pu_bacteria 2599185291 2599897189 433
665 iso_pu_bacteria 2599185300 2599930609 433
666 iso_pu_bacteria 2599185304 2599954338 433
667 iso_pu_bacteria 2599185305 2599963056 433
668 iso_pu_bacteria 2599185306 2599966053 433
669 iso_pu_bacteria 2599185308 2599977897 433
670 iso_pu_bacteria 2599185309 2599982818 433
671 iso_pu_bacteria 2599185310 2599988431 433
672 iso_pu_bacteria 2599185311 2599994094 433
673 iso_pu_bacteria 2599185312 2599999227 433
674 iso_pu_bacteria 2599185313 2600004201 433
675 iso_pu_bacteria 2599185314 2600012064 433
676 iso_pu_bacteria 2599185315 2600019870 433
677 iso_pu_bacteria 2599185316 2600026173 433
678 iso_pu_bacteria 2599185317 2600031244 433
679 iso_pu_bacteria 2599185319 2600044305 433
680 iso_pu_bacteria 2599185320 2600046757 433
681 iso_pu_bacteria 2599185321 2600054496 433
682 iso_pu_bacteria 2599185322 2600062237 433
683 iso_pu_bacteria 2599185323 2600067918 433
684 iso_pu_bacteria 2599185324 2600071975 433
685 iso_pu_bacteria 2599185325 2600076435 433
686 iso_pu_bacteria 2600254930 2600359531 433
687 iso_pu_bacteria 2600254931 2600363440 433
688 iso_pu_bacteria 2600254954 2600444208 433
689 iso_pu_bacteria 2600255389 2602008313 433
690 iso_pu_bacteria 2606217733 2608385067 433
691 iso_pu_bacteria 2623620446 2624495072 433
692 iso_pu_bacteria 2643221633 2644184365 433
693 iso_pu_bacteria 2643221650 2644283120 433
694 iso_pu_bacteria 2651869719 2652544578 433
695 iso_pu_bacteria 2667528170 2671089662 433
696 iso_pu_bacteria 2667528176 2671128481 433
697 iso_pu_bacteria 2671180172 2671771557 433
698 iso_pu_bacteria 2675903515 2678266255 433
699 iso_pu_bacteria 2738543020 2739287984 433
700 iso_pu_bacteria 2738543021 2739293296 433
701 iso_pu_bacteria 2740892503 2743740535 433
702 iso_pu_bacteria 2744054620 2745007487 433
703 iso_pu_bacteria 2773857670 2774118241 433
704 iso_pu_bacteria 2784132072 2784313705 433
705 iso_pu_bacteria 2791355520 2794593733 433
706 iso_pu_bacteria 2808606361 2808855588 433
707 iso_pu_bacteria 2808606373 2808906156 433
708 iso_pu_bacteria 2808606376 2808926082 433
709 iso_pu_bacteria 2808606378 2808935575 433
710 iso_pu_bacteria 2808606379 2808942208 433
711 iso_pu_bacteria 2808606380 2808948183 433
712 iso_pu_bacteria 2808606383 2808964183 433
713 iso_pu_bacteria 2808606389 2808998981 433
714 iso_pu_bacteria 2811994881 2812369596 433
715 iso_pu_bacteria 2823421272 2823425832 433
716 iso_pu_bacteria 2825651385 2825654960 433
717 iso_pu_bacteria 2826581358 2826582386 433
718 iso_pu_bacteria 2842805378 2842808661 433
719 iso_pu_bacteria 2842815866 2842816962 433
720 iso_pu_bacteria 2842849001 2842852159 433
721 iso_pu_bacteria 2842854478 2842855730 433
722 iso_pu_bacteria 2860339153 2860341840 433
723 iso_pu_bacteria 2913036834 2913042635 433
724 iso_pu_bacteria 2919456309 2919457693 433
725 iso_pu_bacteria 2919481497 2919485764 433
726 iso_pu_bacteria 2919501602 2919502588 433
727 iso_pu_bacteria 2919697872 2919700465 433
728 iso_pu_bacteria 2923153595 2923159628 433
729 iso_pu_bacteria 2923519811 2923523683 433
730 iso_pu_bacteria 2923586266 2923589105 433
731 iso_pu_bacteria 2926063275 2926064261 433
732 iso_pu_bacteria 2929144301 2929150030 433
733 iso_pu_bacteria 2931369376 2931372530 433
734 iso_pu_bacteria 2931396565 2931398224 433
735 iso_pu_bacteria 2984286254 2984286486 433
736 iso_pu_bacteria 2988728565 2988731568 433
737 iso_pu_bacteria 3007252601 3007255678 433
738 iso_pu_bacteria 3007315729 3007320233 433
739 iso_pu_bacteria 3007866637 3007866678 433
740 iso_pu_bacteria 8011350971 8011352186 433
741 iso_pu_bacteria 8015687852 8015693726 433
742 iso_pu_bacteria 8019775933 8019777573 433
743 iso_pu_bacteria 8034962539 8034965160 433
744 iso_pu_bacteria 8055770955 8055776984 433
745 iso_pu_bacteria 8056143049 8056143059 433
746 iso_pu_bacteria 8056155041 8056159817 433
747 3300042013 Ga0439456_000230 Ga0439456_000230_8300_9604 434
748 3300046515 Ga0495620_0020288 Ga0495620_0020288_1053_2357 434
749 3300046616 Ga0495668_0054741 Ga0495668_0054741_562_1866 434
750 3300047469 Ga0495673_0015997 Ga0495673_0015997_1326_2630 434
751 3300009036 Ga0105244_10007074 Ga0105244_100070745 435
752 3300009148 Ga0105243_10023362 Ga0105243_100233624 435
753 3300013104 Ga0157370_10201840 Ga0157370_102018402 435
754 3300014497 Ga0182008_10023001 Ga0182008_100230014 435
755 3300025303 Ga0209051_1009208 Ga0209051_10092083 435
756 3300025728 Ga0207655_1016789 Ga0207655_10167893 435
757 3300025735 Ga0207713_1008038 Ga0207713_10080383 435
758 3300027111 Ga0209281_1000016 Ga0209281_1000016412 435
759 3300027665 Ga0209983_1000420 Ga0209983_10004202 435
760 3300027907 Ga0207428_10020703 Ga0207428_100207034 435
761 3300027907 Ga0207428_10069133 Ga0207428_100691333 435
762 3300027907 Ga0207428_10073243 Ga0207428_100732432 435
763 3300041405 Ga0439438_008831 Ga0439438_008831_1583_2890 435
764 3300041405 Ga0439438_016940 Ga0439438_016940_286_1593 435
765 3300041407 Ga0439447_004837 Ga0439447_004837_1302_2609 435
766 3300042006 Ga0439432_009729 Ga0439432_009729_1415_2722 435
767 3300042010 Ga0439452_007890 Ga0439452_007890_1876_3183 435
768 3300042122 Ga0450920_001883 Ga0450920_001883_2025_3332 435
769 3300042124 Ga0450922_000428 Ga0450922_000428_1866_3173 435
770 3300042145 Ga0450906_002870 Ga0450906_002870_1137_2444 435
771 3300042147 Ga0450910_000496 Ga0450910_000496_1905_3212 435
772 3300042876 Ga0451577_0008829 Ga0451577_0008829_1499_2806 435
773 3300046452 Ga0495617_001186 Ga0495617_001186_7856_9163 435
774 3300046457 Ga0495590_0002297 Ga0495590_0002297_5577_6884 435
775 3300046460 Ga0495638_0033473 Ga0495638_0033473_501_1880 435
776 3300046474 Ga0495605_0002634 Ga0495605_0002634_7879_9186 435
777 3300046506 Ga0495583_0015243 Ga0495583_0015243_964_2271 435
778 3300046512 Ga0495610_0013475 Ga0495610_0013475_3489_4796 435
779 3300046512 Ga0495610_0019927 Ga0495610_0019927_1104_2411 435
780 3300046512 Ga0495610_0021621 Ga0495610_0021621_1161_2468 435
781 3300046515 Ga0495620_0023778 Ga0495620_0023778_560_1867 435
782 3300046524 Ga0495648_0003973 Ga0495648_0003973_4192_5499 435
783 3300046524 Ga0495648_0004380 Ga0495648_0004380_4208_5515 435
784 3300046524 Ga0495648_0044175 Ga0495648_0044175_1128_2435 435
785 3300046528 Ga0495642_0001293 Ga0495642_0001293_7947_9254 435
786 3300046530 Ga0495654_0015858 Ga0495654_0015858_1266_2573 435
787 3300046530 Ga0495654_0021272 Ga0495654_0021272_124_1431 435
788 3300046530 Ga0495654_0021888 Ga0495654_0021888_1148_2455 435
789 3300046530 Ga0495654_0030004 Ga0495654_0030004_535_1842 435
790 3300046542 Ga0495597_0038072 Ga0495597_0038072_815_2122 435
791 3300046616 Ga0495668_0005775 Ga0495668_0005775_1918_3225 435
792 3300046674 Ga0495588_0035206 Ga0495588_0035206_448_1755 435
793 3300046684 Ga0495669_0018475 Ga0495669_0018475_993_2300 435
794 3300046692 Ga0495671_0028266 Ga0495671_0028266_995_2302 435
795 3300046692 Ga0495671_0046395 Ga0495671_0046395_286_1593 435
796 3300046694 Ga0495649_0015776 Ga0495649_0015776_1300_2679 435
797 3300046694 Ga0495649_0021047 Ga0495649_0021047_1013_2320 435
798 3300046694 Ga0495649_0026405 Ga0495649_0026405_1159_2466 435
799 3300046794 Ga0495589_0020689 Ga0495589_0020689_1004_2311 435
800 3300046794 Ga0495589_0029514 Ga0495589_0029514_419_1798 435
801 3300046810 Ga0495660_0082788 Ga0495660_0082788_225_1532 435
802 3300047320 Ga0495672_0017803 Ga0495672_0017803_2440_3747 435
803 3300047320 Ga0495672_0019509 Ga0495672_0019509_1333_2640 435
804 3300047320 Ga0495672_0056873 Ga0495672_0056873_542_1849 435
805 3300047323 Ga0495683_0001936 Ga0495683_0001936_7217_8524 435
806 3300047443 Ga0495687_004868 Ga0495687_004868_2046_3353 435
807 3300047443 Ga0495687_006493 Ga0495687_006493_3407_4714 435
808 3300047469 Ga0495673_0025150 Ga0495673_0025150_751_2058 435
809 3300047470 Ga0495681_0018331 Ga0495681_0018331_1360_2667 435
810 3300048091 Ga0495626_0001637 Ga0495626_0001637_7514_8821 435
811 3300048091 Ga0495626_0014388 Ga0495626_0014388_1837_3144 435
812 3300048919 Ga0496116_0056262 Ga0496116_0056262_518_1825 435
813 3300049459 Ga0495678_011789 Ga0495678_011789_922_2229 435
814 3300049460 Ga0495682_0007806 Ga0495682_0007806_1108_2487 435
815 3300050489 nmdc:mga03683_11726_c2 nmdc:mga03683_11726_c2_299_1606 435
816 iso_pu_bacteria 2728369097 2729146549 435
817 iso_pu_bacteria 640427133 640486437 435
818 2124908027 MRS2a_Contig_772 MRS2a_00629050 436
819 3300003781 Ga0055536_1002554 Ga0055536_100255410 436
820 3300003781 Ga0055536_1002668 Ga0055536_10026688 436
821 3300003791 Ga0055530_10002969 Ga0055530_100029693 436
822 3300003792 Ga0055540_1000304 Ga0055540_100030435 436
823 3300003794 Ga0055531_10001049 Ga0055531_1000104913 436
824 3300005288 Ga0065714_10010936 Ga0065714_100109363 436
825 3300005353 Ga0070669_100000443 Ga0070669_10000044319 436
826 3300005457 Ga0070662_100018119 Ga0070662_1000181191 436
827 3300005548 Ga0070665_100025573 Ga0070665_1000255733 436
828 3300006051 Ga0075364_10064263 Ga0075364_100642632 436
829 3300009011 Ga0105251_10071381 Ga0105251_100713812 436
830 3300009036 Ga0105244_10020823 Ga0105244_100208233 436
831 3300009036 Ga0105244_10068333 Ga0105244_100683331 436
832 3300009036 Ga0105244_10068334 Ga0105244_100683341 436
833 3300009036 Ga0105244_10100062 Ga0105244_101000621 436
834 3300009092 Ga0105250_10002236 Ga0105250_100022368 436
835 3300009092 Ga0105250_10036448 Ga0105250_100364482 436
836 3300009148 Ga0105243_10001894 Ga0105243_100018943 436
837 3300012498 Ga0157345_1000140 Ga0157345_10001407 436
838 3300013100 Ga0157373_10004749 Ga0157373_100047499 436
839 3300013104 Ga0157370_10243054 Ga0157370_102430542 436
840 3300013105 Ga0157369_10011887 Ga0157369_100118873 436
841 3300013306 Ga0163162_10002676 Ga0163162_100026767 436
842 3300013307 Ga0157372_10003275 Ga0157372_1000327512 436
843 3300013308 Ga0157375_10139730 Ga0157375_101397302 436
844 3300014497 Ga0182008_10000177 Ga0182008_100001773 436
845 3300014497 Ga0182008_10017595 Ga0182008_100175953 436
846 3300014497 Ga0182008_10049542 Ga0182008_100495422 436
847 3300015261 Ga0182006_1002537 Ga0182006_10025378 436
848 3300017792 Ga0163161_10005440 Ga0163161_100054406 436
849 3300025291 Ga0209675_1010605 Ga0209675_10106052 436
850 3300025292 Ga0209676_1000015 Ga0209676_1000015308 436
851 3300025292 Ga0209676_1000041 Ga0209676_100004167 436
852 3300025298 Ga0209050_1000030 Ga0209050_1000030130 436
853 3300025303 Ga0209051_1000012 Ga0209051_1000012371 436
854 3300025304 Ga0209257_1000262 Ga0209257_100026255 436
855 3300025711 Ga0207696_1000031 Ga0207696_1000031341 436
856 3300025711 Ga0207696_1000982 Ga0207696_10009823 436
857 3300025711 Ga0207696_1002163 Ga0207696_10021633 436
858 3300025711 Ga0207696_1006618 Ga0207696_10066182 436
859 3300025728 Ga0207655_1001006 Ga0207655_100100617 436
860 3300025728 Ga0207655_1007506 Ga0207655_10075065 436
861 3300025728 Ga0207655_1019393 Ga0207655_10193931 436
862 3300025728 Ga0207655_1028142 Ga0207655_10281423 436
863 3300025728 Ga0207655_1033171 Ga0207655_10331713 436
864 3300025735 Ga0207713_1001718 Ga0207713_100171811 436
865 3300025735 Ga0207713_1016771 Ga0207713_10167713 436
866 3300025735 Ga0207713_1044720 Ga0207713_10447202 436
867 3300025923 Ga0207681_10000919 Ga0207681_1000091914 436
868 3300025933 Ga0207706_10003763 Ga0207706_100037635 436
869 3300025935 Ga0207709_10000061 Ga0207709_10000061162 436
870 3300027111 Ga0209281_1003168 Ga0209281_10031685 436
871 3300028379 Ga0268266_10013641 Ga0268266_100136411 436
872 3300028379 Ga0268266_10193164 Ga0268266_101931642 436
873 3300030734 Ga0316179_1114947 Ga0316179_11149471 436
874 3300030735 Ga0316178_1116522 Ga0316178_11165228 436
875 3300031548 Ga0307408_100002042 Ga0307408_1000020424 436
876 3300031548 Ga0307408_100041439 Ga0307408_1000414391 436
877 3300031730 Ga0307516_10060509 Ga0307516_100605093 436
878 3300031911 Ga0307412_10024458 Ga0307412_100244583 436
879 3300031911 Ga0307412_10046517 Ga0307412_100465173 436
880 3300032004 Ga0307414_10154137 Ga0307414_101541372 436
881 3300033180 Ga0307510_10011676 Ga0307510_100116765 436
882 3300041405 Ga0439438_016183 Ga0439438_016183_42_1352 436
883 3300041407 Ga0439447_008410 Ga0439447_008410_810_2120 436
884 3300042010 Ga0439452_000431 Ga0439452_000431_15090_16445 436
885 3300042016 Ga0439463_000664 Ga0439463_000664_2719_4029 436
886 3300042016 Ga0439463_009210 Ga0439463_009210_688_2043 436
887 3300042115 Ga0450911_000593 Ga0450911_000593_7471_8790 436
888 3300042138 Ga0450903_003253 Ga0450903_003253_417_1736 436
889 3300042139 Ga0450904_001179 Ga0450904_001179_733_2088 436
890 3300042145 Ga0450906_002121 Ga0450906_002121_1497_2852 436
891 3300046452 Ga0495617_011907 Ga0495617_011907_1055_2374 436
892 3300046452 Ga0495617_022863 Ga0495617_022863_728_2038 436
893 3300046453 Ga0495627_001548 Ga0495627_001548_4181_5500 436
894 3300046453 Ga0495627_009288 Ga0495627_009288_1208_2518 436
895 3300046453 Ga0495627_013440 Ga0495627_013440_1001_2311 436
896 3300046457 Ga0495590_0011391 Ga0495590_0011391_930_2240 436
897 3300046458 Ga0495591_003610 Ga0495591_003610_5803_7122 436
898 3300046458 Ga0495591_006629 Ga0495591_006629_1343_2653 436
899 3300046458 Ga0495591_010026 Ga0495591_010026_1127_2437 436
900 3300046458 Ga0495591_011872 Ga0495591_011872_1017_2336 436
901 3300046458 Ga0495591_012542 Ga0495591_012542_934_2253 436
902 3300046458 Ga0495591_015205 Ga0495591_015205_1267_2577 436
903 3300046460 Ga0495638_0031662 Ga0495638_0031662_1111_2430 436
904 3300046463 Ga0495653_0067680 Ga0495653_0067680_42_1352 436
905 3300046471 Ga0495650_0001236 Ga0495650_0001236_7495_8805 436
906 3300046471 Ga0495650_0019168 Ga0495650_0019168_1158_2468 436
907 3300046474 Ga0495605_0028498 Ga0495605_0028498_1124_2434 436
908 3300046491 Ga0495584_0019261 Ga0495584_0019261_1043_2362 436
909 3300046492 Ga0495585_0019809 Ga0495585_0019809_1678_2988 436
910 3300046492 Ga0495585_0023036 Ga0495585_0023036_1106_2416 436
911 3300046492 Ga0495585_0028422 Ga0495585_0028422_748_2058 436
912 3300046500 Ga0495596_0016905 Ga0495596_0016905_194_1513 436
913 3300046500 Ga0495596_0042177 Ga0495596_0042177_244_1554 436
914 3300046501 Ga0495607_0001310 Ga0495607_0001310_13221_14552 436
915 3300046501 Ga0495607_0006315 Ga0495607_0006315_1160_2470 436
916 3300046501 Ga0495607_0026926 Ga0495607_0026926_1260_2579 436
917 3300046501 Ga0495607_0039433 Ga0495607_0039433_1235_2554 436
918 3300046501 Ga0495607_0074332 Ga0495607_0074332_442_1752 436
919 3300046506 Ga0495583_0000896 Ga0495583_0000896_27072_28382 436
920 3300046506 Ga0495583_0003267 Ga0495583_0003267_5835_7166 436
921 3300046506 Ga0495583_0012834 Ga0495583_0012834_1191_2510 436
922 3300046507 Ga0495606_0002158 Ga0495606_0002158_12309_13622 436
923 3300046507 Ga0495606_0004529 Ga0495606_0004529_6977_8287 436
924 3300046507 Ga0495606_0007338 Ga0495606_0007338_7364_8674 436
925 3300046507 Ga0495606_0032452 Ga0495606_0032452_1082_2401 436
926 3300046507 Ga0495606_0057796 Ga0495606_0057796_1052_2362 436
927 3300046507 Ga0495606_0100509 Ga0495606_0100509_126_1445 436
928 3300046512 Ga0495610_0006220 Ga0495610_0006220_5213_6523 436
929 3300046512 Ga0495610_0007028 Ga0495610_0007028_1091_2401 436
930 3300046512 Ga0495610_0013259 Ga0495610_0013259_1314_2633 436
931 3300046513 Ga0495616_0005455 Ga0495616_0005455_5408_6727 436
932 3300046513 Ga0495616_0015002 Ga0495616_0015002_2362_3672 436
933 3300046513 Ga0495616_0022640 Ga0495616_0022640_1062_2372 436
934 3300046513 Ga0495616_0022940 Ga0495616_0022940_1108_2427 436
935 3300046513 Ga0495616_0039730 Ga0495616_0039730_470_1780 436
936 3300046515 Ga0495620_0000602 Ga0495620_0000602_7454_8785 436
937 3300046515 Ga0495620_0000779 Ga0495620_0000779_7229_8539 436
938 3300046515 Ga0495620_0002764 Ga0495620_0002764_7663_8982 436
939 3300046515 Ga0495620_0027696 Ga0495620_0027696_684_2003 436
940 3300046515 Ga0495620_0029897 Ga0495620_0029897_78_1388 436
941 3300046518 Ga0495631_0002951 Ga0495631_0002951_2023_3342 436
942 3300046519 Ga0495632_0004095 Ga0495632_0004095_7600_8919 436
943 3300046519 Ga0495632_0005460 Ga0495632_0005460_3356_4666 436
944 3300046519 Ga0495632_0028575 Ga0495632_0028575_1044_2354 436
945 3300046519 Ga0495632_0030668 Ga0495632_0030668_717_2027 436
946 3300046519 Ga0495632_0053175 Ga0495632_0053175_241_1560 436
947 3300046520 Ga0495637_0000234 Ga0495637_0000234_7513_8823 436
948 3300046520 Ga0495637_0002465 Ga0495637_0002465_7261_8571 436
949 3300046520 Ga0495637_0006981 Ga0495637_0006981_50_1369 436
950 3300046520 Ga0495637_0023844 Ga0495637_0023844_986_2305 436
951 3300046520 Ga0495637_0025087 Ga0495637_0025087_50_1369 436
952 3300046520 Ga0495637_0026815 Ga0495637_0026815_463_1782 436
953 3300046522 Ga0495643_0000382 Ga0495643_0000382_18770_20083 436
954 3300046522 Ga0495643_0008143 Ga0495643_0008143_4355_5668 436
955 3300046522 Ga0495643_0020519 Ga0495643_0020519_1416_2726 436
956 3300046522 Ga0495643_0027293 Ga0495643_0027293_793_2112 436
957 3300046523 Ga0495644_0000865 Ga0495644_0000865_499_1809 436
958 3300046523 Ga0495644_0008836 Ga0495644_0008836_1379_2698 436
959 3300046524 Ga0495648_0000452 Ga0495648_0000452_1691_3004 436
960 3300046524 Ga0495648_0005359 Ga0495648_0005359_1669_3024 436
961 3300046524 Ga0495648_0007583 Ga0495648_0007583_4110_5420 436
962 3300046524 Ga0495648_0027776 Ga0495648_0027776_1221_2531 436
963 3300046524 Ga0495648_0036414 Ga0495648_0036414_1264_2583 436
964 3300046524 Ga0495648_0050296 Ga0495648_0050296_976_2286 436
965 3300046524 Ga0495648_0057040 Ga0495648_0057040_946_2256 436
966 3300046524 Ga0495648_0102286 Ga0495648_0102286_244_1554 436
967 3300046530 Ga0495654_0003698 Ga0495654_0003698_1244_2554 436
968 3300046530 Ga0495654_0017732 Ga0495654_0017732_1126_2436 436
969 3300046530 Ga0495654_0023673 Ga0495654_0023673_64_1374 436
970 3300046530 Ga0495654_0036636 Ga0495654_0036636_593_1912 436
971 3300046530 Ga0495654_0047411 Ga0495654_0047411_770_2080 436
972 3300046530 Ga0495654_0063358 Ga0495654_0063358_106_1425 436
973 3300046538 Ga0495609_0000453 Ga0495609_0000453_27191_28501 436
974 3300046538 Ga0495609_0003975 Ga0495609_0003975_5711_7030 436
975 3300046538 Ga0495609_0012374 Ga0495609_0012374_360_1670 436
976 3300046538 Ga0495609_0014015 Ga0495609_0014015_1124_2443 436
977 3300046538 Ga0495609_0040278 Ga0495609_0040278_172_1491 436
978 3300046542 Ga0495597_0003575 Ga0495597_0003575_2052_3371 436
979 3300046542 Ga0495597_0060164 Ga0495597_0060164_63_1382 436
980 3300046557 Ga0495622_0003731 Ga0495622_0003731_47_1366 436
981 3300046557 Ga0495622_0015700 Ga0495622_0015700_1513_2823 436
982 3300046558 Ga0495633_0015255 Ga0495633_0015255_1471_2781 436
983 3300046616 Ga0495668_0015565 Ga0495668_0015565_2006_3316 436
984 3300046616 Ga0495668_0038011 Ga0495668_0038011_338_1648 436
985 3300046648 Ga0495611_0001237 Ga0495611_0001237_7629_8948 436
986 3300046648 Ga0495611_0001857 Ga0495611_0001857_7476_8786 436
987 3300046660 Ga0495625_0000061 Ga0495625_0000061_170111_171421 436
988 3300046660 Ga0495625_0006962 Ga0495625_0006962_7600_8910 436
989 3300046660 Ga0495625_0039660 Ga0495625_0039660_1558_2868 436
990 3300046660 Ga0495625_0060857 Ga0495625_0060857_1231_2550 436
991 3300046660 Ga0495625_0076939 Ga0495625_0076939_933_2243 436
992 3300046665 Ga0495661_0000356 Ga0495661_0000356_41075_42385 436
993 3300046665 Ga0495661_0034096 Ga0495661_0034096_856_2175 436
994 3300046680 Ga0495646_0044560 Ga0495646_0044560_496_1806 436
995 3300046689 Ga0495613_0073034 Ga0495613_0073034_335_1645 436
996 3300046690 Ga0495624_0024612 Ga0495624_0024612_1961_3271 436
997 3300046691 Ga0495670_0009608 Ga0495670_0009608_1225_2544 436
998 3300046691 Ga0495670_0044402 Ga0495670_0044402_550_1860 436
999 3300046692 Ga0495671_0000831 Ga0495671_0000831_18691_20004 436
1000 3300046692 Ga0495671_0017510 Ga0495671_0017510_952_2271 436
1001 3300046692 Ga0495671_0024154 Ga0495671_0024154_943_2262 436
1002 3300046692 Ga0495671_0030378 Ga0495671_0030378_493_1812 436
1003 3300046694 Ga0495649_0007090 Ga0495649_0007090_1170_2483 436
1004 3300046694 Ga0495649_0011361 Ga0495649_0011361_2862_4175 436
1005 3300046694 Ga0495649_0019995 Ga0495649_0019995_1313_2632 436
1006 3300046694 Ga0495649_0021977 Ga0495649_0021977_2054_3364 436
1007 3300046694 Ga0495649_0022442 Ga0495649_0022442_1059_2378 436
1008 3300046694 Ga0495649_0024342 Ga0495649_0024342_482_1792 436
1009 3300046794 Ga0495589_0003341 Ga0495589_0003341_5643_6962 436
1010 3300046794 Ga0495589_0018112 Ga0495589_0018112_1194_2513 436
1011 3300046809 Ga0495600_0051646 Ga0495600_0051646_501_1811 436
1012 3300046810 Ga0495660_0016866 Ga0495660_0016866_1970_3280 436
1013 3300046810 Ga0495660_0030578 Ga0495660_0030578_664_1983 436
1014 3300046810 Ga0495660_0054263 Ga0495660_0054263_219_1529 436
1015 3300047317 Ga0495604_0060124 Ga0495604_0060124_23_1333 436
1016 3300047320 Ga0495672_0019171 Ga0495672_0019171_1986_3296 436
1017 3300047320 Ga0495672_0040095 Ga0495672_0040095_870_2189 436
1018 3300047321 Ga0495676_0000011 Ga0495676_0000011_7477_8787 436
1019 3300047321 Ga0495676_0040214 Ga0495676_0040214_1223_2542 436
1020 3300047321 Ga0495676_0057316 Ga0495676_0057316_1678_2988 436
1021 3300047322 Ga0495680_0115741 Ga0495680_0115741_576_1886 436
1022 3300047323 Ga0495683_0013037 Ga0495683_0013037_1931_3241 436
1023 3300047323 Ga0495683_0020473 Ga0495683_0020473_721_2040 436
1024 3300047323 Ga0495683_0035728 Ga0495683_0035728_95_1405 436
1025 3300047446 Ga0495679_000028 Ga0495679_000028_13076_14386 436
1026 3300047446 Ga0495679_010995 Ga0495679_010995_1060_2379 436
1027 3300047446 Ga0495679_011890 Ga0495679_011890_910_2229 436
1028 3300047446 Ga0495679_019447 Ga0495679_019447_827_2137 436
1029 3300047469 Ga0495673_0002928 Ga0495673_0002928_2996_4306 436
1030 3300047469 Ga0495673_0004883 Ga0495673_0004883_5851_7170 436
1031 3300047469 Ga0495673_0017046 Ga0495673_0017046_1137_2447 436
1032 3300047469 Ga0495673_0021092 Ga0495673_0021092_867_2177 436
1033 3300047469 Ga0495673_0034470 Ga0495673_0034470_320_1639 436
1034 3300047470 Ga0495681_0001819 Ga0495681_0001819_3833_5143 436
1035 3300047470 Ga0495681_0003177 Ga0495681_0003177_7133_8452 436
1036 3300047470 Ga0495681_0017013 Ga0495681_0017013_2186_3499 436
1037 3300047470 Ga0495681_0019939 Ga0495681_0019939_1094_2413 436
1038 3300047470 Ga0495681_0022191 Ga0495681_0022191_1037_2347 436
1039 3300047470 Ga0495681_0023661 Ga0495681_0023661_1140_2450 436
1040 3300047472 Ga0495686_0018468 Ga0495686_0018468_1550_2860 436
1041 3300047472 Ga0495686_0038352 Ga0495686_0038352_844_2163 436
1042 3300048088 Ga0495602_0050339 Ga0495602_0050339_1851_3161 436
1043 3300048091 Ga0495626_0000024 Ga0495626_0000024_134032_135342 436
1044 3300048091 Ga0495626_0012330 Ga0495626_0012330_485_1804 436
1045 3300048091 Ga0495626_0024030 Ga0495626_0024030_557_1867 436
1046 3300048091 Ga0495626_0028377 Ga0495626_0028377_77_1396 436
1047 3300048091 Ga0495626_0036459 Ga0495626_0036459_993_2312 436
1048 3300048091 Ga0495626_0060977 Ga0495626_0060977_355_1665 436
1049 3300048919 Ga0496116_0007235 Ga0496116_0007235_7414_8724 436
1050 3300048919 Ga0496116_0013490 Ga0496116_0013490_4230_5549 436
1051 3300048919 Ga0496116_0030868 Ga0496116_0030868_1316_2635 436
1052 3300048920 Ga0496117_0013606 Ga0496117_0013606_3500_4831 436
1053 3300048920 Ga0496117_0038813 Ga0496117_0038813_1158_2477 436
1054 3300048920 Ga0496117_0097258 Ga0496117_0097258_488_1807 436
1055 3300048921 Ga0496118_0029398 Ga0496118_0029398_1332_2651 436
1056 3300048921 Ga0496118_0043491 Ga0496118_0043491_1159_2478 436
1057 3300048923 Ga0496120_0084507 Ga0496120_0084507_188_1507 436
1058 3300048924 Ga0496121_0003293 Ga0496121_0003293_14275_15606 436
1059 3300048924 Ga0496121_0054357 Ga0496121_0054357_435_1754 436
1060 3300048925 Ga0496122_0032813 Ga0496122_0032813_2377_3708 436
1061 3300048925 Ga0496122_0057697 Ga0496122_0057697_1153_2508 436
1062 3300048925 Ga0496122_0079331 Ga0496122_0079331_84_1403 436
1063 3300048926 Ga0496123_0035575 Ga0496123_0035575_1217_2572 436
1064 3300048926 Ga0496123_0060981 Ga0496123_0060981_1012_2343 436
1065 3300048927 Ga0496124_0000073 Ga0496124_0000073_210607_211917 436
1066 3300048927 Ga0496124_0009118 Ga0496124_0009118_1323_2654 436
1067 3300048927 Ga0496124_0049432 Ga0496124_0049432_1275_2585 436
1068 3300048928 Ga0496125_0055196 Ga0496125_0055196_88_1407 436
1069 3300049459 Ga0495678_003435 Ga0495678_003435_1129_2439 436
1070 3300049459 Ga0495678_004268 Ga0495678_004268_5424_6743 436
1071 3300049459 Ga0495678_007645 Ga0495678_007645_3749_5059 436
1072 3300049459 Ga0495678_019936 Ga0495678_019936_1130_2440 436
1073 3300049459 Ga0495678_031695 Ga0495678_031695_833_2188 436
1074 3300049460 Ga0495682_0000620 Ga0495682_0000620_14895_16226 436
1075 3300049460 Ga0495682_0008086 Ga0495682_0008086_1263_2573 436
1076 3300049460 Ga0495682_0017975 Ga0495682_0017975_529_1839 436
1077 3300049460 Ga0495682_0037911 Ga0495682_0037911_319_1638 436
1078 3300049758 Ga0501241_002487 Ga0501241_002487_884_2203 436
1079 3300050491 nmdc:mga00v17_54882_c2 nmdc:mga00v17_54882_c2_325_1680 436
1080 3300053111 Ga0500572_003741 Ga0500572_003741_1049_2359 436
1081 2124908027 MRS2a_Contig_6919 MRS2a_00763540 437
1082 2124908027 MRS2a_Contig_826 MRS2a_00679780 437
1083 3300002737 JGI25162J39368_1000473 JGI25162J39368_10004739 437
1084 3300002771 JGI25163J39215_1000741 JGI25163J39215_10007415 437
1085 3300002772 JGI25164J39214_1000323 JGI25164J39214_100032322 437
1086 3300003214 JGI25165J46597_1000599 JGI25165J46597_100059922 437
1087 3300003781 Ga0055536_1000081 Ga0055536_100008174 437
1088 3300003791 Ga0055530_10001391 Ga0055530_100013919 437
1089 3300003792 Ga0055540_1001018 Ga0055540_10010188 437
1090 3300003856 Ga0058692_1011167 Ga0058692_10111671 437
1091 3300005288 Ga0065714_10002290 Ga0065714_1000229026 437
1092 3300005288 Ga0065714_10004145 Ga0065714_100041456 437
1093 3300005288 Ga0065714_10005015 Ga0065714_100050154 437
1094 3300005288 Ga0065714_10065119 Ga0065714_1006511910 437
1095 3300005290 Ga0065712_10002648 Ga0065712_100026482 437
1096 3300006058 Ga0075432_10000334 Ga0075432_100003343 437
1097 3300006058 Ga0075432_10000773 Ga0075432_100007738 437
1098 3300006946 Ga0079104_1000344 Ga0079104_100034449 437
1099 3300006948 Ga0099826_10012111 Ga0099826_100121114 437
1100 3300009011 Ga0105251_10002300 Ga0105251_100023009 437
1101 3300009036 Ga0105244_10000139 Ga0105244_1000013910 437
1102 3300009036 Ga0105244_10007197 Ga0105244_100071974 437
1103 3300009148 Ga0105243_10013524 Ga0105243_100135244 437
1104 3300011119 Ga0105246_10000963 Ga0105246_1000096311 437
1105 3300011119 Ga0105246_10015157 Ga0105246_100151574 437
1106 3300013100 Ga0157373_10005232 Ga0157373_100052323 437
1107 3300013100 Ga0157373_10053420 Ga0157373_100534202 437
1108 3300013102 Ga0157371_10002295 Ga0157371_100022959 437
1109 3300013104 Ga0157370_10145356 Ga0157370_101453562 437
1110 3300013104 Ga0157370_10189007 Ga0157370_101890072 437
1111 3300013306 Ga0163162_10056436 Ga0163162_100564364 437
1112 3300014497 Ga0182008_10015053 Ga0182008_100150534 437
1113 3300015261 Ga0182006_1001181 Ga0182006_10011819 437
1114 3300015261 Ga0182006_1006107 Ga0182006_10061074 437
1115 3300015262 Ga0182007_10018153 Ga0182007_100181533 437
1116 3300015265 Ga0182005_1000664 Ga0182005_100066410 437
1117 3300015265 Ga0182005_1018694 Ga0182005_10186942 437
1118 3300025207 Ga0209760_100027 Ga0209760_1000275 437
1119 3300025231 Ga0207427_100006 Ga0207427_100006337 437
1120 3300025233 Ga0209437_100013 Ga0209437_100013337 437
1121 3300025261 Ga0209233_1000022 Ga0209233_1000022337 437
1122 3300025292 Ga0209676_1000030 Ga0209676_1000030380 437
1123 3300025292 Ga0209676_1004777 Ga0209676_10047774 437
1124 3300025298 Ga0209050_1000024 Ga0209050_100002461 437
1125 3300025298 Ga0209050_1000332 Ga0209050_100033274 437
1126 3300025303 Ga0209051_1000660 Ga0209051_10006609 437
1127 3300025303 Ga0209051_1000672 Ga0209051_10006729 437
1128 3300025711 Ga0207696_1001880 Ga0207696_10018805 437
1129 3300025711 Ga0207696_1001924 Ga0207696_10019249 437
1130 3300025728 Ga0207655_1000785 Ga0207655_100078527 437
1131 3300025728 Ga0207655_1003871 Ga0207655_10038719 437
1132 3300025728 Ga0207655_1006458 Ga0207655_10064584 437
1133 3300025728 Ga0207655_1023693 Ga0207655_10236933 437
1134 3300025735 Ga0207713_1000784 Ga0207713_100078426 437
1135 3300025735 Ga0207713_1001349 Ga0207713_100134915 437
1136 3300025935 Ga0207709_10016447 Ga0207709_100164474 437
1137 3300027111 Ga0209281_1000019 Ga0209281_1000019115 437
1138 3300027312 Ga0209371_1000228 Ga0209371_100022860 437
1139 3300027907 Ga0207428_10020685 Ga0207428_100206853 437
1140 3300030500 Ga0268256_1000188 Ga0268256_100018819 437
1141 3300030742 Ga0316183_1208517 Ga0316183_12085173 437
1142 3300030744 Ga0316181_1047742 Ga0316181_10477427 437
1143 3300031548 Ga0307408_100001670 Ga0307408_10000167011 437
1144 3300031548 Ga0307408_100002990 Ga0307408_1000029901 437
1145 3300031548 Ga0307408_100021267 Ga0307408_1000212672 437
1146 3300031731 Ga0307405_10000558 Ga0307405_1000055812 437
1147 3300031731 Ga0307405_10001502 Ga0307405_100015023 437
1148 3300031731 Ga0307405_10014768 Ga0307405_100147683 437
1149 3300031901 Ga0307406_10084995 Ga0307406_100849953 437
1150 3300031903 Ga0307407_10003064 Ga0307407_100030644 437
1151 3300031911 Ga0307412_10001108 Ga0307412_1000110810 437
1152 3300031911 Ga0307412_10010757 Ga0307412_100107573 437
1153 3300031911 Ga0307412_10013568 Ga0307412_100135683 437
1154 3300031995 Ga0307409_100011629 Ga0307409_1000116294 437
1155 3300032002 Ga0307416_100010057 Ga0307416_1000100574 437
1156 3300032002 Ga0307416_100043412 Ga0307416_1000434124 437
1157 3300032004 Ga0307414_10018757 Ga0307414_100187575 437
1158 3300032004 Ga0307414_10029138 Ga0307414_100291382 437
1159 3300032005 Ga0307411_10007715 Ga0307411_100077153 437
1160 3300032005 Ga0307411_10136977 Ga0307411_101369771 437
1161 3300041404 Ga0439436_0000209 Ga0439436_0000209_3562_4884 437
1162 3300041405 Ga0439438_001540 Ga0439438_001540_7725_9038 437
1163 3300041405 Ga0439438_002122 Ga0439438_002122_1068_2381 437
1164 3300041405 Ga0439438_002508 Ga0439438_002508_5591_6904 437
1165 3300041405 Ga0439438_005241 Ga0439438_005241_1986_3308 437
1166 3300041405 Ga0439438_006909 Ga0439438_006909_294_1607 437
1167 3300041407 Ga0439447_001667 Ga0439447_001667_1248_2561 437
1168 3300041407 Ga0439447_002742 Ga0439447_002742_4026_5339 437
1169 3300041407 Ga0439447_025954 Ga0439447_025954_78_1391 437
1170 3300041407 Ga0439447_025956 Ga0439447_025956_65_1387 437
1171 3300041411 Ga0439466_0000196 Ga0439466_0000196_21682_23004 437
1172 3300041411 Ga0439466_0001640 Ga0439466_0001640_1035_2348 437
1173 3300041411 Ga0439466_0001877 Ga0439466_0001877_6469_7782 437
1174 3300041411 Ga0439466_0007333 Ga0439466_0007333_530_1843 437
1175 3300041411 Ga0439466_0008160 Ga0439466_0008160_2605_3927 437
1176 3300041413 Ga0439465_0007730 Ga0439465_0007730_441_1763 437
1177 3300042006 Ga0439432_001275 Ga0439432_001275_3961_5274 437
1178 3300042006 Ga0439432_002030 Ga0439432_002030_6104_7426 437
1179 3300042006 Ga0439432_002901 Ga0439432_002901_1995_3317 437
1180 3300042006 Ga0439432_012525 Ga0439432_012525_828_2141 437
1181 3300042006 Ga0439432_020332 Ga0439432_020332_139_1452 437
1182 3300042009 Ga0439451_000263 Ga0439451_000263_72_1394 437
1183 3300042009 Ga0439451_000612 Ga0439451_000612_5398_6720 437
1184 3300042009 Ga0439451_012527 Ga0439451_012527_53_1375 437
1185 3300042010 Ga0439452_000432 Ga0439452_000432_3350_4663 437
1186 3300042010 Ga0439452_001055 Ga0439452_001055_5586_6899 437
1187 3300042010 Ga0439452_001508 Ga0439452_001508_1538_2851 437
1188 3300042010 Ga0439452_002404 Ga0439452_002404_72_1394 437
1189 3300042010 Ga0439452_003176 Ga0439452_003176_2400_3722 437
1190 3300042010 Ga0439452_011136 Ga0439452_011136_1045_2358 437
1191 3300042010 Ga0439452_025141 Ga0439452_025141_121_1443 437
1192 3300042013 Ga0439456_003818 Ga0439456_003818_1183_2505 437
1193 3300042013 Ga0439456_004841 Ga0439456_004841_350_1663 437
1194 3300042013 Ga0439456_005410 Ga0439456_005410_1020_2342 437
1195 3300042016 Ga0439463_000844 Ga0439463_000844_3452_4774 437
1196 3300042016 Ga0439463_000897 Ga0439463_000897_5778_7100 437
1197 3300042115 Ga0450911_001546 Ga0450911_001546_1766_3088 437
1198 3300042121 Ga0450919_000016 Ga0450919_000016_1983_3305 437
1199 3300042124 Ga0450922_000700 Ga0450922_000700_794_2107 437
1200 3300042124 Ga0450922_001832 Ga0450922_001832_75_1397 437
1201 3300042127 Ga0450890_000105 Ga0450890_000105_11959_13272 437
1202 3300042137 Ga0450902_003347 Ga0450902_003347_24_1337 437
1203 3300042138 Ga0450903_003125 Ga0450903_003125_1298_2620 437
1204 3300042139 Ga0450904_000705 Ga0450904_000705_2547_3881 437
1205 3300042145 Ga0450906_000291 Ga0450906_000291_3486_4808 437
1206 3300042146 Ga0450907_000099 Ga0450907_000099_8008_9321 437
1207 3300042146 Ga0450907_001296 Ga0450907_001296_245_1567 437
1208 3300042156 Ga0439446_0000434 Ga0439446_0000434_4846_6159 437
1209 3300042156 Ga0439446_0001439 Ga0439446_0001439_2952_4274 437
1210 3300042156 Ga0439446_0004699 Ga0439446_0004699_197_1519 437
1211 3300042184 Ga0450908_000465 Ga0450908_000465_1163_2485 437
1212 3300042185 Ga0450909_000144 Ga0450909_000144_3810_5132 437
1213 3300042435 Ga0439434_0000131 Ga0439434_0000131_13276_14589 437
1214 3300042435 Ga0439434_0002096 Ga0439434_0002096_2353_3675 437
1215 3300042435 Ga0439434_0018685 Ga0439434_0018685_110_1432 437
1216 3300042439 Ga0439464_0004808 Ga0439464_0004808_1096_2418 437
1217 3300042439 Ga0439464_0006464 Ga0439464_0006464_1153_2466 437
1218 3300042461 Ga0439460_0000031 Ga0439460_0000031_10196_11518 437
1219 3300042531 Ga0450918_002222 Ga0450918_002222_1155_2477 437
1220 3300042532 Ga0450893_0001104 Ga0450893_0001104_531_1865 437
1221 3300042993 Ga0439440_0000059 Ga0439440_0000059_1977_3299 437
1222 3300042993 Ga0439440_0006168 Ga0439440_0006168_779_2092 437
1223 3300042993 Ga0439440_0016130 Ga0439440_0016130_100_1413 437
1224 3300046452 Ga0495617_005421 Ga0495617_005421_1083_2396 437
1225 3300046452 Ga0495617_007723 Ga0495617_007723_1805_3118 437
1226 3300046452 Ga0495617_010220 Ga0495617_010220_797_2110 437
1227 3300046452 Ga0495617_022294 Ga0495617_022294_228_1541 437
1228 3300046455 Ga0495603_0002844 Ga0495603_0002844_4516_5829 437
1229 3300046455 Ga0495603_0027341 Ga0495603_0027341_513_1826 437
1230 3300046455 Ga0495603_0108129 Ga0495603_0108129_226_1539 437
1231 3300046457 Ga0495590_0011875 Ga0495590_0011875_902_2215 437
1232 3300046458 Ga0495591_000164 Ga0495591_000164_61910_63223 437
1233 3300046458 Ga0495591_002516 Ga0495591_002516_1244_2557 437
1234 3300046458 Ga0495591_014173 Ga0495591_014173_593_1906 437
1235 3300046458 Ga0495591_017502 Ga0495591_017502_95_1408 437
1236 3300046458 Ga0495591_020452 Ga0495591_020452_863_2176 437
1237 3300046458 Ga0495591_024684 Ga0495591_024684_258_1571 437
1238 3300046460 Ga0495638_0004365 Ga0495638_0004365_7473_8786 437
1239 3300046460 Ga0495638_0031947 Ga0495638_0031947_577_1890 437
1240 3300046460 Ga0495638_0037741 Ga0495638_0037741_612_1925 437
1241 3300046460 Ga0495638_0058866 Ga0495638_0058866_173_1486 437
1242 3300046460 Ga0495638_0064911 Ga0495638_0064911_187_1500 437
1243 3300046463 Ga0495653_0002141 Ga0495653_0002141_1801_3114 437
1244 3300046463 Ga0495653_0058239 Ga0495653_0058239_667_1980 437
1245 3300046463 Ga0495653_0090950 Ga0495653_0090950_212_1525 437
1246 3300046471 Ga0495650_0005323 Ga0495650_0005323_5234_6547 437
1247 3300046471 Ga0495650_0012694 Ga0495650_0012694_1503_2816 437
1248 3300046471 Ga0495650_0019487 Ga0495650_0019487_490_1875 437
1249 3300046471 Ga0495650_0021364 Ga0495650_0021364_858_2171 437
1250 3300046471 Ga0495650_0021672 Ga0495650_0021672_1035_2348 437
1251 3300046474 Ga0495605_0000319 Ga0495605_0000319_2944_4257 437
1252 3300046474 Ga0495605_0003081 Ga0495605_0003081_59_1444 437
1253 3300046474 Ga0495605_0029337 Ga0495605_0029337_440_1753 437
1254 3300046474 Ga0495605_0050481 Ga0495605_0050481_105_1418 437
1255 3300046474 Ga0495605_0056382 Ga0495605_0056382_408_1721 437
1256 3300046491 Ga0495584_0001139 Ga0495584_0001139_4168_5553 437
1257 3300046491 Ga0495584_0008518 Ga0495584_0008518_2252_3565 437
1258 3300046491 Ga0495584_0009681 Ga0495584_0009681_1588_2901 437
1259 3300046491 Ga0495584_0010909 Ga0495584_0010909_1364_2677 437
1260 3300046491 Ga0495584_0070800 Ga0495584_0070800_343_1656 437
1261 3300046492 Ga0495585_0004605 Ga0495585_0004605_5546_6859 437
1262 3300046492 Ga0495585_0016595 Ga0495585_0016595_1911_3224 437
1263 3300046492 Ga0495585_0026429 Ga0495585_0026429_1014_2327 437
1264 3300046492 Ga0495585_0032470 Ga0495585_0032470_780_2093 437
1265 3300046499 Ga0495594_0045888 Ga0495594_0045888_834_2147 437
1266 3300046499 Ga0495594_0062171 Ga0495594_0062171_131_1444 437
1267 3300046500 Ga0495596_0000889 Ga0495596_0000889_14892_16205 437
1268 3300046501 Ga0495607_0000268 Ga0495607_0000268_47324_48637 437
1269 3300046501 Ga0495607_0000762 Ga0495607_0000762_21422_22735 437
1270 3300046501 Ga0495607_0001456 Ga0495607_0001456_7653_9038 437
1271 3300046501 Ga0495607_0018596 Ga0495607_0018596_1863_3176 437
1272 3300046501 Ga0495607_0024734 Ga0495607_0024734_1417_2730 437
1273 3300046501 Ga0495607_0031738 Ga0495607_0031738_820_2133 437
1274 3300046501 Ga0495607_0074348 Ga0495607_0074348_469_1782 437
1275 3300046506 Ga0495583_0005506 Ga0495583_0005506_5357_6670 437
1276 3300046506 Ga0495583_0020637 Ga0495583_0020637_1264_2577 437
1277 3300046507 Ga0495606_0020957 Ga0495606_0020957_1287_2600 437
1278 3300046507 Ga0495606_0034279 Ga0495606_0034279_961_2274 437
1279 3300046507 Ga0495606_0069402 Ga0495606_0069402_311_1624 437
1280 3300046512 Ga0495610_0006307 Ga0495610_0006307_1088_2401 437
1281 3300046512 Ga0495610_0016703 Ga0495610_0016703_1789_3102 437
1282 3300046512 Ga0495610_0042269 Ga0495610_0042269_689_2002 437
1283 3300046513 Ga0495616_0001510 Ga0495616_0001510_5630_7015 437
1284 3300046513 Ga0495616_0006028 Ga0495616_0006028_4922_6235 437
1285 3300046513 Ga0495616_0024427 Ga0495616_0024427_1382_2695 437
1286 3300046513 Ga0495616_0036103 Ga0495616_0036103_929_2242 437
1287 3300046515 Ga0495620_0005805 Ga0495620_0005805_2862_4175 437
1288 3300046515 Ga0495620_0005943 Ga0495620_0005943_4141_5454 437
1289 3300046518 Ga0495631_0002297 Ga0495631_0002297_7376_8689 437
1290 3300046518 Ga0495631_0047547 Ga0495631_0047547_505_1818 437
1291 3300046519 Ga0495632_0000902 Ga0495632_0000902_13836_15221 437
1292 3300046519 Ga0495632_0003822 Ga0495632_0003822_7956_9269 437
1293 3300046519 Ga0495632_0003845 Ga0495632_0003845_8215_9528 437
1294 3300046519 Ga0495632_0010599 Ga0495632_0010599_1995_3308 437
1295 3300046519 Ga0495632_0012697 Ga0495632_0012697_1471_2784 437
1296 3300046519 Ga0495632_0014447 Ga0495632_0014447_1590_2903 437
1297 3300046520 Ga0495637_0004255 Ga0495637_0004255_4880_6193 437
1298 3300046520 Ga0495637_0007815 Ga0495637_0007815_1714_3027 437
1299 3300046520 Ga0495637_0010171 Ga0495637_0010171_657_1970 437
1300 3300046520 Ga0495637_0011226 Ga0495637_0011226_2000_3322 437
1301 3300046520 Ga0495637_0011854 Ga0495637_0011854_1978_3429 437
1302 3300046520 Ga0495637_0021107 Ga0495637_0021107_1632_2945 437
1303 3300046520 Ga0495637_0024067 Ga0495637_0024067_83_1396 437
1304 3300046520 Ga0495637_0026935 Ga0495637_0026935_575_1894 437
1305 3300046522 Ga0495643_0000202 Ga0495643_0000202_65171_66493 437
1306 3300046522 Ga0495643_0026045 Ga0495643_0026045_57_1379 437
1307 3300046522 Ga0495643_0034115 Ga0495643_0034115_59_1444 437
1308 3300046522 Ga0495643_0034779 Ga0495643_0034779_452_1765 437
1309 3300046522 Ga0495643_0037884 Ga0495643_0037884_1031_2344 437
1310 3300046522 Ga0495643_0059159 Ga0495643_0059159_311_1624 437
1311 3300046522 Ga0495643_0061014 Ga0495643_0061014_389_1702 437
1312 3300046523 Ga0495644_0000944 Ga0495644_0000944_981_2294 437
1313 3300046523 Ga0495644_0002842 Ga0495644_0002842_2087_3400 437
1314 3300046523 Ga0495644_0009119 Ga0495644_0009119_1379_2692 437
1315 3300046524 Ga0495648_0020124 Ga0495648_0020124_1244_2557 437
1316 3300046524 Ga0495648_0021676 Ga0495648_0021676_1101_2414 437
1317 3300046524 Ga0495648_0027627 Ga0495648_0027627_879_2201 437
1318 3300046524 Ga0495648_0051137 Ga0495648_0051137_405_1718 437
1319 3300046524 Ga0495648_0057611 Ga0495648_0057611_601_1914 437
1320 3300046524 Ga0495648_0061608 Ga0495648_0061608_139_1452 437
1321 3300046524 Ga0495648_0096088 Ga0495648_0096088_115_1500 437
1322 3300046526 Ga0495666_0037661 Ga0495666_0037661_828_2141 437
1323 3300046528 Ga0495642_0000195 Ga0495642_0000195_8479_9792 437
1324 3300046528 Ga0495642_0001107 Ga0495642_0001107_812_2197 437
1325 3300046530 Ga0495654_0003040 Ga0495654_0003040_7359_8672 437
1326 3300046530 Ga0495654_0008904 Ga0495654_0008904_1295_2680 437
1327 3300046530 Ga0495654_0009824 Ga0495654_0009824_311_1624 437
1328 3300046530 Ga0495654_0014368 Ga0495654_0014368_2176_3489 437
1329 3300046530 Ga0495654_0040109 Ga0495654_0040109_572_1885 437
1330 3300046530 Ga0495654_0040180 Ga0495654_0040180_682_1995 437
1331 3300046538 Ga0495609_0003663 Ga0495609_0003663_5589_6974 437
1332 3300046542 Ga0495597_0000121 Ga0495597_0000121_61974_63287 437
1333 3300046542 Ga0495597_0024797 Ga0495597_0024797_1171_2484 437
1334 3300046542 Ga0495597_0038565 Ga0495597_0038565_723_2036 437
1335 3300046542 Ga0495597_0071701 Ga0495597_0071701_146_1459 437
1336 3300046615 Ga0495656_0015058 Ga0495656_0015058_1354_2667 437
1337 3300046616 Ga0495668_0004162 Ga0495668_0004162_1791_3104 437
1338 3300046616 Ga0495668_0020639 Ga0495668_0020639_350_1663 437
1339 3300046642 Ga0495634_0001603 Ga0495634_0001603_7528_8841 437
1340 3300046648 Ga0495611_0018966 Ga0495611_0018966_530_1915 437
1341 3300046660 Ga0495625_0009246 Ga0495625_0009246_1301_2614 437
1342 3300046660 Ga0495625_0010546 Ga0495625_0010546_6144_7466 437
1343 3300046660 Ga0495625_0032946 Ga0495625_0032946_1355_2668 437
1344 3300046663 Ga0495635_0005130 Ga0495635_0005130_2140_3453 437
1345 3300046664 Ga0495659_0000905 Ga0495659_0000905_1845_3158 437
1346 3300046664 Ga0495659_0002360 Ga0495659_0002360_4560_5873 437
1347 3300046664 Ga0495659_0017480 Ga0495659_0017480_392_1777 437
1348 3300046665 Ga0495661_0027223 Ga0495661_0027223_1339_2652 437
1349 3300046665 Ga0495661_0032076 Ga0495661_0032076_1748_3061 437
1350 3300046665 Ga0495661_0047062 Ga0495661_0047062_1075_2388 437
1351 3300046665 Ga0495661_0114221 Ga0495661_0114221_131_1444 437
1352 3300046674 Ga0495588_0007883 Ga0495588_0007883_3147_4460 437
1353 3300046675 Ga0495657_0065244 Ga0495657_0065244_635_1948 437
1354 3300046679 Ga0495623_0030677 Ga0495623_0030677_821_2134 437
1355 3300046679 Ga0495623_0061475 Ga0495623_0061475_97_1410 437
1356 3300046684 Ga0495669_0024082 Ga0495669_0024082_1089_2402 437
1357 3300046691 Ga0495670_0000936 Ga0495670_0000936_11239_12552 437
1358 3300046691 Ga0495670_0019579 Ga0495670_0019579_1208_2521 437
1359 3300046691 Ga0495670_0031152 Ga0495670_0031152_368_1681 437
1360 3300046691 Ga0495670_0034238 Ga0495670_0034238_382_1704 437
1361 3300046692 Ga0495671_0000523 Ga0495671_0000523_17619_18941 437
1362 3300046692 Ga0495671_0001233 Ga0495671_0001233_7483_8805 437
1363 3300046692 Ga0495671_0005417 Ga0495671_0005417_1248_2561 437
1364 3300046692 Ga0495671_0051228 Ga0495671_0051228_233_1546 437
1365 3300046694 Ga0495649_0000391 Ga0495649_0000391_9791_11176 437
1366 3300046694 Ga0495649_0004173 Ga0495649_0004173_849_2171 437
1367 3300046694 Ga0495649_0015829 Ga0495649_0015829_1196_2509 437
1368 3300046694 Ga0495649_0023674 Ga0495649_0023674_997_2310 437
1369 3300046694 Ga0495649_0030686 Ga0495649_0030686_783_2105 437
1370 3300046694 Ga0495649_0033554 Ga0495649_0033554_614_1936 437
1371 3300046694 Ga0495649_0062909 Ga0495649_0062909_602_1915 437
1372 3300046694 Ga0495649_0093992 Ga0495649_0093992_107_1420 437
1373 3300046794 Ga0495589_0000623 Ga0495589_0000623_12488_13873 437
1374 3300046794 Ga0495589_0018616 Ga0495589_0018616_997_2310 437
1375 3300046794 Ga0495589_0030037 Ga0495589_0030037_1237_2550 437
1376 3300046810 Ga0495660_0000813 Ga0495660_0000813_14272_15585 437
1377 3300046810 Ga0495660_0001072 Ga0495660_0001072_4099_5412 437
1378 3300046810 Ga0495660_0017059 Ga0495660_0017059_1759_3072 437
1379 3300046810 Ga0495660_0030959 Ga0495660_0030959_925_2238 437
1380 3300046810 Ga0495660_0035800 Ga0495660_0035800_629_1942 437
1381 3300046810 Ga0495660_0102189 Ga0495660_0102189_60_1382 437
1382 3300047315 Ga0495581_0026005 Ga0495581_0026005_1226_2539 437
1383 3300047317 Ga0495604_0010283 Ga0495604_0010283_1819_3132 437
1384 3300047317 Ga0495604_0070477 Ga0495604_0070477_428_1741 437
1385 3300047318 Ga0495636_0004764 Ga0495636_0004764_3559_4944 437
1386 3300047319 Ga0495674_0036832 Ga0495674_0036832_1841_3154 437
1387 3300047320 Ga0495672_0001713 Ga0495672_0001713_12046_13431 437
1388 3300047320 Ga0495672_0006772 Ga0495672_0006772_1076_2389 437
1389 3300047320 Ga0495672_0008160 Ga0495672_0008160_4977_6290 437
1390 3300047320 Ga0495672_0010811 Ga0495672_0010811_411_1724 437
1391 3300047320 Ga0495672_0028127 Ga0495672_0028127_2119_3432 437
1392 3300047320 Ga0495672_0044618 Ga0495672_0044618_1247_2560 437
1393 3300047321 Ga0495676_0018322 Ga0495676_0018322_522_1835 437
1394 3300047322 Ga0495680_0020550 Ga0495680_0020550_1486_2799 437
1395 3300047323 Ga0495683_0000055 Ga0495683_0000055_110593_111906 437
1396 3300047323 Ga0495683_0002474 Ga0495683_0002474_7587_8900 437
1397 3300047323 Ga0495683_0019923 Ga0495683_0019923_892_2205 437
1398 3300047323 Ga0495683_0027209 Ga0495683_0027209_571_1884 437
1399 3300047323 Ga0495683_0033597 Ga0495683_0033597_926_2248 437
1400 3300047323 Ga0495683_0038596 Ga0495683_0038596_916_2229 437
1401 3300047323 Ga0495683_0060205 Ga0495683_0060205_189_1502 437
1402 3300047443 Ga0495687_001949 Ga0495687_001949_12006_13391 437
1403 3300047443 Ga0495687_007391 Ga0495687_007391_652_1965 437
1404 3300047444 Ga0495675_0114547 Ga0495675_0114547_30_1343 437
1405 3300047445 Ga0495677_0006695 Ga0495677_0006695_1204_2517 437
1406 3300047446 Ga0495679_012627 Ga0495679_012627_1121_2434 437
1407 3300047446 Ga0495679_016337 Ga0495679_016337_77_1390 437
1408 3300047447 Ga0495685_009090 Ga0495685_009090_516_1901 437
1409 3300047469 Ga0495673_0002787 Ga0495673_0002787_888_2201 437
1410 3300047469 Ga0495673_0003210 Ga0495673_0003210_7327_8640 437
1411 3300047469 Ga0495673_0017983 Ga0495673_0017983_1661_2974 437
1412 3300047469 Ga0495673_0029015 Ga0495673_0029015_903_2216 437
1413 3300047469 Ga0495673_0031018 Ga0495673_0031018_316_1629 437
1414 3300047469 Ga0495673_0031900 Ga0495673_0031900_390_1703 437
1415 3300047470 Ga0495681_0002096 Ga0495681_0002096_12105_13418 437
1416 3300047470 Ga0495681_0006194 Ga0495681_0006194_1089_2402 437
1417 3300047470 Ga0495681_0013400 Ga0495681_0013400_1542_2864 437
1418 3300047470 Ga0495681_0023884 Ga0495681_0023884_1719_3032 437
1419 3300047470 Ga0495681_0029554 Ga0495681_0029554_376_1761 437
1420 3300047471 Ga0495684_0086477 Ga0495684_0086477_726_2039 437
1421 3300047472 Ga0495686_0028199 Ga0495686_0028199_795_2108 437
1422 3300047673 Ga0495593_0024794 Ga0495593_0024794_1533_2846 437
1423 3300047673 Ga0495593_0026184 Ga0495593_0026184_780_2093 437
1424 3300048091 Ga0495626_0002640 Ga0495626_0002640_10816_12129 437
1425 3300048091 Ga0495626_0002807 Ga0495626_0002807_8129_9442 437
1426 3300048091 Ga0495626_0003080 Ga0495626_0003080_2052_3365 437
1427 3300048091 Ga0495626_0003418 Ga0495626_0003418_1485_2798 437
1428 3300048091 Ga0495626_0020772 Ga0495626_0020772_1177_2490 437
1429 3300048905 Ga0496102_0001804 Ga0496102_0001804_7564_8877 437
1430 3300048906 Ga0496103_0016839 Ga0496103_0016839_1813_3126 437
1431 3300048910 Ga0496107_0100991 Ga0496107_0100991_207_1520 437
1432 3300048914 Ga0496111_0140402 Ga0496111_0140402_145_1458 437
1433 3300048919 Ga0496116_0001804 Ga0496116_0001804_14998_16311 437
1434 3300048920 Ga0496117_0023769 Ga0496117_0023769_1514_2827 437
1435 3300048921 Ga0496118_0042757 Ga0496118_0042757_779_2092 437
1436 3300048921 Ga0496118_0056636 Ga0496118_0056636_937_2250 437
1437 3300048924 Ga0496121_0072805 Ga0496121_0072805_1039_2352 437
1438 3300048925 Ga0496122_0032284 Ga0496122_0032284_1138_2451 437
1439 3300048927 Ga0496124_0010734 Ga0496124_0010734_2068_3381 437
1440 3300048927 Ga0496124_0056014 Ga0496124_0056014_842_2155 437
1441 3300048927 Ga0496124_0067741 Ga0496124_0067741_1058_2371 437
1442 3300048928 Ga0496125_0030596 Ga0496125_0030596_1442_2755 437
1443 3300048928 Ga0496125_0057767 Ga0496125_0057767_1056_2369 437
1444 3300049459 Ga0495678_001969 Ga0495678_001969_10795_12180 437
1445 3300049459 Ga0495678_008771 Ga0495678_008771_3600_4913 437
1446 3300049459 Ga0495678_016342 Ga0495678_016342_414_1727 437
1447 3300049459 Ga0495678_018980 Ga0495678_018980_700_2022 437
1448 3300049460 Ga0495682_0023806 Ga0495682_0023806_69_1382 437
1449 3300049569 Ga0501032_0121317 Ga0501032_0121317_199_1521 437
1450 3300049571 Ga0501034_0108804 Ga0501034_0108804_1311_2633 437
1451 3300049853 Ga0501226_000049 Ga0501226_000049_35684_37018 437
1452 3300049853 Ga0501226_001205 Ga0501226_001205_1043_2356 437

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01494

FAD_binding_3

FAD binding domain

37

81

0.94

PF00890

FAD_binding_2

FAD binding domain

39

83

0.92

PF01266

DAO

FAD dependent oxidoreductase

39

389

0.89

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

42

101

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gg2-assembly1.cif.gz_D crystal structure of udp-glucose 6-dehydrogenase from porphyromonas gingivalis bound to product udp-glucuronate 0.9735 39 68
4gwg-assembly1.cif.gz_A crystal structure analysis of 6-phosphogluconate dehydrogenase apo-form 0.9588 38 65
4oqy-assembly1.cif.gz_B streptomyces sp. gf3546 imine reductase 0.9588 39 66
5a9s-assembly1.cif.gz_B nadph complex of imine reductase from amycolatopsis orientalis 0.9584 39 66
4oqy-assembly1.cif.gz_A streptomyces sp. gf3546 imine reductase 0.9583 39 66
ID Description Score Start End Superfamily
5z2gB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.002 40 68 3.50.50.60
af_Q58454_1_196_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9906 39 68 3.40.50.720
af_P9WN19_146_269_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9875 40 69 3.50.50.60
1mfzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.983 40 68 3.40.50.720
af_Q57871_2_201_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9826 39 69 3.40.50.720
ID Description Score Start End GO Terms
AF-S6V071-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9827 77 437 GO:0005737
AF-A0A7Y5EES7-F1-model_v4 FAD-binding oxidoreductase 0.9781 10 387 GO:0005737
AF-S6V071-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9773 77 437 GO:0005737
AF-R7TEC2-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9762 166 437 GO:0005737
AF-A0A7V8KEX7-F1-model_v4 deleted 0.9755 11 432

Feature Viewer

pLDDT pTM Quality
87.1 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map