F490861

General Info

Members Datasets Scaffolds Average Seq Length
1151 294 2302 145

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10076513|Ga0105245_100765135
Length 177
Sequence MIAARRLENQVALDMNRDEAEIRHKLRGWRGIMAIRPSGIWRLTAGLTLLASALLAHHSFGAEYDATKPVMLTGVITKIDWTNPHSYFFIDVKDDKGNVANWKLEGYPPSVLSRTGWKKDVTMKVGDTVTVFGWHARDGSNWAHSRQVTFADGKKLFFGPPAGTGDGGNTPAVEVLK

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.22
Rhizosphere 98.44
Stem 0
Stem Tuber 0
Unclassified 34.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10076513 3300009098 Bacteria 3049
2 JGI24750J21931_1070484 3300002070 Unclassified 570
3 JGI24742J22300_10128337 3300002244 Unclassified 504
4 Ga0065714_10320666 3300005288 Unclassified 669
5 Ga0065712_10004025 3300005290 Bacteria 4359
6 Ga0065712_10158284 3300005290 Unclassified 1320
7 Ga0065715_10000766 3300005293 Bacteria 8488
8 Ga0065715_10057764 3300005293 Unclassified 1054
9 Ga0065707_10004492 3300005295 Unclassified 3187
10 Ga0065707_10023923 3300005295 Bacteria 1624
11 Ga0065707_10118664 3300005295 Bacteria 2179
12 Ga0070676_10002130 3300005328 Bacteria 10080
13 Ga0070676_10048093 3300005328 Bacteria 2493
14 Ga0070676_10414367 3300005328 Bacteria 940
15 Ga0070676_11024512 3300005328 Unclassified 621
16 Ga0070683_100077941 3300005329 Unclassified 3100
17 Ga0070683_100146928 3300005329 Bacteria 2234
18 Ga0070683_100779229 3300005329 Unclassified 916
19 Ga0070683_101106159 3300005329 Unclassified 761
20 Ga0070690_100035456 3300005330 Unclassified 3130
21 Ga0070690_100067424 3300005330 Bacteria 2319
22 Ga0070690_100094602 3300005330 Unclassified 1972
23 Ga0070690_100584678 3300005330 Unclassified 846
24 Ga0070690_100643323 3300005330 Bacteria 809
25 Ga0070690_100667856 3300005330 Unclassified 795
26 Ga0070690_101470421 3300005330 Unclassified 550
27 Ga0070670_100001376 3300005331 Bacteria 19487
28 Ga0070670_100004397 3300005331 Bacteria 11795
29 Ga0070670_100019553 3300005331 Bacteria 5813
30 Ga0070670_101534914 3300005331 Bacteria 612
31 Ga0070677_10002121 3300005333 Bacteria 6329
32 Ga0070677_10004228 3300005333 Unclassified 4679
33 Ga0070677_10010228 3300005333 Bacteria 3204
34 Ga0068869_100006944 3300005334 Bacteria 7206
35 Ga0068869_100008081 3300005334 Bacteria 6764
36 Ga0068869_100021377 3300005334 Bacteria 4450
37 Ga0068869_100075528 3300005334 Unclassified 2504
38 Ga0068869_100144020 3300005334 Bacteria 1843
39 Ga0068869_100485186 3300005334 Bacteria 1030
40 Ga0070666_10004014 3300005335 Bacteria 8934
41 Ga0070666_10097527 3300005335 Bacteria 2024
42 Ga0070666_10173254 3300005335 Unclassified 1512
43 Ga0070666_10320909 3300005335 Unclassified 1105
44 Ga0070666_10460392 3300005335 Bacteria 919
45 Ga0070680_100727533 3300005336 Unclassified 854
46 Ga0070682_100482790 3300005337 Archaea 956
47 Ga0070682_100945636 3300005337 Unclassified 711
48 Ga0068868_100028746 3300005338 Unclassified 4253
49 Ga0068868_100089529 3300005338 Bacteria 2478
50 Ga0068868_101140055 3300005338 Unclassified 719
51 Ga0070660_100028114 3300005339 Bacteria 4204
52 Ga0070660_100631980 3300005339 Unclassified 896
53 Ga0070689_100009058 3300005340 Bacteria 7046
54 Ga0070689_100013527 3300005340 Bacteria 5909
55 Ga0070689_100030022 3300005340 Bacteria 4122
56 Ga0070689_100133112 3300005340 Bacteria 1995
57 Ga0070689_101185293 3300005340 Unclassified 685
58 Ga0070689_101241118 3300005340 Unclassified 670
59 Ga0070689_101975288 3300005340 Unclassified 533
60 Ga0070691_10004994 3300005341 Bacteria 6034
61 Ga0070691_11078052 3300005341 Unclassified 505
62 Ga0070687_100004620 3300005343 Bacteria 5504
63 Ga0070687_100009945 3300005343 Bacteria 4092
64 Ga0070687_100024088 3300005343 Unclassified 2901
65 Ga0070661_100009957 3300005344 Bacteria 6593
66 Ga0070661_100102423 3300005344 Bacteria 2131
67 Ga0070661_100670914 3300005344 Bacteria 843
68 Ga0070692_10078733 3300005345 Unclassified 1771
69 Ga0070692_10323632 3300005345 Bacteria 949
70 Ga0070692_11079316 3300005345 Unclassified 566
71 Ga0070668_100045307 3300005347 Unclassified 3375
72 Ga0070668_100070669 3300005347 Unclassified 2718
73 Ga0070668_101061616 3300005347 Unclassified 730
74 Ga0070668_101176370 3300005347 Bacteria 694
75 Ga0070669_100012416 3300005353 Bacteria 6043
76 Ga0070669_100060674 3300005353 Unclassified 2778
77 Ga0070669_100411049 3300005353 Unclassified 1109
78 Ga0070669_100467023 3300005353 Bacteria 1042
79 Ga0070669_101138583 3300005353 Unclassified 673
80 Ga0070669_101173617 3300005353 Bacteria 663
81 Ga0070675_100001521 3300005354 Bacteria 17146
82 Ga0070675_100003288 3300005354 Bacteria 12256
83 Ga0070675_100023946 3300005354 Bacteria 4886
84 Ga0070675_100113344 3300005354 Bacteria 2296
85 Ga0070675_100127903 3300005354 Bacteria 2163
86 Ga0070675_100182487 3300005354 Bacteria 1815
87 Ga0070675_100952594 3300005354 Unclassified 787
88 Ga0070671_100006397 3300005355 Bacteria 9411
89 Ga0070671_100041594 3300005355 Bacteria 3820
90 Ga0070671_100065471 3300005355 Bacteria 3027
91 Ga0070671_100224783 3300005355 Unclassified 1593
92 Ga0070671_101723623 3300005355 Unclassified 556
93 Ga0070674_100001992 3300005356 Bacteria 11184
94 Ga0070674_100156985 3300005356 Bacteria 1722
95 Ga0070674_100518021 3300005356 Unclassified 996
96 Ga0070674_100831246 3300005356 Bacteria 800
97 Ga0070673_100013101 3300005364 Bacteria 5722
98 Ga0070673_100043845 3300005364 Bacteria 3460
99 Ga0070673_100135883 3300005364 Bacteria 2069
100 Ga0070673_100207522 3300005364 Unclassified 1690
101 Ga0070673_100362668 3300005364 Bacteria 1288
102 Ga0070673_100373248 3300005364 Bacteria 1270
103 Ga0070673_100495249 3300005364 Bacteria 1105
104 Ga0070673_100552490 3300005364 Bacteria 1046
105 Ga0070688_100004251 3300005365 Bacteria 7447
106 Ga0070688_100020983 3300005365 Unclassified 3808
107 Ga0070688_100030277 3300005365 Bacteria 3247
108 Ga0070688_100088699 3300005365 Bacteria 2017
109 Ga0070688_100509177 3300005365 Bacteria 909
110 Ga0070688_101659293 3300005365 Bacteria 523
111 Ga0070659_100070829 3300005366 Unclassified 2771
112 Ga0070659_100258750 3300005366 Bacteria 1444
113 Ga0070659_100297110 3300005366 Unclassified 1346
114 Ga0070659_100471592 3300005366 Bacteria 1067
115 Ga0070667_100021283 3300005367 Bacteria 5387
116 Ga0070667_100620397 3300005367 Bacteria 997
117 Ga0070703_10264793 3300005406 Unclassified 703
118 Ga0070709_10191112 3300005434 Bacteria 1444
119 Ga0070713_100190238 3300005436 Bacteria 1849
120 Ga0070713_100231938 3300005436 Bacteria 1678
121 Ga0070710_10529894 3300005437 Unclassified 810
122 Ga0070710_10798294 3300005437 Unclassified 674
123 Ga0070701_10050245 3300005438 Bacteria 2158
124 Ga0070701_10054352 3300005438 Unclassified 2088
125 Ga0070701_10135373 3300005438 Unclassified 1404
126 Ga0070701_10594376 3300005438 Bacteria 732
127 Ga0070701_10989098 3300005438 Unclassified 586
128 Ga0070711_100078558 3300005439 Bacteria 2345
129 Ga0070711_100766664 3300005439 Unclassified 816
130 Ga0070705_100000409 3300005440 Bacteria 24706
131 Ga0070705_100006513 3300005440 Bacteria 5731
132 Ga0070705_100065077 3300005440 Unclassified 2181
133 Ga0070705_100071149 3300005440 Unclassified 2103
134 Ga0070705_101076117 3300005440 Bacteria 657
135 Ga0070705_101131408 3300005440 Unclassified 642
136 Ga0070700_100008474 3300005441 Bacteria 5598
137 Ga0070700_100053330 3300005441 Bacteria 2523
138 Ga0070694_100015841 3300005444 Bacteria 4743
139 Ga0070694_100027628 3300005444 Bacteria 3687
140 Ga0070694_100046602 3300005444 Bacteria 2911
141 Ga0070694_100111506 3300005444 Unclassified 1949
142 Ga0070694_100485903 3300005444 Bacteria 980
143 Ga0070694_100505429 3300005444 Unclassified 962
144 Ga0070708_100280275 3300005445 Bacteria 1569
145 Ga0070708_100315854 3300005445 Bacteria 1472
146 Ga0070708_100555176 3300005445 Bacteria 1083
147 Ga0070708_101072349 3300005445 Unclassified 755
148 Ga0070663_100698133 3300005455 Unclassified 862
149 Ga0070678_100086413 3300005456 Bacteria 2392
150 Ga0070678_100108054 3300005456 Bacteria 2171
151 Ga0070678_100237148 3300005456 Bacteria 1523
152 Ga0070678_100981241 3300005456 Bacteria 776
153 Ga0070678_101503576 3300005456 Unclassified 631
154 Ga0070662_100025944 3300005457 Unclassified 4052
155 Ga0070662_100028891 3300005457 Bacteria 3865
156 Ga0070662_100041285 3300005457 Bacteria 3290
157 Ga0070662_100044446 3300005457 Unclassified 3182
158 Ga0070662_100438280 3300005457 Bacteria 1083
159 Ga0070662_101362747 3300005457 Bacteria 611
160 Ga0070681_10044836 3300005458 Bacteria 4427
161 Ga0070681_10189217 3300005458 Bacteria 1978
162 Ga0070681_10315014 3300005458 Bacteria 1474
163 Ga0070681_10350788 3300005458 Bacteria 1386
164 Ga0070681_11272787 3300005458 Unclassified 658
165 Ga0068867_100009440 3300005459 Bacteria 6879
166 Ga0068867_100013742 3300005459 Bacteria 5732
167 Ga0068867_100019384 3300005459 Unclassified 4848
168 Ga0068867_100097892 3300005459 Bacteria 2236
169 Ga0068867_100213309 3300005459 Bacteria 1552
170 Ga0068867_100228021 3300005459 Unclassified 1504
171 Ga0068867_100275791 3300005459 Bacteria 1377
172 Ga0068867_100306445 3300005459 Unclassified 1311
173 Ga0068867_100609693 3300005459 Bacteria 953
174 Ga0068867_100632200 3300005459 Unclassified 937
175 Ga0068867_100711690 3300005459 Bacteria 887
176 Ga0068867_100903960 3300005459 Bacteria 795
177 Ga0068867_100935571 3300005459 Unclassified 782
178 Ga0068867_102265460 3300005459 Unclassified 516
179 Ga0070685_10004167 3300005466 Bacteria 7292
180 Ga0070685_10130794 3300005466 Unclassified 1569
181 Ga0070706_100810115 3300005467 Bacteria 867
182 Ga0070706_100856739 3300005467 Bacteria 840
183 Ga0070706_101465729 3300005467 Unclassified 624
184 Ga0070707_100124549 3300005468 Bacteria 2503
185 Ga0070707_100309931 3300005468 Unclassified 1534
186 Ga0070707_100356008 3300005468 Unclassified 1422
187 Ga0070707_100570644 3300005468 Bacteria 1094
188 Ga0070707_100584661 3300005468 Unclassified 1079
189 Ga0070698_100008437 3300005471 Bacteria 11136
190 Ga0070698_100050520 3300005471 Bacteria 4239
191 Ga0070698_100060971 3300005471 Bacteria 3805
192 Ga0070698_100789690 3300005471 Bacteria 893
193 Ga0070698_101813752 3300005471 Bacteria 563
194 Ga0070698_102153942 3300005471 Unclassified 511
195 Ga0070699_100005570 3300005518 Bacteria 11041
196 Ga0070699_100006887 3300005518 Bacteria 9885
197 Ga0070699_100021255 3300005518 Bacteria 5596
198 Ga0070699_100111782 3300005518 Unclassified 2399
199 Ga0070699_100547452 3300005518 Bacteria 1053
200 Ga0070699_100823973 3300005518 Unclassified 849
201 Ga0070679_100000937 3300005530 Bacteria 25354
202 Ga0070679_100591614 3300005530 Unclassified 1053
203 Ga0070679_100628067 3300005530 Unclassified 1017
204 Ga0070684_100000220 3300005535 Bacteria 39930
205 Ga0070684_100033979 3300005535 Bacteria 4358
206 Ga0070684_100058609 3300005535 Bacteria 3365
207 Ga0070684_100079422 3300005535 Bacteria 2900
208 Ga0070684_100272009 3300005535 Bacteria 1551
209 Ga0070684_100277320 3300005535 Bacteria 1535
210 Ga0070684_100395913 3300005535 Bacteria 1273
211 Ga0070684_100523744 3300005535 Bacteria 1099
212 Ga0070697_100038660 3300005536 Unclassified 3856
213 Ga0070697_101047296 3300005536 Unclassified 726
214 Ga0068853_100009310 3300005539 Bacteria 7920
215 Ga0068853_100315548 3300005539 Bacteria 1448
216 Ga0068853_100572665 3300005539 Bacteria 1071
217 Ga0070672_100013202 3300005543 Bacteria 5826
218 Ga0070672_100024022 3300005543 Bacteria 4497
219 Ga0070672_100038806 3300005543 Unclassified 3642
220 Ga0070672_100216377 3300005543 Unclassified 1606
221 Ga0070672_100285181 3300005543 Bacteria 1397
222 Ga0070672_100415658 3300005543 Bacteria 1154
223 Ga0070672_100479835 3300005543 Unclassified 1073
224 Ga0070686_100008216 3300005544 Bacteria 5842
225 Ga0070686_100039392 3300005544 Bacteria 2945
226 Ga0070686_100354280 3300005544 Unclassified 1104
227 Ga0070686_101247657 3300005544 Bacteria 619
228 Ga0070695_100000063 3300005545 Bacteria 42774
229 Ga0070695_100471741 3300005545 Bacteria 965
230 Ga0070695_101309635 3300005545 Bacteria 599
231 Ga0070696_100000064 3300005546 Bacteria 50839
232 Ga0070696_100006244 3300005546 Bacteria 7975
233 Ga0070696_100022663 3300005546 Bacteria 4268
234 Ga0070696_100026342 3300005546 Bacteria 3956
235 Ga0070696_100565622 3300005546 Bacteria 913
236 Ga0070693_101331948 3300005547 Unclassified 556
237 Ga0070665_100009896 3300005548 Bacteria 9641
238 Ga0070665_100262390 3300005548 Unclassified 1728
239 Ga0070704_100010532 3300005549 Bacteria 5629
240 Ga0070704_100039327 3300005549 Unclassified 3247
241 Ga0070704_100058306 3300005549 Unclassified 2750
242 Ga0070704_100100992 3300005549 Unclassified 2173
243 Ga0070704_100266263 3300005549 Unclassified 1414
244 Ga0070704_100462718 3300005549 Bacteria 1094
245 Ga0070704_101864830 3300005549 Unclassified 557
246 Ga0068855_100008856 3300005563 Bacteria 12166
247 Ga0068855_100084626 3300005563 Bacteria 3671
248 Ga0068855_100121694 3300005563 Bacteria 2986
249 Ga0068855_100623617 3300005563 Bacteria 1161
250 Ga0070664_100005747 3300005564 Bacteria 10003
251 Ga0070664_100147595 3300005564 Bacteria 2075
252 Ga0070664_100394524 3300005564 Unclassified 1265
253 Ga0070664_100543121 3300005564 Unclassified 1074
254 Ga0068857_100009482 3300005577 Bacteria 8454
255 Ga0068857_100025305 3300005577 Bacteria 5227
256 Ga0068857_100027803 3300005577 Bacteria 4987
257 Ga0068857_100047994 3300005577 Bacteria 3791
258 Ga0068857_100072561 3300005577 Plasmid 3068
259 Ga0068857_100196133 3300005577 Bacteria 1840
260 Ga0068857_100945624 3300005577 Bacteria 828
261 Ga0068854_100014894 3300005578 Bacteria 5135
262 Ga0068854_100222872 3300005578 Bacteria 1493
263 Ga0068854_101815217 3300005578 Unclassified 559
264 Ga0068854_101967528 3300005578 Unclassified 538
265 Ga0068856_100039344 3300005614 Bacteria 4643
266 Ga0068856_100041958 3300005614 Bacteria 4499
267 Ga0068856_100146923 3300005614 Archaea 2365
268 Ga0068856_100163258 3300005614 Bacteria 2239
269 Ga0068856_100259219 3300005614 Bacteria 1754
270 Ga0068856_100296875 3300005614 Unclassified 1633
271 Ga0068856_100396143 3300005614 Bacteria 1400
272 Ga0068856_100527098 3300005614 Unclassified 1202
273 Ga0068856_100657821 3300005614 Unclassified 1068
274 Ga0068856_102123550 3300005614 Unclassified 571
275 Ga0070702_100002366 3300005615 Bacteria 8105
276 Ga0070702_100061746 3300005615 Bacteria 2183
277 Ga0070702_100202611 3300005615 Unclassified 1315
278 Ga0070702_100233231 3300005615 Bacteria 1238
279 Ga0068852_100020042 3300005616 Bacteria 5311
280 Ga0068852_100053272 3300005616 Bacteria 3482
281 Ga0068852_100470696 3300005616 Bacteria 1247
282 Ga0068852_101033047 3300005616 Bacteria 841
283 Ga0068859_100008792 3300005617 Bacteria 10194
284 Ga0068859_100013417 3300005617 Bacteria 8216
285 Ga0068859_100133533 3300005617 Unclassified 2554
286 Ga0068859_100137164 3300005617 Bacteria 2520
287 Ga0068859_100403507 3300005617 Bacteria 1463
288 Ga0068859_100959951 3300005617 Unclassified 938
289 Ga0068859_101314117 3300005617 Unclassified 797
290 Ga0068859_101733187 3300005617 Unclassified 690
291 Ga0068864_100029090 3300005618 Bacteria 4675
292 Ga0068864_100060069 3300005618 Bacteria 3291
293 Ga0068864_100209586 3300005618 Unclassified 1794
294 Ga0068864_100217175 3300005618 Bacteria 1763
295 Ga0068864_100885136 3300005618 Unclassified 881
296 Ga0068866_10007943 3300005718 Bacteria 4454
297 Ga0068866_10140289 3300005718 Bacteria 1386
298 Ga0068866_10203369 3300005718 Bacteria 1185
299 Ga0068861_100000410 3300005719 Bacteria 24782
300 Ga0068861_100017323 3300005719 Bacteria 5113
301 Ga0068861_100055161 3300005719 Bacteria 3029
302 Ga0068861_100410199 3300005719 Bacteria 1204
303 Ga0068861_100819868 3300005719 Bacteria 875
304 Ga0068861_101207383 3300005719 Unclassified 732
305 Ga0068851_10010649 3300005834 Bacteria 4294
306 Ga0068851_10467994 3300005834 Unclassified 751
307 Ga0068870_10000872 3300005840 Bacteria 11786
308 Ga0068870_10004033 3300005840 Bacteria 6273
309 Ga0068870_10021478 3300005840 Unclassified 3158
310 Ga0068870_10155288 3300005840 Bacteria 1352
311 Ga0068870_10214742 3300005840 Bacteria 1174
312 Ga0068870_10287168 3300005840 Bacteria 1034
313 Ga0068870_10348530 3300005840 Bacteria 950
314 Ga0068870_10950660 3300005840 Unclassified 610
315 Ga0068870_11038272 3300005840 Unclassified 586
316 Ga0068863_100002061 3300005841 Bacteria 19922
317 Ga0068863_100068374 3300005841 Unclassified 3360
318 Ga0068863_100069788 3300005841 Bacteria 3322
319 Ga0068863_100089605 3300005841 Bacteria 2917
320 Ga0068863_101589276 3300005841 Bacteria 663
321 Ga0068863_102284085 3300005841 Unclassified 551
322 Ga0068858_100018687 3300005842 Bacteria 6488
323 Ga0068858_100058040 3300005842 Bacteria 3578
324 Ga0068858_100122236 3300005842 Bacteria 2435
325 Ga0068858_100308191 3300005842 Bacteria 1511
326 Ga0068858_101290364 3300005842 Unclassified 718
327 Ga0068858_101342782 3300005842 Bacteria 704
328 Ga0068860_100002194 3300005843 Bacteria 20537
329 Ga0068860_100023907 3300005843 Bacteria 5906
330 Ga0068860_100028328 3300005843 Bacteria 5391
331 Ga0068860_100070347 3300005843 Bacteria 3327
332 Ga0068860_100303771 3300005843 Bacteria 1564
333 Ga0068860_100423539 3300005843 Bacteria 1320
334 Ga0068860_100456534 3300005843 Unclassified 1271
335 Ga0068860_100511543 3300005843 Unclassified 1200
336 Ga0068860_100873152 3300005843 Bacteria 915
337 Ga0068860_100990675 3300005843 Bacteria 858
338 Ga0068860_101052916 3300005843 Unclassified 832
339 Ga0068860_101343123 3300005843 Unclassified 736
340 Ga0068860_101929773 3300005843 Bacteria 612
341 Ga0068862_100003220 3300005844 Bacteria 14137
342 Ga0068862_100569162 3300005844 Unclassified 1084
343 Ga0068862_101685687 3300005844 Unclassified 642
344 Ga0081455_10116340 3300005937 Bacteria 2115
345 Ga0081455_10489905 3300005937 Bacteria 829
346 Ga0070717_10923740 3300006028 Unclassified 794
347 Ga0097621_100029485 3300006237 Unclassified 4334
348 Ga0097621_100039382 3300006237 Bacteria 3796
349 Ga0097621_100039987 3300006237 Bacteria 3768
350 Ga0097621_100048756 3300006237 Unclassified 3438
351 Ga0097621_100080595 3300006237 Unclassified 2708
352 Ga0097621_100123936 3300006237 Bacteria 2194
353 Ga0097621_100130234 3300006237 Bacteria 2141
354 Ga0097621_100157845 3300006237 Unclassified 1948
355 Ga0097621_100537675 3300006237 Unclassified 1062
356 Ga0097621_100653481 3300006237 Bacteria 965
357 Ga0097621_101375952 3300006237 Bacteria 668
358 Ga0068871_100013498 3300006358 Bacteria 6065
359 Ga0068871_100019371 3300006358 Bacteria 5196
360 Ga0068871_100020714 3300006358 Bacteria 5043
361 Ga0068871_100024112 3300006358 Bacteria 4715
362 Ga0068871_100053946 3300006358 Bacteria 3260
363 Ga0068871_100079486 3300006358 Unclassified 2713
364 Ga0068871_100117842 3300006358 Unclassified 2240
365 Ga0068871_100162161 3300006358 Bacteria 1913
366 Ga0068871_100588501 3300006358 Bacteria 1011
367 Ga0068871_100621333 3300006358 Bacteria 984
368 Ga0068871_100709966 3300006358 Unclassified 922
369 Ga0068871_100738288 3300006358 Unclassified 904
370 Ga0075428_100033591 3300006844 Bacteria 5663
371 Ga0075428_100037354 3300006844 Bacteria 5348
372 Ga0075428_100085873 3300006844 Bacteria 3432
373 Ga0075428_100120531 3300006844 Unclassified 2856
374 Ga0075428_100133559 3300006844 Bacteria 2699
375 Ga0075428_100172891 3300006844 Unclassified 2341
376 Ga0075428_100217301 3300006844 Bacteria 2064
377 Ga0075428_101246106 3300006844 Unclassified 783
378 Ga0075428_101567422 3300006844 Unclassified 689
379 Ga0075430_100003769 3300006846 Bacteria 12738
380 Ga0075430_100089728 3300006846 Bacteria 2572
381 Ga0075431_100018585 3300006847 Bacteria 7081
382 Ga0075431_100129847 3300006847 Unclassified 2600
383 Ga0075431_101159055 3300006847 Unclassified 736
384 Ga0075433_10002662 3300006852 Bacteria 13632
385 Ga0075433_10120708 3300006852 Bacteria 2327
386 Ga0075433_10158456 3300006852 Bacteria 2014
387 Ga0075433_10330313 3300006852 Bacteria 1348
388 Ga0075433_10590156 3300006852 Unclassified 976
389 Ga0075433_10696772 3300006852 Bacteria 890
390 Ga0075434_100047389 3300006871 Bacteria 4265
391 Ga0075434_100085384 3300006871 Unclassified 3155
392 Ga0075434_100096545 3300006871 Unclassified 2960
393 Ga0075434_100119420 3300006871 Unclassified 2650
394 Ga0075434_100140198 3300006871 Bacteria 2437
395 Ga0075434_100165630 3300006871 Unclassified 2230
396 Ga0075434_100233006 3300006871 Bacteria 1861
397 Ga0075434_100306602 3300006871 Bacteria 1608
398 Ga0075434_100328658 3300006871 Bacteria 1549
399 Ga0075434_100425718 3300006871 Unclassified 1349
400 Ga0075434_100685161 3300006871 Unclassified 1043
401 Ga0075434_101152270 3300006871 Unclassified 788
402 Ga0075434_102470681 3300006871 Unclassified 521
403 Ga0075429_100049770 3300006880 Unclassified 3645
404 Ga0075429_100117268 3300006880 Unclassified 2327
405 Ga0075429_100194529 3300006880 Unclassified 1776
406 Ga0075429_100339637 3300006880 Unclassified 1315
407 Ga0075429_100476534 3300006880 Bacteria 1094
408 Ga0068865_100010239 3300006881 Bacteria 5831
409 Ga0068865_100013640 3300006881 Bacteria 5144
410 Ga0068865_100114681 3300006881 Bacteria 1993
411 Ga0068865_100133264 3300006881 Bacteria 1864
412 Ga0068865_100211295 3300006881 Bacteria 1512
413 Ga0068865_100219518 3300006881 Bacteria 1486
414 Ga0068865_100417728 3300006881 Bacteria 1102
415 Ga0068865_100594296 3300006881 Unclassified 935
416 Ga0075436_100663870 3300006914 Bacteria 771
417 Ga0075436_100847908 3300006914 Unclassified 682
418 Ga0097620_100008792 3300006931 Bacteria 10194
419 Ga0097620_100013417 3300006931 Bacteria 8216
420 Ga0097620_100133539 3300006931 Unclassified 2554
421 Ga0097620_100137166 3300006931 Bacteria 2520
422 Ga0097620_100403527 3300006931 Bacteria 1463
423 Ga0097620_100959881 3300006931 Unclassified 938
424 Ga0097620_101314188 3300006931 Unclassified 797
425 Ga0097620_101733172 3300006931 Unclassified 690
426 Ga0075435_100022668 3300007076 Unclassified 4846
427 Ga0075435_100040029 3300007076 Unclassified 3742
428 Ga0075435_100113926 3300007076 Unclassified 2251
429 Ga0075435_100149793 3300007076 Bacteria 1961
430 Ga0075435_100304615 3300007076 Bacteria 1363
431 Ga0075435_100304728 3300007076 Bacteria 1363
432 Ga0075435_100351842 3300007076 Bacteria 1263
433 Ga0075435_100595014 3300007076 Bacteria 959
434 Ga0075435_100948791 3300007076 Unclassified 751
435 Ga0075435_100968742 3300007076 Unclassified 742
436 Ga0099794_10039852 3300007265 Unclassified 2231
437 Ga0105240_10003663 3300009093 Bacteria 23765
438 Ga0105240_10020135 3300009093 Bacteria 8905
439 Ga0105240_10064169 3300009093 Unclassified 4565
440 Ga0105240_10166412 3300009093 Unclassified 2615
441 Ga0105240_10227599 3300009093 Bacteria 2169
442 Ga0105240_11440380 3300009093 Bacteria 723
443 Ga0111539_10016172 3300009094 Bacteria 9256
444 Ga0111539_10044634 3300009094 Bacteria 5309
445 Ga0111539_10070479 3300009094 Unclassified 4127
446 Ga0111539_10175430 3300009094 Bacteria 2504
447 Ga0111539_10251201 3300009094 Bacteria 2059
448 Ga0111539_10704830 3300009094 Bacteria 1175
449 Ga0111539_10730743 3300009094 Bacteria 1152
450 Ga0105245_10006391 3300009098 Bacteria 10368
451 Ga0105245_10010932 3300009098 Bacteria 7897
452 Ga0105245_10205035 3300009098 Bacteria 1895
453 Ga0105245_10223273 3300009098 Bacteria 1819
454 Ga0105245_10852495 3300009098 Bacteria 951
455 Ga0105245_10966040 3300009098 Bacteria 895
456 Ga0105245_10969270 3300009098 Unclassified 894
457 Ga0105245_10997376 3300009098 Unclassified 882
458 Ga0105245_11406372 3300009098 Bacteria 748
459 Ga0105245_11494283 3300009098 Unclassified 726
460 Ga0105245_12271001 3300009098 Unclassified 596
461 Ga0105245_12293727 3300009098 Unclassified 593
462 Ga0105245_12337930 3300009098 Unclassified 588
463 Ga0105247_10006873 3300009101 Bacteria 7011
464 Ga0105247_10702164 3300009101 Unclassified 761
465 Ga0114129_10002325 3300009147 Bacteria 26400
466 Ga0114129_10025741 3300009147 Bacteria 8334
467 Ga0114129_10029196 3300009147 Bacteria 7811
468 Ga0114129_10050075 3300009147 Bacteria 5868
469 Ga0114129_10069233 3300009147 Bacteria 4919
470 Ga0114129_10478082 3300009147 Bacteria 1630
471 Ga0114129_10507032 3300009147 Unclassified 1575
472 Ga0114129_10593386 3300009147 Unclassified 1436
473 Ga0114129_10772522 3300009147 Unclassified 1228
474 Ga0114129_11128970 3300009147 Bacteria 980
475 Ga0105243_10013693 3300009148 Bacteria 6136
476 Ga0105243_10014817 3300009148 Bacteria 5899
477 Ga0105243_10016503 3300009148 Bacteria 5583
478 Ga0105243_10175564 3300009148 Bacteria 1859
479 Ga0105243_10181181 3300009148 Bacteria 1832
480 Ga0105243_10468310 3300009148 Unclassified 1186
481 Ga0105243_11908025 3300009148 Unclassified 627
482 Ga0105241_10020683 3300009174 Bacteria 4862
483 Ga0105241_10024599 3300009174 Bacteria 4472
484 Ga0105241_10049390 3300009174 Bacteria 3204
485 Ga0105241_10069983 3300009174 Bacteria 2721
486 Ga0105241_10091837 3300009174 Unclassified 2396
487 Ga0105241_10193333 3300009174 Unclassified 1695
488 Ga0105241_10282514 3300009174 Bacteria 1418
489 Ga0105241_10883890 3300009174 Unclassified 829
490 Ga0105242_10015811 3300009176 Bacteria 5862
491 Ga0105242_10020652 3300009176 Bacteria 5167
492 Ga0105242_10026637 3300009176 Unclassified 4583
493 Ga0105242_10029211 3300009176 Bacteria 4395
494 Ga0105242_10091744 3300009176 Bacteria 2558
495 Ga0105242_10106653 3300009176 Bacteria 2381
496 Ga0105242_10206468 3300009176 Unclassified 1747
497 Ga0105242_10262885 3300009176 Bacteria 1560
498 Ga0105242_10341942 3300009176 Bacteria 1379
499 Ga0105242_10468515 3300009176 Unclassified 1191
500 Ga0105242_11878081 3300009176 Bacteria 639
501 Ga0105242_13006680 3300009176 Unclassified 522
502 Ga0105248_10060955 3300009177 Bacteria 4235
503 Ga0105248_10106134 3300009177 Bacteria 3167
504 Ga0105248_10113816 3300009177 Bacteria 3051
505 Ga0105248_10171127 3300009177 Bacteria 2448
506 Ga0105248_10208234 3300009177 Bacteria 2203
507 Ga0105248_10257140 3300009177 Bacteria 1966
508 Ga0105248_10611923 3300009177 Bacteria 1229
509 Ga0105248_10726673 3300009177 Unclassified 1120
510 Ga0105248_11110556 3300009177 Bacteria 894
511 Ga0105237_10006103 3300009545 Bacteria 13467
512 Ga0105237_10008051 3300009545 Bacteria 11462
513 Ga0105237_10012134 3300009545 Bacteria 9089
514 Ga0105237_10146161 3300009545 Unclassified 2359
515 Ga0105237_10266671 3300009545 Bacteria 1715
516 Ga0105237_10303500 3300009545 Bacteria 1600
517 Ga0105237_10707403 3300009545 Unclassified 1014
518 Ga0105237_11321534 3300009545 Unclassified 727
519 Ga0105237_11656020 3300009545 Bacteria 647
520 Ga0105238_10004906 3300009551 Bacteria 13238
521 Ga0105238_10028228 3300009551 Bacteria 5717
522 Ga0105238_10062533 3300009551 Bacteria 3723
523 Ga0105238_10067738 3300009551 Bacteria 3570
524 Ga0105238_10070174 3300009551 Bacteria 3504
525 Ga0105249_10001517 3300009553 Bacteria 20379
526 Ga0105249_10324208 3300009553 Unclassified 1552
527 Ga0105249_10623001 3300009553 Bacteria 1135
528 Ga0105249_11210733 3300009553 Bacteria 826
529 Ga0105249_11341102 3300009553 Bacteria 787
530 Ga0105249_11407032 3300009553 Unclassified 769
531 Ga0105239_10008018 3300010375 Bacteria 12057
532 Ga0105239_10011847 3300010375 Bacteria 9729
533 Ga0105239_10109635 3300010375 Bacteria 3059
534 Ga0105239_10703520 3300010375 Bacteria 1155
535 Ga0105246_10006946 3300011119 Bacteria 6924
536 Ga0105246_10054272 3300011119 Bacteria 2761
537 Ga0105246_10081006 3300011119 Unclassified 2312
538 Ga0105246_10400069 3300011119 Bacteria 1140
539 Ga0105246_10901759 3300011119 Unclassified 793
540 Ga0105246_11864741 3300011119 Unclassified 576
541 Ga0157370_10002320 3300013104 Bacteria 23045
542 Ga0157370_10013256 3300013104 Bacteria 8495
543 Ga0157369_10000856 3300013105 Bacteria 38815
544 Ga0157369_10020341 3300013105 Bacteria 7420
545 Ga0157369_10235325 3300013105 Unclassified 1914
546 Ga0157369_10997637 3300013105 Unclassified 857
547 Ga0157369_11027969 3300013105 Bacteria 843
548 Ga0157374_10004706 3300013296 Bacteria 11461
549 Ga0157374_10057967 3300013296 Bacteria 3619
550 Ga0157374_10097378 3300013296 Unclassified 2815
551 Ga0157374_10141716 3300013296 Unclassified 2334
552 Ga0157374_10477631 3300013296 Unclassified 1250
553 Ga0157374_10523884 3300013296 Bacteria 1191
554 Ga0157374_11576381 3300013296 Bacteria 681
555 Ga0157378_10004469 3300013297 Bacteria 12281
556 Ga0157378_10069719 3300013297 Bacteria 3155
557 Ga0157378_10153012 3300013297 Bacteria 2150
558 Ga0157378_10628827 3300013297 Bacteria 1087
559 Ga0157378_11063431 3300013297 Unclassified 845
560 Ga0163162_10007906 3300013306 Bacteria 10363
561 Ga0163162_10167605 3300013306 Bacteria 2320
562 Ga0163162_10365959 3300013306 Bacteria 1575
563 Ga0163162_10763451 3300013306 Unclassified 1086
564 Ga0163162_10864437 3300013306 Bacteria 1019
565 Ga0163162_10884522 3300013306 Unclassified 1007
566 Ga0163162_12073710 3300013306 Bacteria 652
567 Ga0157372_10020489 3300013307 Bacteria 7136
568 Ga0157372_10024353 3300013307 Bacteria 6574
569 Ga0157372_10068428 3300013307 Bacteria 3992
570 Ga0157372_10279702 3300013307 Unclassified 1940
571 Ga0157372_10309247 3300013307 Unclassified 1839
572 Ga0157372_10312674 3300013307 Bacteria 1829
573 Ga0157372_10770830 3300013307 Bacteria 1118
574 Ga0157372_11115339 3300013307 Unclassified 912
575 Ga0157375_10006342 3300013308 Bacteria 10311
576 Ga0157375_10013179 3300013308 Bacteria 7350
577 Ga0157375_10058331 3300013308 Bacteria 3818
578 Ga0157375_10073966 3300013308 Bacteria 3428
579 Ga0157375_10101653 3300013308 Unclassified 2958
580 Ga0157375_10305473 3300013308 Unclassified 1755
581 Ga0157375_10503260 3300013308 Bacteria 1375
582 Ga0157375_11314982 3300013308 Unclassified 850
583 Ga0157375_11487154 3300013308 Bacteria 799
584 Ga0157375_11585722 3300013308 Unclassified 774
585 Ga0163163_10004905 3300014325 Bacteria 11506
586 Ga0163163_10185940 3300014325 Bacteria 2125
587 Ga0163163_10198573 3300014325 Bacteria 2054
588 Ga0163163_10236688 3300014325 Bacteria 1875
589 Ga0163163_10383455 3300014325 Bacteria 1463
590 Ga0163163_11808929 3300014325 Unclassified 671
591 Ga0163163_11812206 3300014325 Unclassified 670
592 Ga0157380_10001628 3300014326 Archaea 14808
593 Ga0157380_10033205 3300014326 Unclassified 3973
594 Ga0157380_10035075 3300014326 Bacteria 3873
595 Ga0157380_10040834 3300014326 Bacteria 3617
596 Ga0157380_10057405 3300014326 Bacteria 3100
597 Ga0157380_10137318 3300014326 Bacteria 2095
598 Ga0157380_10235205 3300014326 Bacteria 1648
599 Ga0157380_10372187 3300014326 Bacteria 1345
600 Ga0157377_10005177 3300014745 Bacteria 6100
601 Ga0157379_10006764 3300014968 Bacteria 9908
602 Ga0157379_10066570 3300014968 Bacteria 3220
603 Ga0157379_10093858 3300014968 Bacteria 2692
604 Ga0157379_10386298 3300014968 Bacteria 1285
605 Ga0157379_10860219 3300014968 Unclassified 858
606 Ga0157379_10911158 3300014968 Bacteria 834
607 Ga0157379_11382689 3300014968 Unclassified 682
608 Ga0157376_10064091 3300014969 Unclassified 3098
609 Ga0157376_10104084 3300014969 Bacteria 2487
610 Ga0157376_10119831 3300014969 Bacteria 2330
611 Ga0157376_10182589 3300014969 Unclassified 1919
612 Ga0157376_10298798 3300014969 Unclassified 1523
613 Ga0157376_10302807 3300014969 Bacteria 1514
614 Ga0157376_10351170 3300014969 Bacteria 1411
615 Ga0157376_10547673 3300014969 Bacteria 1144
616 Ga0163161_10024908 3300017792 Bacteria 4230
617 Ga0163161_10951212 3300017792 Unclassified 731
618 Ga0163161_11061894 3300017792 Unclassified 694
619 Ga0206352_10276273 3300020078 Unclassified 852
620 Ga0213875_10020183 3300021388 Unclassified 3197
621 Ga0207673_1015351 3300025290 Bacteria 1013
622 Ga0207697_10001790 3300025315 Bacteria 11496
623 Ga0207656_10044342 3300025321 Bacteria 1899
624 Ga0207653_10038169 3300025885 Bacteria 1569
625 Ga0207682_10002980 3300025893 Bacteria 7427
626 Ga0207682_10003881 3300025893 Bacteria 6393
627 Ga0207682_10035183 3300025893 Bacteria 2022
628 Ga0207692_10447154 3300025898 Unclassified 813
629 Ga0207642_10031206 3300025899 Bacteria 2229
630 Ga0207642_10106625 3300025899 Unclassified 1418
631 Ga0207642_10259319 3300025899 Bacteria 990
632 Ga0207642_10522134 3300025899 Unclassified 730
633 Ga0207710_10016079 3300025900 Bacteria 3165
634 Ga0207688_10002313 3300025901 Bacteria 10244
635 Ga0207680_10283130 3300025903 Bacteria 1152
636 Ga0207680_10291311 3300025903 Bacteria 1136
637 Ga0207680_10884041 3300025903 Unclassified 640
638 Ga0207647_10239478 3300025904 Unclassified 1042
639 Ga0207699_10308459 3300025906 Bacteria 1107
640 Ga0207645_10004825 3300025907 Bacteria 9904
641 Ga0207645_10013798 3300025907 Bacteria 5422
642 Ga0207645_10050497 3300025907 Bacteria 2656
643 Ga0207645_10094311 3300025907 Bacteria 1926
644 Ga0207643_10000719 3300025908 Bacteria 20342
645 Ga0207643_10003155 3300025908 Bacteria 8878
646 Ga0207643_10021602 3300025908 Bacteria 3538
647 Ga0207643_10036366 3300025908 Bacteria 2761
648 Ga0207643_10098401 3300025908 Bacteria 1713
649 Ga0207643_10239236 3300025908 Bacteria 1115
650 Ga0207643_10276967 3300025908 Unclassified 1040
651 Ga0207643_10775757 3300025908 Unclassified 621
652 Ga0207654_10018789 3300025911 Bacteria 3633
653 Ga0207654_10082009 3300025911 Unclassified 1944
654 Ga0207654_10084206 3300025911 Bacteria 1922
655 Ga0207654_10142895 3300025911 Unclassified 1528
656 Ga0207654_10164816 3300025911 Unclassified 1434
657 Ga0207654_10289068 3300025911 Bacteria 1111
658 Ga0207654_10610968 3300025911 Unclassified 779
659 Ga0207654_11151322 3300025911 Bacteria 565
660 Ga0207707_10039969 3300025912 Bacteria 4098
661 Ga0207707_10177490 3300025912 Bacteria 1860
662 Ga0207707_10640197 3300025912 Unclassified 897
663 Ga0207707_10868193 3300025912 Bacteria 748
664 Ga0207695_10000302 3300025913 Bacteria 121140
665 Ga0207695_10019328 3300025913 Bacteria 7845
666 Ga0207695_10034902 3300025913 Bacteria 5462
667 Ga0207695_10129150 3300025913 Bacteria 2486
668 Ga0207695_10393048 3300025913 Unclassified 1271
669 Ga0207695_10757591 3300025913 Unclassified 851
670 Ga0207695_11461321 3300025913 Bacteria 564
671 Ga0207671_10006862 3300025914 Bacteria 10046
672 Ga0207671_10010106 3300025914 Bacteria 7822
673 Ga0207671_10037469 3300025914 Bacteria 3596
674 Ga0207671_10330361 3300025914 Unclassified 1207
675 Ga0207671_10434503 3300025914 Bacteria 1045
676 Ga0207671_10462504 3300025914 Bacteria 1011
677 Ga0207671_10728108 3300025914 Unclassified 788
678 Ga0207671_10856694 3300025914 Unclassified 719
679 Ga0207660_10061029 3300025917 Bacteria 2713
680 Ga0207660_10448120 3300025917 Unclassified 1044
681 Ga0207662_10004573 3300025918 Bacteria 7292
682 Ga0207662_10007357 3300025918 Bacteria 5991
683 Ga0207662_10051246 3300025918 Bacteria 2455
684 Ga0207662_10546311 3300025918 Unclassified 802
685 Ga0207657_10036023 3300025919 Bacteria 4432
686 Ga0207657_10765974 3300025919 Unclassified 747
687 Ga0207649_10219824 3300025920 Unclassified 1352
688 Ga0207649_10334313 3300025920 Unclassified 1117
689 Ga0207649_10490681 3300025920 Bacteria 933
690 Ga0207649_10645621 3300025920 Bacteria 817
691 Ga0207652_10141636 3300025921 Bacteria 2150
692 Ga0207646_10113720 3300025922 Bacteria 2430
693 Ga0207646_10307493 3300025922 Unclassified 1432
694 Ga0207646_10509236 3300025922 Unclassified 1084
695 Ga0207646_10761770 3300025922 Unclassified 863
696 Ga0207646_10789060 3300025922 Unclassified 846
697 Ga0207681_10001889 3300025923 Bacteria 13405
698 Ga0207681_10029885 3300025923 Bacteria 3547
699 Ga0207681_10041243 3300025923 Unclassified 3076
700 Ga0207681_10266226 3300025923 Unclassified 1344
701 Ga0207681_10338832 3300025923 Unclassified 1201
702 Ga0207694_10003179 3300025924 Bacteria 13105
703 Ga0207694_10006554 3300025924 Bacteria 8847
704 Ga0207694_10006776 3300025924 Bacteria 8699
705 Ga0207694_10040780 3300025924 Unclassified 3576
706 Ga0207694_10043525 3300025924 Unclassified 3466
707 Ga0207694_10049427 3300025924 Bacteria 3256
708 Ga0207694_10057282 3300025924 Bacteria 3029
709 Ga0207694_10067430 3300025924 Bacteria 2793
710 Ga0207694_10071198 3300025924 Bacteria 2717
711 Ga0207694_10229719 3300025924 Bacteria 1515
712 Ga0207650_10021575 3300025925 Bacteria 4550
713 Ga0207650_10133913 3300025925 Bacteria 1942
714 Ga0207650_10247174 3300025925 Bacteria 1443
715 Ga0207659_10000726 3300025926 Bacteria 19497
716 Ga0207659_10003073 3300025926 Bacteria 9962
717 Ga0207659_10045577 3300025926 Bacteria 3092
718 Ga0207659_10088025 3300025926 Bacteria 2313
719 Ga0207659_10090677 3300025926 Bacteria 2282
720 Ga0207659_10120472 3300025926 Bacteria 2010
721 Ga0207659_10218141 3300025926 Bacteria 1532
722 Ga0207687_10002357 3300025927 Bacteria 12838
723 Ga0207687_10003605 3300025927 Bacteria 10423
724 Ga0207687_10026900 3300025927 Unclassified 3855
725 Ga0207687_10055686 3300025927 Bacteria 2772
726 Ga0207687_10061616 3300025927 Bacteria 2650
727 Ga0207687_10080962 3300025927 Bacteria 2345
728 Ga0207687_10831387 3300025927 Bacteria 788
729 Ga0207700_10035307 3300025928 Unclassified 3600
730 Ga0207700_10296739 3300025928 Unclassified 1394
731 Ga0207700_10427868 3300025928 Unclassified 1164
732 Ga0207644_10026183 3300025931 Unclassified 4016
733 Ga0207644_10028476 3300025931 Bacteria 3868
734 Ga0207644_10060754 3300025931 Bacteria 2735
735 Ga0207644_11674373 3300025931 Unclassified 533
736 Ga0207690_10235165 3300025932 Bacteria 1409
737 Ga0207690_10654109 3300025932 Unclassified 861
738 Ga0207690_10936082 3300025932 Unclassified 719
739 Ga0207706_10009301 3300025933 Bacteria 9023
740 Ga0207706_10045295 3300025933 Bacteria 3898
741 Ga0207706_10054690 3300025933 Bacteria 3522
742 Ga0207706_10061632 3300025933 Bacteria 3303
743 Ga0207706_10581059 3300025933 Bacteria 963
744 Ga0207706_10829271 3300025933 Unclassified 784
745 Ga0207686_10010199 3300025934 Bacteria 5108
746 Ga0207686_10018809 3300025934 Bacteria 3917
747 Ga0207686_10024018 3300025934 Bacteria 3526
748 Ga0207686_10058845 3300025934 Unclassified 2425
749 Ga0207686_10069484 3300025934 Unclassified 2260
750 Ga0207686_10148547 3300025934 Unclassified 1629
751 Ga0207686_10180564 3300025934 Bacteria 1496
752 Ga0207686_10269260 3300025934 Unclassified 1252
753 Ga0207686_10293014 3300025934 Bacteria 1206
754 Ga0207709_10005436 3300025935 Bacteria 7240
755 Ga0207709_10016161 3300025935 Bacteria 4147
756 Ga0207709_10051331 3300025935 Unclassified 2528
757 Ga0207709_10307692 3300025935 Bacteria 1181
758 Ga0207709_11049445 3300025935 Unclassified 668
759 Ga0207709_11271722 3300025935 Unclassified 607
760 Ga0207670_10005770 3300025936 Bacteria 6832
761 Ga0207670_10099410 3300025936 Bacteria 2075
762 Ga0207670_10103355 3300025936 Bacteria 2039
763 Ga0207670_10196224 3300025936 Bacteria 1531
764 Ga0207670_10365846 3300025936 Bacteria 1145
765 Ga0207670_10510616 3300025936 Bacteria 977
766 Ga0207670_10828805 3300025936 Unclassified 772
767 Ga0207669_10003825 3300025937 Bacteria 6559
768 Ga0207669_10147131 3300025937 Bacteria 1644
769 Ga0207669_10678587 3300025937 Bacteria 845
770 Ga0207669_11426062 3300025937 Unclassified 590
771 Ga0207704_10008623 3300025938 Bacteria 4885
772 Ga0207704_10012832 3300025938 Bacteria 4170
773 Ga0207704_10042913 3300025938 Unclassified 2666
774 Ga0207704_10149767 3300025938 Unclassified 1645
775 Ga0207704_10188600 3300025938 Bacteria 1498
776 Ga0207704_10552935 3300025938 Unclassified 936
777 Ga0207704_10572430 3300025938 Unclassified 921
778 Ga0207704_10917595 3300025938 Bacteria 737
779 Ga0207691_10021926 3300025940 Bacteria 6027
780 Ga0207691_10055697 3300025940 Bacteria 3603
781 Ga0207691_10063756 3300025940 Unclassified 3342
782 Ga0207691_10064866 3300025940 Unclassified 3308
783 Ga0207691_10098762 3300025940 Unclassified 2607
784 Ga0207691_10333934 3300025940 Bacteria 1298
785 Ga0207691_10779058 3300025940 Unclassified 804
786 Ga0207711_10000342 3300025941 Bacteria 49421
787 Ga0207711_10009349 3300025941 Bacteria 8185
788 Ga0207711_10020105 3300025941 Bacteria 5563
789 Ga0207711_10043690 3300025941 Bacteria 3824
790 Ga0207711_10249310 3300025941 Bacteria 1630
791 Ga0207711_10562707 3300025941 Bacteria 1063
792 Ga0207711_10975516 3300025941 Bacteria 787
793 Ga0207711_11872147 3300025941 Bacteria 543
794 Ga0207689_10003931 3300025942 Bacteria 13530
795 Ga0207689_10009664 3300025942 Bacteria 8311
796 Ga0207689_10060470 3300025942 Bacteria 3116
797 Ga0207689_10105601 3300025942 Bacteria 2314
798 Ga0207689_10110845 3300025942 Bacteria 2255
799 Ga0207689_10164903 3300025942 Viruses 1826
800 Ga0207689_10217737 3300025942 Bacteria 1578
801 Ga0207689_10426477 3300025942 Bacteria 1107
802 Ga0207689_10710123 3300025942 Bacteria 848
803 Ga0207689_11259247 3300025942 Unclassified 622
804 Ga0207661_10005099 3300025944 Bacteria 9219
805 Ga0207661_10008090 3300025944 Bacteria 7500
806 Ga0207661_10043293 3300025944 Unclassified 3553
807 Ga0207661_10058658 3300025944 Unclassified 3098
808 Ga0207661_10087213 3300025944 Bacteria 2591
809 Ga0207661_10337990 3300025944 Bacteria 1356
810 Ga0207661_10345244 3300025944 Bacteria 1342
811 Ga0207661_10946725 3300025944 Unclassified 793
812 Ga0207679_10024068 3300025945 Unclassified 4172
813 Ga0207679_10108841 3300025945 Bacteria 2183
814 Ga0207679_10204346 3300025945 Unclassified 1652
815 Ga0207679_10312104 3300025945 Bacteria 1359
816 Ga0207679_10445370 3300025945 Bacteria 1148
817 Ga0207667_10003211 3300025949 Bacteria 20189
818 Ga0207667_10009573 3300025949 Bacteria 11401
819 Ga0207667_10032373 3300025949 Bacteria 5636
820 Ga0207667_10141050 3300025949 Bacteria 2481
821 Ga0207667_10171662 3300025949 Bacteria 2228
822 Ga0207651_10006064 3300025960 Bacteria 6280
823 Ga0207651_10010414 3300025960 Bacteria 5155
824 Ga0207651_10017293 3300025960 Bacteria 4256
825 Ga0207651_10151471 3300025960 Bacteria 1806
826 Ga0207651_10201759 3300025960 Bacteria 1594
827 Ga0207651_10213306 3300025960 Bacteria 1555
828 Ga0207651_10229888 3300025960 Bacteria 1505
829 Ga0207651_10322090 3300025960 Bacteria 1292
830 Ga0207712_10238318 3300025961 Bacteria 1464
831 Ga0207712_10264433 3300025961 Bacteria 1396
832 Ga0207712_10505596 3300025961 Unclassified 1033
833 Ga0207712_10555735 3300025961 Bacteria 988
834 Ga0207712_10599467 3300025961 Bacteria 953
835 Ga0207712_11559829 3300025961 Unclassified 592
836 Ga0207668_10033425 3300025972 Unclassified 3407
837 Ga0207668_10104947 3300025972 Bacteria 2108
838 Ga0207668_10798828 3300025972 Bacteria 835
839 Ga0207640_10058539 3300025981 Unclassified 2539
840 Ga0207640_10248067 3300025981 Bacteria 1380
841 Ga0207640_11705955 3300025981 Bacteria 569
842 Ga0207658_10455901 3300025986 Bacteria 1133
843 Ga0207658_10769747 3300025986 Unclassified 873
844 Ga0207658_10775242 3300025986 Bacteria 869
845 Ga0207677_10377706 3300026023 Bacteria 1195
846 Ga0207677_10805736 3300026023 Unclassified 841
847 Ga0207677_10931563 3300026023 Unclassified 785
848 Ga0207703_10019568 3300026035 Bacteria 5291
849 Ga0207703_10025716 3300026035 Bacteria 4631
850 Ga0207703_10101243 3300026035 Bacteria 2442
851 Ga0207703_10107008 3300026035 Bacteria 2380
852 Ga0207703_10135402 3300026035 Bacteria 2132
853 Ga0207703_10215527 3300026035 Bacteria 1714
854 Ga0207703_10434905 3300026035 Bacteria 1223
855 Ga0207703_10491215 3300026035 Bacteria 1151
856 Ga0207703_11156583 3300026035 Bacteria 744
857 Ga0207639_10066477 3300026041 Bacteria 2802
858 Ga0207639_10068096 3300026041 Unclassified 2772
859 Ga0207639_10326808 3300026041 Unclassified 1363
860 Ga0207639_10355922 3300026041 Unclassified 1309
861 Ga0207639_10390590 3300026041 Bacteria 1251
862 Ga0207678_10186485 3300026067 Bacteria 1772
863 Ga0207708_10017373 3300026075 Bacteria 5416
864 Ga0207708_10020438 3300026075 Bacteria 4994
865 Ga0207708_10045783 3300026075 Unclassified 3334
866 Ga0207708_10106910 3300026075 Bacteria 2170
867 Ga0207708_11795648 3300026075 Unclassified 538
868 Ga0207708_11947547 3300026075 Unclassified 515
869 Ga0207702_10005246 3300026078 Bacteria 11377
870 Ga0207702_10047871 3300026078 Bacteria 3604
871 Ga0207702_10147795 3300026078 Bacteria 2135
872 Ga0207702_10261594 3300026078 Unclassified 1629
873 Ga0207702_10274331 3300026078 Bacteria 1592
874 Ga0207702_10529960 3300026078 Unclassified 1150
875 Ga0207702_10545814 3300026078 Unclassified 1133
876 Ga0207641_10035499 3300026088 Unclassified 4154
877 Ga0207641_10086199 3300026088 Bacteria 2738
878 Ga0207641_10142164 3300026088 Unclassified 2166
879 Ga0207641_10580195 3300026088 Bacteria 1096
880 Ga0207641_10984121 3300026088 Bacteria 840
881 Ga0207641_10997502 3300026088 Bacteria 834
882 Ga0207641_11185301 3300026088 Bacteria 763
883 Ga0207648_10003945 3300026089 Bacteria 15434
884 Ga0207648_10018835 3300026089 Bacteria 6239
885 Ga0207648_10019273 3300026089 Bacteria 6159
886 Ga0207648_10025354 3300026089 Bacteria 5284
887 Ga0207648_10035630 3300026089 Unclassified 4384
888 Ga0207648_10104897 3300026089 Bacteria 2479
889 Ga0207648_10175432 3300026089 Bacteria 1895
890 Ga0207648_10226907 3300026089 Bacteria 1661
891 Ga0207648_10262897 3300026089 Bacteria 1540
892 Ga0207648_10309254 3300026089 Bacteria 1418
893 Ga0207648_10429152 3300026089 Bacteria 1201
894 Ga0207648_10797051 3300026089 Bacteria 879
895 Ga0207648_10976299 3300026089 Unclassified 793
896 Ga0207648_11365668 3300026089 Unclassified 666
897 Ga0207676_10040361 3300026095 Bacteria 3577
898 Ga0207676_10044689 3300026095 Bacteria 3419
899 Ga0207676_10166965 3300026095 Unclassified 1913
900 Ga0207676_11159103 3300026095 Unclassified 765
901 Ga0207676_11608905 3300026095 Unclassified 647
902 Ga0207676_12540293 3300026095 Unclassified 509
903 Ga0207674_10001765 3300026116 Bacteria 27659
904 Ga0207674_10012664 3300026116 Bacteria 9424
905 Ga0207674_10048681 3300026116 Bacteria 4338
906 Ga0207674_10050355 3300026116 Unclassified 4256
907 Ga0207674_10058693 3300026116 Bacteria 3897
908 Ga0207674_10223020 3300026116 Bacteria 1833
909 Ga0207674_10298481 3300026116 Unclassified 1560
910 Ga0207674_10663864 3300026116 Bacteria 1007
911 Ga0207674_11174578 3300026116 Bacteria 737
912 Ga0207675_100001637 3300026118 Bacteria 22454
913 Ga0207675_100017102 3300026118 Bacteria 6772
914 Ga0207675_100022288 3300026118 Bacteria 5897
915 Ga0207675_100048376 3300026118 Bacteria 3969
916 Ga0207675_100122370 3300026118 Bacteria 2463
917 Ga0207675_100232072 3300026118 Bacteria 1781
918 Ga0207675_100628842 3300026118 Unclassified 1078
919 Ga0207675_100646833 3300026118 Bacteria 1063
920 Ga0207675_100812753 3300026118 Bacteria 949
921 Ga0207683_10009184 3300026121 Bacteria 8424
922 Ga0207683_10054261 3300026121 Unclassified 3514
923 Ga0207683_10097166 3300026121 Bacteria 2626
924 Ga0207683_10303670 3300026121 Bacteria 1460
925 Ga0207683_10316897 3300026121 Bacteria 1428
926 Ga0207683_10664172 3300026121 Bacteria 966
927 Ga0207683_10803045 3300026121 Bacteria 873
928 Ga0207698_10030727 3300026142 Unclassified 3868
929 Ga0207698_10091810 3300026142 Bacteria 2487
930 Ga0207698_10480190 3300026142 Bacteria 1205
931 Ga0207698_10804404 3300026142 Unclassified 942
932 Ga0207698_10817049 3300026142 Unclassified 935
933 Ga0207698_11771031 3300026142 Unclassified 633
934 Ga0209996_1060768 3300027395 Unclassified 580
935 Ga0209968_1033876 3300027526 Unclassified 860
936 Ga0207428_10000986 3300027907 Bacteria 31515
937 Ga0207428_10004387 3300027907 Bacteria 13451
938 Ga0207428_10361777 3300027907 Bacteria 1066
939 Ga0207428_10700454 3300027907 Bacteria 724
940 Ga0268266_10026277 3300028379 Unclassified 4954
941 Ga0268266_10110959 3300028379 Bacteria 2430
942 Ga0268265_10001817 3300028380 Bacteria 17054
943 Ga0268265_10025542 3300028380 Unclassified 4195
944 Ga0268264_10002343 3300028381 Bacteria 16749
945 Ga0268264_10053776 3300028381 Bacteria 3360
946 Ga0268264_10071606 3300028381 Bacteria 2938
947 Ga0268264_10196846 3300028381 Bacteria 1841
948 Ga0268264_10225866 3300028381 Bacteria 1726
949 Ga0268264_10372553 3300028381 Unclassified 1365
950 Ga0268264_10416631 3300028381 Unclassified 1294
951 Ga0268264_10844520 3300028381 Unclassified 917
952 Ga0268264_10925075 3300028381 Bacteria 876
953 Ga0268264_11044295 3300028381 Unclassified 824
954 Ga0268264_11817961 3300028381 Unclassified 619
955 Ga0265762_1078418 3300030760 Bacteria 704
956 Ga0265760_10039341 3300031090 Unclassified 1407
957 Ga0265314_10003122 3300031711 Bacteria 16288
958 Ga0307416_100229966 3300032002 Unclassified 1787
959 Ga0373934_0000376 3300035086 Bacteria 15611
960 Ga0373934_0047781 3300035086 Bacteria 1693
961 Ga0373934_0105131 3300035086 Bacteria 1143
962 Ga0373940_0111804 3300035088 Bacteria 839
963 Ga0373949_0047917 3300035090 Bacteria 1069
964 Ga0373932_0100219 3300035112 Bacteria 941
965 Ga0373941_0430996 3300035115 Unclassified 550
966 Ga0373953_0008851 3300035117 Bacteria 3436
967 Ga0373953_0037484 3300035117 Unclassified 1914
968 Ga0373953_0092149 3300035117 Bacteria 1268
969 Ga0373953_0287218 3300035117 Bacteria 717
970 Ga0373954_0000350 3300035118 Bacteria 16985
971 Ga0373954_0000935 3300035118 Bacteria 11356
972 Ga0373954_0001398 3300035118 Bacteria 9777
973 Ga0373954_0006742 3300035118 Bacteria 5010
974 Ga0373954_0352894 3300035118 Unclassified 726
975 Ga0373956_0162962 3300035119 Bacteria 1051
976 Ga0373956_0180697 3300035119 Unclassified 997
977 Ga0373956_0635659 3300035119 Unclassified 509
978 Ga0373957_0001881 3300035120 Bacteria 5828
979 Ga0373960_0115180 3300035121 Bacteria 886
980 Ga0373955_0043575 3300035172 Bacteria 2414
981 Ga0373961_0011244 3300035241 Bacteria 2219
982 Ga0373961_0387892 3300035241 Unclassified 534
983 Ga0373931_0509328 3300035691 Unclassified 777
984 Ga0373931_0686574 3300035691 Unclassified 675
985 Ga0373935_0091475 3300035692 Bacteria 1993
986 Ga0373927_0105607 3300035695 Unclassified 1834
987 Ga0373927_0464574 3300035695 Unclassified 836
988 Ga0373933_0014824 3300035724 Bacteria 4337
989 Ga0373933_0015115 3300035724 Bacteria 4303
990 Ga0373933_0234548 3300035724 Bacteria 1179
991 Ga0373933_0497722 3300035724 Bacteria 798
992 Ga0373933_0594695 3300035724 Unclassified 726
993 Ga0373933_0894118 3300035724 Bacteria 585
994 Ga0373947_0646041 3300035725 Unclassified 721
995 Ga0373937_0002174 3300036401 Bacteria 16408
996 Ga0373937_0005074 3300036401 Bacteria 11209
997 Ga0373937_0005118 3300036401 Bacteria 11172
998 Ga0373937_0007547 3300036401 Bacteria 9420
999 Ga0373937_0011117 3300036401 Bacteria 7889
1000 Ga0373937_0031595 3300036401 Unclassified 4799
1001 Ga0373937_0244870 3300036401 Bacteria 1690
1002 Ga0373937_0354287 3300036401 Bacteria 1390
1003 Ga0373937_0572310 3300036401 Unclassified 1073
1004 Ga0373937_1134027 3300036401 Bacteria 731
1005 Ga0373925_0086373 3300037068 Bacteria 2393
1006 Ga0373925_0110419 3300037068 Bacteria 2124
1007 Ga0373925_0394537 3300037068 Bacteria 1128
1008 Ga0373925_0574429 3300037068 Unclassified 928
1009 Ga0373925_1048003 3300037068 Unclassified 671
1010 Ga0436364_1138878 3300037853 Bacteria 1942
1011 Ga0436363_0546662 3300039450 Unclassified 658
1012 Ga0436363_0635755 3300039450 Unclassified 580
1013 Ga0436362_0188994 3300039453 Unclassified 530
1014 Ga0439464_0069982 3300042439 Bacteria 1037
1015 Ga0451577_0773381 3300042876 Unclassified 868
1016 Ga0453683_0851988 3300044673 Unclassified 601
1017 Ga0451576_0031110 3300045051 Bacteria 5693
1018 Ga0451576_0086745 3300045051 Bacteria 3255
1019 Ga0451576_0107691 3300045051 Bacteria 2900
1020 Ga0451576_0712302 3300045051 Bacteria 1054
1021 Ga0451576_0801062 3300045051 Unclassified 989
1022 Ga0495592_0122741 3300046454 Unclassified 1825
1023 Ga0495641_0356437 3300046461 Bacteria 662
1024 Ga0495651_0385634 3300046462 Unclassified 918
1025 Ga0495651_0548110 3300046462 Unclassified 735
1026 Ga0495580_0033712 3300046472 Unclassified 3688
1027 Ga0495580_0043694 3300046472 Bacteria 3189
1028 Ga0495580_0646323 3300046472 Unclassified 696
1029 Ga0495582_0201285 3300046473 Unclassified 1137
1030 Ga0495608_0145613 3300046511 Bacteria 1511
1031 Ga0495628_0955427 3300046516 Bacteria 592
1032 Ga0495630_0547161 3300046517 Bacteria 888
1033 Ga0495630_1500837 3300046517 Bacteria 506
1034 Ga0495644_0215317 3300046523 Bacteria 742
1035 Ga0495642_0355345 3300046528 Unclassified 644
1036 Ga0495652_0006912 3300046529 Bacteria 10501
1037 Ga0495665_0097187 3300046531 Bacteria 1546
1038 Ga0495665_0184212 3300046531 Unclassified 1084
1039 Ga0495640_0479591 3300046533 Bacteria 758
1040 Ga0495586_0161832 3300046535 Unclassified 1262
1041 Ga0495586_0214424 3300046535 Bacteria 1093
1042 Ga0495587_0142205 3300046536 Bacteria 1369
1043 Ga0495587_0298598 3300046536 Bacteria 901
1044 Ga0495587_0507361 3300046536 Unclassified 667
1045 Ga0495598_0032282 3300046537 Bacteria 1479
1046 Ga0495597_0199490 3300046542 Unclassified 802
1047 Ga0495645_0021213 3300046543 Unclassified 4695
1048 Ga0495667_0038465 3300046559 Unclassified 3185
1049 Ga0495656_0108088 3300046615 Bacteria 1297
1050 Ga0495656_0326512 3300046615 Bacteria 791
1051 Ga0495634_0123994 3300046642 Unclassified 1652
1052 Ga0495634_0249624 3300046642 Bacteria 1086
1053 Ga0495659_0037097 3300046664 Bacteria 1725
1054 Ga0495588_0162062 3300046674 Bacteria 1183
1055 Ga0495599_0001991 3300046678 Bacteria 11814
1056 Ga0495623_0186866 3300046679 Bacteria 1200
1057 Ga0495658_0020114 3300046683 Bacteria 3497
1058 Ga0495613_0027552 3300046689 Bacteria 4229
1059 Ga0495613_0296911 3300046689 Unclassified 1119
1060 Ga0495600_0298326 3300046809 Unclassified 1017
1061 Ga0495604_0112088 3300047317 Bacteria 1988
1062 Ga0495636_0017086 3300047318 Bacteria 2903
1063 Ga0495674_0579368 3300047319 Bacteria 891
1064 Ga0495680_0126597 3300047322 Bacteria 1881
1065 Ga0495680_0193981 3300047322 Bacteria 1460
1066 Ga0495680_0207404 3300047322 Bacteria 1404
1067 Ga0495680_0518060 3300047322 Unclassified 807
1068 Ga0495675_0038181 3300047444 Bacteria 3058
1069 Ga0495675_0503833 3300047444 Unclassified 695
1070 Ga0495684_0006087 3300047471 Bacteria 9383
1071 Ga0495684_0017963 3300047471 Bacteria 5449
1072 Ga0495684_0020127 3300047471 Bacteria 5138
1073 Ga0495684_0211261 3300047471 Bacteria 1427
1074 Ga0495602_0453031 3300048088 Unclassified 905
1075 Ga0496100_0017245 3300048903 Bacteria 4259
1076 Ga0496101_0006359 3300048904 Bacteria 7605
1077 Ga0496102_0109248 3300048905 Bacteria 2577
1078 Ga0496104_0139245 3300048907 Bacteria 2332
1079 Ga0496104_0342995 3300048907 Unclassified 1407
1080 Ga0496104_0727354 3300048907 Unclassified 900
1081 Ga0496106_0035342 3300048909 Bacteria 3737
1082 Ga0496106_1043358 3300048909 Unclassified 642
1083 Ga0496106_1469377 3300048909 Unclassified 525
1084 Ga0496112_0223205 3300048915 Bacteria 1840
1085 Ga0496112_1371074 3300048915 Unclassified 622
1086 Ga0496114_0002532 3300048917 Bacteria 13959
1087 Ga0496114_0539275 3300048917 Unclassified 1031
1088 Ga0496115_0387577 3300048918 Bacteria 1135
1089 Ga0501033_0625600 3300049570 Unclassified 737
1090 Ga0501036_0016212 3300049572 Bacteria 6223
1091 Ga0501038_0736700 3300049574 Unclassified 736
1092 Ga0501039_0289807 3300049575 Bacteria 1287
1093 Ga0501040_0044231 3300049576 Bacteria 3036
1094 Ga0501041_0016496 3300049577 Bacteria 4391
1095 Ga0501041_0200472 3300049577 Bacteria 1251
1096 Ga0501042_0410391 3300049578 Unclassified 981
1097 Ga0501046_0016197 3300049580 Bacteria 6249
1098 Ga0501068_0353240 3300049584 Unclassified 945
1099 Ga0501072_1024170 3300049588 Bacteria 643
1100 Ga0501075_0549821 3300049591 Unclassified 881
1101 Ga0501076_0014376 3300049592 Bacteria 5962
1102 Ga0501079_0003042 3300049741 Bacteria 12278
1103 Ga0501081_0154815 3300049743 Bacteria 1648
1104 Ga0501045_0761787 3300049824 Unclassified 713
1105 nmdc:mga05p37_245414_c1 3300050507 Bacteria 2150
1106 nmdc:mga05p37_36011_c1 3300050507 Bacteria 6072
1107 nmdc:mga05p37_3678_c1 3300050507 Bacteria 17931
1108 nmdc:mga05p37_4305_c1 3300050507 Bacteria 16620
1109 nmdc:mga05p37_54320_c1 3300050507 Bacteria 1797
1110 nmdc:mga05p37_69413_c1 3300050507 Bacteria 4335
1111 nmdc:mga05p37_777690_c1 3300050507 Unclassified 1051
1112 nmdc:mga09592_107377_c1 3300050508 Unclassified 2394
1113 nmdc:mga09592_119986_c1 3300050508 Bacteria 2258
1114 nmdc:mga09592_15185_c1 3300050508 Bacteria 6293
1115 nmdc:mga0qj67_1031_c1 3300050509 Bacteria 19266
1116 nmdc:mga0qj67_889323_c1 3300050509 Unclassified 702
1117 nmdc:mga06r32_92505_c1 3300050510 Unclassified 2957
1118 nmdc:mga06r32_9715_c1 3300050510 Bacteria 8691
1119 nmdc:mga08y16_109136_c1 3300050511 Unclassified 2881
1120 nmdc:mga08y16_1160642_c1 3300050511 Bacteria 745
1121 nmdc:mga08y16_12324_c1 3300050511 Bacteria 8991
1122 nmdc:mga08y16_31440_c1 3300050511 Bacteria 5583
1123 nmdc:mga08y16_561780_c1 3300050511 Bacteria 1154
1124 nmdc:mga08y16_784347_c1 3300050511 Bacteria 947
1125 nmdc:mga0n895_1034525_c1 3300050512 Bacteria 801
1126 nmdc:mga0n895_1118260_c1 3300050512 Unclassified 765
1127 nmdc:mga0n895_5526_c1 3300050512 Bacteria 10582
1128 nmdc:mga0n895_590198_c1 3300050512 Unclassified 1114
1129 nmdc:mga0n895_61306_c1 3300050512 Unclassified 3713
1130 nmdc:mga0n895_69297_c1 3300050512 Bacteria 3494
1131 nmdc:mga0n895_7683_c1 3300050512 Bacteria 9275
1132 nmdc:mga0n895_963186_c1 3300050512 Unclassified 836
1133 nmdc:mga0rr50_181033_c1 3300050513 Bacteria 1723
1134 nmdc:mga0rr50_243166_c1 3300050513 Bacteria 1492
1135 nmdc:mga0rr50_361212_c1 3300050513 Bacteria 1222
1136 nmdc:mga0rr50_63211_c1 3300050513 Unclassified 2795
1137 nmdc:mga0rr50_79805_c1 3300050513 Bacteria 2521
1138 nmdc:mga08x19_1166421_c1 3300050514 Unclassified 546
1139 nmdc:mga08x19_69351_c1 3300050514 Unclassified 2296
1140 nmdc:mga0a205_131939_c1 3300050515 Unclassified 2399
1141 nmdc:mga0a205_1627_c1 3300050515 Bacteria 19317
1142 nmdc:mga0a205_190191_c1 3300050515 Bacteria 1945
1143 nmdc:mga0a205_537800_c1 3300050515 Bacteria 1024
1144 nmdc:mga0a205_58889_c1 3300050515 Bacteria 3710
1145 nmdc:mga0a205_806302_c1 3300050515 Unclassified 787
1146 Ga0495601_0127376 3300053077 Unclassified 1657
1147 Ga0495595_0750858 3300053084 Unclassified 501
1148 Ga0495619_0170709 3300053085 Unclassified 1504
1149 Ga0501084_0006540 3300054114 Bacteria 9578
1150 Ga0501082_0017413 3300060353 Bacteria 6190
1151 Ga0530510_0062594 3300061734 Bacteria 2693
1152 Ga0105245_10076513
1153 JGI24750J21931_1070484
1154 JGI24742J22300_10128337
1155 Ga0065714_10320666
1156 Ga0065712_10004025
1157 Ga0065712_10158284
1158 Ga0065715_10000766
1159 Ga0065715_10057764
1160 Ga0065707_10004492
1161 Ga0065707_10023923
1162 Ga0065707_10118664
1163 Ga0070676_10002130
1164 Ga0070676_10048093
1165 Ga0070676_10414367
1166 Ga0070676_11024512
1167 Ga0070683_100077941
1168 Ga0070683_100146928
1169 Ga0070683_100779229
1170 Ga0070683_101106159
1171 Ga0070690_100035456
1172 Ga0070690_100067424
1173 Ga0070690_100094602
1174 Ga0070690_100584678
1175 Ga0070690_100643323
1176 Ga0070690_100667856
1177 Ga0070690_101470421
1178 Ga0070670_100001376
1179 Ga0070670_100004397
1180 Ga0070670_100019553
1181 Ga0070670_101534914
1182 Ga0070677_10002121
1183 Ga0070677_10004228
1184 Ga0070677_10010228
1185 Ga0068869_100006944
1186 Ga0068869_100008081
1187 Ga0068869_100021377
1188 Ga0068869_100075528
1189 Ga0068869_100144020
1190 Ga0068869_100485186
1191 Ga0070666_10004014
1192 Ga0070666_10097527
1193 Ga0070666_10173254
1194 Ga0070666_10320909
1195 Ga0070666_10460392
1196 Ga0070680_100727533
1197 Ga0070682_100482790
1198 Ga0070682_100945636
1199 Ga0068868_100028746
1200 Ga0068868_100089529
1201 Ga0068868_101140055
1202 Ga0070660_100028114
1203 Ga0070660_100631980
1204 Ga0070689_100009058
1205 Ga0070689_100013527
1206 Ga0070689_100030022
1207 Ga0070689_100133112
1208 Ga0070689_101185293
1209 Ga0070689_101241118
1210 Ga0070689_101975288
1211 Ga0070691_10004994
1212 Ga0070691_11078052
1213 Ga0070687_100004620
1214 Ga0070687_100009945
1215 Ga0070687_100024088
1216 Ga0070661_100009957
1217 Ga0070661_100102423
1218 Ga0070661_100670914
1219 Ga0070692_10078733
1220 Ga0070692_10323632
1221 Ga0070692_11079316
1222 Ga0070668_100045307
1223 Ga0070668_100070669
1224 Ga0070668_101061616
1225 Ga0070668_101176370
1226 Ga0070669_100012416
1227 Ga0070669_100060674
1228 Ga0070669_100411049
1229 Ga0070669_100467023
1230 Ga0070669_101138583
1231 Ga0070669_101173617
1232 Ga0070675_100001521
1233 Ga0070675_100003288
1234 Ga0070675_100023946
1235 Ga0070675_100113344
1236 Ga0070675_100127903
1237 Ga0070675_100182487
1238 Ga0070675_100952594
1239 Ga0070671_100006397
1240 Ga0070671_100041594
1241 Ga0070671_100065471
1242 Ga0070671_100224783
1243 Ga0070671_101723623
1244 Ga0070674_100001992
1245 Ga0070674_100156985
1246 Ga0070674_100518021
1247 Ga0070674_100831246
1248 Ga0070673_100013101
1249 Ga0070673_100043845
1250 Ga0070673_100135883
1251 Ga0070673_100207522
1252 Ga0070673_100362668
1253 Ga0070673_100373248
1254 Ga0070673_100495249
1255 Ga0070673_100552490
1256 Ga0070688_100004251
1257 Ga0070688_100020983
1258 Ga0070688_100030277
1259 Ga0070688_100088699
1260 Ga0070688_100509177
1261 Ga0070688_101659293
1262 Ga0070659_100070829
1263 Ga0070659_100258750
1264 Ga0070659_100297110
1265 Ga0070659_100471592
1266 Ga0070667_100021283
1267 Ga0070667_100620397
1268 Ga0070703_10264793
1269 Ga0070709_10191112
1270 Ga0070713_100190238
1271 Ga0070713_100231938
1272 Ga0070710_10529894
1273 Ga0070710_10798294
1274 Ga0070701_10050245
1275 Ga0070701_10054352
1276 Ga0070701_10135373
1277 Ga0070701_10594376
1278 Ga0070701_10989098
1279 Ga0070711_100078558
1280 Ga0070711_100766664
1281 Ga0070705_100000409
1282 Ga0070705_100006513
1283 Ga0070705_100065077
1284 Ga0070705_100071149
1285 Ga0070705_101076117
1286 Ga0070705_101131408
1287 Ga0070700_100008474
1288 Ga0070700_100053330
1289 Ga0070694_100015841
1290 Ga0070694_100027628
1291 Ga0070694_100046602
1292 Ga0070694_100111506
1293 Ga0070694_100485903
1294 Ga0070694_100505429
1295 Ga0070708_100280275
1296 Ga0070708_100315854
1297 Ga0070708_100555176
1298 Ga0070708_101072349
1299 Ga0070663_100698133
1300 Ga0070678_100086413
1301 Ga0070678_100108054
1302 Ga0070678_100237148
1303 Ga0070678_100981241
1304 Ga0070678_101503576
1305 Ga0070662_100025944
1306 Ga0070662_100028891
1307 Ga0070662_100041285
1308 Ga0070662_100044446
1309 Ga0070662_100438280
1310 Ga0070662_101362747
1311 Ga0070681_10044836
1312 Ga0070681_10189217
1313 Ga0070681_10315014
1314 Ga0070681_10350788
1315 Ga0070681_11272787
1316 Ga0068867_100009440
1317 Ga0068867_100013742
1318 Ga0068867_100019384
1319 Ga0068867_100097892
1320 Ga0068867_100213309
1321 Ga0068867_100228021
1322 Ga0068867_100275791
1323 Ga0068867_100306445
1324 Ga0068867_100609693
1325 Ga0068867_100632200
1326 Ga0068867_100711690
1327 Ga0068867_100903960
1328 Ga0068867_100935571
1329 Ga0068867_102265460
1330 Ga0070685_10004167
1331 Ga0070685_10130794
1332 Ga0070706_100810115
1333 Ga0070706_100856739
1334 Ga0070706_101465729
1335 Ga0070707_100124549
1336 Ga0070707_100309931
1337 Ga0070707_100356008
1338 Ga0070707_100570644
1339 Ga0070707_100584661
1340 Ga0070698_100008437
1341 Ga0070698_100050520
1342 Ga0070698_100060971
1343 Ga0070698_100789690
1344 Ga0070698_101813752
1345 Ga0070698_102153942
1346 Ga0070699_100005570
1347 Ga0070699_100006887
1348 Ga0070699_100021255
1349 Ga0070699_100111782
1350 Ga0070699_100547452
1351 Ga0070699_100823973
1352 Ga0070679_100000937
1353 Ga0070679_100591614
1354 Ga0070679_100628067
1355 Ga0070684_100000220
1356 Ga0070684_100033979
1357 Ga0070684_100058609
1358 Ga0070684_100079422
1359 Ga0070684_100272009
1360 Ga0070684_100277320
1361 Ga0070684_100395913
1362 Ga0070684_100523744
1363 Ga0070697_100038660
1364 Ga0070697_101047296
1365 Ga0068853_100009310
1366 Ga0068853_100315548
1367 Ga0068853_100572665
1368 Ga0070672_100013202
1369 Ga0070672_100024022
1370 Ga0070672_100038806
1371 Ga0070672_100216377
1372 Ga0070672_100285181
1373 Ga0070672_100415658
1374 Ga0070672_100479835
1375 Ga0070686_100008216
1376 Ga0070686_100039392
1377 Ga0070686_100354280
1378 Ga0070686_101247657
1379 Ga0070695_100000063
1380 Ga0070695_100471741
1381 Ga0070695_101309635
1382 Ga0070696_100000064
1383 Ga0070696_100006244
1384 Ga0070696_100022663
1385 Ga0070696_100026342
1386 Ga0070696_100565622
1387 Ga0070693_101331948
1388 Ga0070665_100009896
1389 Ga0070665_100262390
1390 Ga0070704_100010532
1391 Ga0070704_100039327
1392 Ga0070704_100058306
1393 Ga0070704_100100992
1394 Ga0070704_100266263
1395 Ga0070704_100462718
1396 Ga0070704_101864830
1397 Ga0068855_100008856
1398 Ga0068855_100084626
1399 Ga0068855_100121694
1400 Ga0068855_100623617
1401 Ga0070664_100005747
1402 Ga0070664_100147595
1403 Ga0070664_100394524
1404 Ga0070664_100543121
1405 Ga0068857_100009482
1406 Ga0068857_100025305
1407 Ga0068857_100027803
1408 Ga0068857_100047994
1409 Ga0068857_100072561
1410 Ga0068857_100196133
1411 Ga0068857_100945624
1412 Ga0068854_100014894
1413 Ga0068854_100222872
1414 Ga0068854_101815217
1415 Ga0068854_101967528
1416 Ga0068856_100039344
1417 Ga0068856_100041958
1418 Ga0068856_100146923
1419 Ga0068856_100163258
1420 Ga0068856_100259219
1421 Ga0068856_100296875
1422 Ga0068856_100396143
1423 Ga0068856_100527098
1424 Ga0068856_100657821
1425 Ga0068856_102123550
1426 Ga0070702_100002366
1427 Ga0070702_100061746
1428 Ga0070702_100202611
1429 Ga0070702_100233231
1430 Ga0068852_100020042
1431 Ga0068852_100053272
1432 Ga0068852_100470696
1433 Ga0068852_101033047
1434 Ga0068859_100008792
1435 Ga0068859_100013417
1436 Ga0068859_100133533
1437 Ga0068859_100137164
1438 Ga0068859_100403507
1439 Ga0068859_100959951
1440 Ga0068859_101314117
1441 Ga0068859_101733187
1442 Ga0068864_100029090
1443 Ga0068864_100060069
1444 Ga0068864_100209586
1445 Ga0068864_100217175
1446 Ga0068864_100885136
1447 Ga0068866_10007943
1448 Ga0068866_10140289
1449 Ga0068866_10203369
1450 Ga0068861_100000410
1451 Ga0068861_100017323
1452 Ga0068861_100055161
1453 Ga0068861_100410199
1454 Ga0068861_100819868
1455 Ga0068861_101207383
1456 Ga0068851_10010649
1457 Ga0068851_10467994
1458 Ga0068870_10000872
1459 Ga0068870_10004033
1460 Ga0068870_10021478
1461 Ga0068870_10155288
1462 Ga0068870_10214742
1463 Ga0068870_10287168
1464 Ga0068870_10348530
1465 Ga0068870_10950660
1466 Ga0068870_11038272
1467 Ga0068863_100002061
1468 Ga0068863_100068374
1469 Ga0068863_100069788
1470 Ga0068863_100089605
1471 Ga0068863_101589276
1472 Ga0068863_102284085
1473 Ga0068858_100018687
1474 Ga0068858_100058040
1475 Ga0068858_100122236
1476 Ga0068858_100308191
1477 Ga0068858_101290364
1478 Ga0068858_101342782
1479 Ga0068860_100002194
1480 Ga0068860_100023907
1481 Ga0068860_100028328
1482 Ga0068860_100070347
1483 Ga0068860_100303771
1484 Ga0068860_100423539
1485 Ga0068860_100456534
1486 Ga0068860_100511543
1487 Ga0068860_100873152
1488 Ga0068860_100990675
1489 Ga0068860_101052916
1490 Ga0068860_101343123
1491 Ga0068860_101929773
1492 Ga0068862_100003220
1493 Ga0068862_100569162
1494 Ga0068862_101685687
1495 Ga0081455_10116340
1496 Ga0081455_10489905
1497 Ga0070717_10923740
1498 Ga0097621_100029485
1499 Ga0097621_100039382
1500 Ga0097621_100039987
1501 Ga0097621_100048756
1502 Ga0097621_100080595
1503 Ga0097621_100123936
1504 Ga0097621_100130234
1505 Ga0097621_100157845
1506 Ga0097621_100537675
1507 Ga0097621_100653481
1508 Ga0097621_101375952
1509 Ga0068871_100013498
1510 Ga0068871_100019371
1511 Ga0068871_100020714
1512 Ga0068871_100024112
1513 Ga0068871_100053946
1514 Ga0068871_100079486
1515 Ga0068871_100117842
1516 Ga0068871_100162161
1517 Ga0068871_100588501
1518 Ga0068871_100621333
1519 Ga0068871_100709966
1520 Ga0068871_100738288
1521 Ga0075428_100033591
1522 Ga0075428_100037354
1523 Ga0075428_100085873
1524 Ga0075428_100120531
1525 Ga0075428_100133559
1526 Ga0075428_100172891
1527 Ga0075428_100217301
1528 Ga0075428_101246106
1529 Ga0075428_101567422
1530 Ga0075430_100003769
1531 Ga0075430_100089728
1532 Ga0075431_100018585
1533 Ga0075431_100129847
1534 Ga0075431_101159055
1535 Ga0075433_10002662
1536 Ga0075433_10120708
1537 Ga0075433_10158456
1538 Ga0075433_10330313
1539 Ga0075433_10590156
1540 Ga0075433_10696772
1541 Ga0075434_100047389
1542 Ga0075434_100085384
1543 Ga0075434_100096545
1544 Ga0075434_100119420
1545 Ga0075434_100140198
1546 Ga0075434_100165630
1547 Ga0075434_100233006
1548 Ga0075434_100306602
1549 Ga0075434_100328658
1550 Ga0075434_100425718
1551 Ga0075434_100685161
1552 Ga0075434_101152270
1553 Ga0075434_102470681
1554 Ga0075429_100049770
1555 Ga0075429_100117268
1556 Ga0075429_100194529
1557 Ga0075429_100339637
1558 Ga0075429_100476534
1559 Ga0068865_100010239
1560 Ga0068865_100013640
1561 Ga0068865_100114681
1562 Ga0068865_100133264
1563 Ga0068865_100211295
1564 Ga0068865_100219518
1565 Ga0068865_100417728
1566 Ga0068865_100594296
1567 Ga0075436_100663870
1568 Ga0075436_100847908
1569 Ga0097620_100008792
1570 Ga0097620_100013417
1571 Ga0097620_100133539
1572 Ga0097620_100137166
1573 Ga0097620_100403527
1574 Ga0097620_100959881
1575 Ga0097620_101314188
1576 Ga0097620_101733172
1577 Ga0075435_100022668
1578 Ga0075435_100040029
1579 Ga0075435_100113926
1580 Ga0075435_100149793
1581 Ga0075435_100304615
1582 Ga0075435_100304728
1583 Ga0075435_100351842
1584 Ga0075435_100595014
1585 Ga0075435_100948791
1586 Ga0075435_100968742
1587 Ga0099794_10039852
1588 Ga0105240_10003663
1589 Ga0105240_10020135
1590 Ga0105240_10064169
1591 Ga0105240_10166412
1592 Ga0105240_10227599
1593 Ga0105240_11440380
1594 Ga0111539_10016172
1595 Ga0111539_10044634
1596 Ga0111539_10070479
1597 Ga0111539_10175430
1598 Ga0111539_10251201
1599 Ga0111539_10704830
1600 Ga0111539_10730743
1601 Ga0105245_10006391
1602 Ga0105245_10010932
1603 Ga0105245_10205035
1604 Ga0105245_10223273
1605 Ga0105245_10852495
1606 Ga0105245_10966040
1607 Ga0105245_10969270
1608 Ga0105245_10997376
1609 Ga0105245_11406372
1610 Ga0105245_11494283
1611 Ga0105245_12271001
1612 Ga0105245_12293727
1613 Ga0105245_12337930
1614 Ga0105247_10006873
1615 Ga0105247_10702164
1616 Ga0114129_10002325
1617 Ga0114129_10025741
1618 Ga0114129_10029196
1619 Ga0114129_10050075
1620 Ga0114129_10069233
1621 Ga0114129_10478082
1622 Ga0114129_10507032
1623 Ga0114129_10593386
1624 Ga0114129_10772522
1625 Ga0114129_11128970
1626 Ga0105243_10013693
1627 Ga0105243_10014817
1628 Ga0105243_10016503
1629 Ga0105243_10175564
1630 Ga0105243_10181181
1631 Ga0105243_10468310
1632 Ga0105243_11908025
1633 Ga0105241_10020683
1634 Ga0105241_10024599
1635 Ga0105241_10049390
1636 Ga0105241_10069983
1637 Ga0105241_10091837
1638 Ga0105241_10193333
1639 Ga0105241_10282514
1640 Ga0105241_10883890
1641 Ga0105242_10015811
1642 Ga0105242_10020652
1643 Ga0105242_10026637
1644 Ga0105242_10029211
1645 Ga0105242_10091744
1646 Ga0105242_10106653
1647 Ga0105242_10206468
1648 Ga0105242_10262885
1649 Ga0105242_10341942
1650 Ga0105242_10468515
1651 Ga0105242_11878081
1652 Ga0105242_13006680
1653 Ga0105248_10060955
1654 Ga0105248_10106134
1655 Ga0105248_10113816
1656 Ga0105248_10171127
1657 Ga0105248_10208234
1658 Ga0105248_10257140
1659 Ga0105248_10611923
1660 Ga0105248_10726673
1661 Ga0105248_11110556
1662 Ga0105237_10006103
1663 Ga0105237_10008051
1664 Ga0105237_10012134
1665 Ga0105237_10146161
1666 Ga0105237_10266671
1667 Ga0105237_10303500
1668 Ga0105237_10707403
1669 Ga0105237_11321534
1670 Ga0105237_11656020
1671 Ga0105238_10004906
1672 Ga0105238_10028228
1673 Ga0105238_10062533
1674 Ga0105238_10067738
1675 Ga0105238_10070174
1676 Ga0105249_10001517
1677 Ga0105249_10324208
1678 Ga0105249_10623001
1679 Ga0105249_11210733
1680 Ga0105249_11341102
1681 Ga0105249_11407032
1682 Ga0105239_10008018
1683 Ga0105239_10011847
1684 Ga0105239_10109635
1685 Ga0105239_10703520
1686 Ga0105246_10006946
1687 Ga0105246_10054272
1688 Ga0105246_10081006
1689 Ga0105246_10400069
1690 Ga0105246_10901759
1691 Ga0105246_11864741
1692 Ga0157370_10002320
1693 Ga0157370_10013256
1694 Ga0157369_10000856
1695 Ga0157369_10020341
1696 Ga0157369_10235325
1697 Ga0157369_10997637
1698 Ga0157369_11027969
1699 Ga0157374_10004706
1700 Ga0157374_10057967
1701 Ga0157374_10097378
1702 Ga0157374_10141716
1703 Ga0157374_10477631
1704 Ga0157374_10523884
1705 Ga0157374_11576381
1706 Ga0157378_10004469
1707 Ga0157378_10069719
1708 Ga0157378_10153012
1709 Ga0157378_10628827
1710 Ga0157378_11063431
1711 Ga0163162_10007906
1712 Ga0163162_10167605
1713 Ga0163162_10365959
1714 Ga0163162_10763451
1715 Ga0163162_10864437
1716 Ga0163162_10884522
1717 Ga0163162_12073710
1718 Ga0157372_10020489
1719 Ga0157372_10024353
1720 Ga0157372_10068428
1721 Ga0157372_10279702
1722 Ga0157372_10309247
1723 Ga0157372_10312674
1724 Ga0157372_10770830
1725 Ga0157372_11115339
1726 Ga0157375_10006342
1727 Ga0157375_10013179
1728 Ga0157375_10058331
1729 Ga0157375_10073966
1730 Ga0157375_10101653
1731 Ga0157375_10305473
1732 Ga0157375_10503260
1733 Ga0157375_11314982
1734 Ga0157375_11487154
1735 Ga0157375_11585722
1736 Ga0163163_10004905
1737 Ga0163163_10185940
1738 Ga0163163_10198573
1739 Ga0163163_10236688
1740 Ga0163163_10383455
1741 Ga0163163_11808929
1742 Ga0163163_11812206
1743 Ga0157380_10001628
1744 Ga0157380_10033205
1745 Ga0157380_10035075
1746 Ga0157380_10040834
1747 Ga0157380_10057405
1748 Ga0157380_10137318
1749 Ga0157380_10235205
1750 Ga0157380_10372187
1751 Ga0157377_10005177
1752 Ga0157379_10006764
1753 Ga0157379_10066570
1754 Ga0157379_10093858
1755 Ga0157379_10386298
1756 Ga0157379_10860219
1757 Ga0157379_10911158
1758 Ga0157379_11382689
1759 Ga0157376_10064091
1760 Ga0157376_10104084
1761 Ga0157376_10119831
1762 Ga0157376_10182589
1763 Ga0157376_10298798
1764 Ga0157376_10302807
1765 Ga0157376_10351170
1766 Ga0157376_10547673
1767 Ga0163161_10024908
1768 Ga0163161_10951212
1769 Ga0163161_11061894
1770 Ga0206352_10276273
1771 Ga0213875_10020183
1772 Ga0207673_1015351
1773 Ga0207697_10001790
1774 Ga0207656_10044342
1775 Ga0207653_10038169
1776 Ga0207682_10002980
1777 Ga0207682_10003881
1778 Ga0207682_10035183
1779 Ga0207692_10447154
1780 Ga0207642_10031206
1781 Ga0207642_10106625
1782 Ga0207642_10259319
1783 Ga0207642_10522134
1784 Ga0207710_10016079
1785 Ga0207688_10002313
1786 Ga0207680_10283130
1787 Ga0207680_10291311
1788 Ga0207680_10884041
1789 Ga0207647_10239478
1790 Ga0207699_10308459
1791 Ga0207645_10004825
1792 Ga0207645_10013798
1793 Ga0207645_10050497
1794 Ga0207645_10094311
1795 Ga0207643_10000719
1796 Ga0207643_10003155
1797 Ga0207643_10021602
1798 Ga0207643_10036366
1799 Ga0207643_10098401
1800 Ga0207643_10239236
1801 Ga0207643_10276967
1802 Ga0207643_10775757
1803 Ga0207654_10018789
1804 Ga0207654_10082009
1805 Ga0207654_10084206
1806 Ga0207654_10142895
1807 Ga0207654_10164816
1808 Ga0207654_10289068
1809 Ga0207654_10610968
1810 Ga0207654_11151322
1811 Ga0207707_10039969
1812 Ga0207707_10177490
1813 Ga0207707_10640197
1814 Ga0207707_10868193
1815 Ga0207695_10000302
1816 Ga0207695_10019328
1817 Ga0207695_10034902
1818 Ga0207695_10129150
1819 Ga0207695_10393048
1820 Ga0207695_10757591
1821 Ga0207695_11461321
1822 Ga0207671_10006862
1823 Ga0207671_10010106
1824 Ga0207671_10037469
1825 Ga0207671_10330361
1826 Ga0207671_10434503
1827 Ga0207671_10462504
1828 Ga0207671_10728108
1829 Ga0207671_10856694
1830 Ga0207660_10061029
1831 Ga0207660_10448120
1832 Ga0207662_10004573
1833 Ga0207662_10007357
1834 Ga0207662_10051246
1835 Ga0207662_10546311
1836 Ga0207657_10036023
1837 Ga0207657_10765974
1838 Ga0207649_10219824
1839 Ga0207649_10334313
1840 Ga0207649_10490681
1841 Ga0207649_10645621
1842 Ga0207652_10141636
1843 Ga0207646_10113720
1844 Ga0207646_10307493
1845 Ga0207646_10509236
1846 Ga0207646_10761770
1847 Ga0207646_10789060
1848 Ga0207681_10001889
1849 Ga0207681_10029885
1850 Ga0207681_10041243
1851 Ga0207681_10266226
1852 Ga0207681_10338832
1853 Ga0207694_10003179
1854 Ga0207694_10006554
1855 Ga0207694_10006776
1856 Ga0207694_10040780
1857 Ga0207694_10043525
1858 Ga0207694_10049427
1859 Ga0207694_10057282
1860 Ga0207694_10067430
1861 Ga0207694_10071198
1862 Ga0207694_10229719
1863 Ga0207650_10021575
1864 Ga0207650_10133913
1865 Ga0207650_10247174
1866 Ga0207659_10000726
1867 Ga0207659_10003073
1868 Ga0207659_10045577
1869 Ga0207659_10088025
1870 Ga0207659_10090677
1871 Ga0207659_10120472
1872 Ga0207659_10218141
1873 Ga0207687_10002357
1874 Ga0207687_10003605
1875 Ga0207687_10026900
1876 Ga0207687_10055686
1877 Ga0207687_10061616
1878 Ga0207687_10080962
1879 Ga0207687_10831387
1880 Ga0207700_10035307
1881 Ga0207700_10296739
1882 Ga0207700_10427868
1883 Ga0207644_10026183
1884 Ga0207644_10028476
1885 Ga0207644_10060754
1886 Ga0207644_11674373
1887 Ga0207690_10235165
1888 Ga0207690_10654109
1889 Ga0207690_10936082
1890 Ga0207706_10009301
1891 Ga0207706_10045295
1892 Ga0207706_10054690
1893 Ga0207706_10061632
1894 Ga0207706_10581059
1895 Ga0207706_10829271
1896 Ga0207686_10010199
1897 Ga0207686_10018809
1898 Ga0207686_10024018
1899 Ga0207686_10058845
1900 Ga0207686_10069484
1901 Ga0207686_10148547
1902 Ga0207686_10180564
1903 Ga0207686_10269260
1904 Ga0207686_10293014
1905 Ga0207709_10005436
1906 Ga0207709_10016161
1907 Ga0207709_10051331
1908 Ga0207709_10307692
1909 Ga0207709_11049445
1910 Ga0207709_11271722
1911 Ga0207670_10005770
1912 Ga0207670_10099410
1913 Ga0207670_10103355
1914 Ga0207670_10196224
1915 Ga0207670_10365846
1916 Ga0207670_10510616
1917 Ga0207670_10828805
1918 Ga0207669_10003825
1919 Ga0207669_10147131
1920 Ga0207669_10678587
1921 Ga0207669_11426062
1922 Ga0207704_10008623
1923 Ga0207704_10012832
1924 Ga0207704_10042913
1925 Ga0207704_10149767
1926 Ga0207704_10188600
1927 Ga0207704_10552935
1928 Ga0207704_10572430
1929 Ga0207704_10917595
1930 Ga0207691_10021926
1931 Ga0207691_10055697
1932 Ga0207691_10063756
1933 Ga0207691_10064866
1934 Ga0207691_10098762
1935 Ga0207691_10333934
1936 Ga0207691_10779058
1937 Ga0207711_10000342
1938 Ga0207711_10009349
1939 Ga0207711_10020105
1940 Ga0207711_10043690
1941 Ga0207711_10249310
1942 Ga0207711_10562707
1943 Ga0207711_10975516
1944 Ga0207711_11872147
1945 Ga0207689_10003931
1946 Ga0207689_10009664
1947 Ga0207689_10060470
1948 Ga0207689_10105601
1949 Ga0207689_10110845
1950 Ga0207689_10164903
1951 Ga0207689_10217737
1952 Ga0207689_10426477
1953 Ga0207689_10710123
1954 Ga0207689_11259247
1955 Ga0207661_10005099
1956 Ga0207661_10008090
1957 Ga0207661_10043293
1958 Ga0207661_10058658
1959 Ga0207661_10087213
1960 Ga0207661_10337990
1961 Ga0207661_10345244
1962 Ga0207661_10946725
1963 Ga0207679_10024068
1964 Ga0207679_10108841
1965 Ga0207679_10204346
1966 Ga0207679_10312104
1967 Ga0207679_10445370
1968 Ga0207667_10003211
1969 Ga0207667_10009573
1970 Ga0207667_10032373
1971 Ga0207667_10141050
1972 Ga0207667_10171662
1973 Ga0207651_10006064
1974 Ga0207651_10010414
1975 Ga0207651_10017293
1976 Ga0207651_10151471
1977 Ga0207651_10201759
1978 Ga0207651_10213306
1979 Ga0207651_10229888
1980 Ga0207651_10322090
1981 Ga0207712_10238318
1982 Ga0207712_10264433
1983 Ga0207712_10505596
1984 Ga0207712_10555735
1985 Ga0207712_10599467
1986 Ga0207712_11559829
1987 Ga0207668_10033425
1988 Ga0207668_10104947
1989 Ga0207668_10798828
1990 Ga0207640_10058539
1991 Ga0207640_10248067
1992 Ga0207640_11705955
1993 Ga0207658_10455901
1994 Ga0207658_10769747
1995 Ga0207658_10775242
1996 Ga0207677_10377706
1997 Ga0207677_10805736
1998 Ga0207677_10931563
1999 Ga0207703_10019568
2000 Ga0207703_10025716
2001 Ga0207703_10101243
2002 Ga0207703_10107008
2003 Ga0207703_10135402
2004 Ga0207703_10215527
2005 Ga0207703_10434905
2006 Ga0207703_10491215
2007 Ga0207703_11156583
2008 Ga0207639_10066477
2009 Ga0207639_10068096
2010 Ga0207639_10326808
2011 Ga0207639_10355922
2012 Ga0207639_10390590
2013 Ga0207678_10186485
2014 Ga0207708_10017373
2015 Ga0207708_10020438
2016 Ga0207708_10045783
2017 Ga0207708_10106910
2018 Ga0207708_11795648
2019 Ga0207708_11947547
2020 Ga0207702_10005246
2021 Ga0207702_10047871
2022 Ga0207702_10147795
2023 Ga0207702_10261594
2024 Ga0207702_10274331
2025 Ga0207702_10529960
2026 Ga0207702_10545814
2027 Ga0207641_10035499
2028 Ga0207641_10086199
2029 Ga0207641_10142164
2030 Ga0207641_10580195
2031 Ga0207641_10984121
2032 Ga0207641_10997502
2033 Ga0207641_11185301
2034 Ga0207648_10003945
2035 Ga0207648_10018835
2036 Ga0207648_10019273
2037 Ga0207648_10025354
2038 Ga0207648_10035630
2039 Ga0207648_10104897
2040 Ga0207648_10175432
2041 Ga0207648_10226907
2042 Ga0207648_10262897
2043 Ga0207648_10309254
2044 Ga0207648_10429152
2045 Ga0207648_10797051
2046 Ga0207648_10976299
2047 Ga0207648_11365668
2048 Ga0207676_10040361
2049 Ga0207676_10044689
2050 Ga0207676_10166965
2051 Ga0207676_11159103
2052 Ga0207676_11608905
2053 Ga0207676_12540293
2054 Ga0207674_10001765
2055 Ga0207674_10012664
2056 Ga0207674_10048681
2057 Ga0207674_10050355
2058 Ga0207674_10058693
2059 Ga0207674_10223020
2060 Ga0207674_10298481
2061 Ga0207674_10663864
2062 Ga0207674_11174578
2063 Ga0207675_100001637
2064 Ga0207675_100017102
2065 Ga0207675_100022288
2066 Ga0207675_100048376
2067 Ga0207675_100122370
2068 Ga0207675_100232072
2069 Ga0207675_100628842
2070 Ga0207675_100646833
2071 Ga0207675_100812753
2072 Ga0207683_10009184
2073 Ga0207683_10054261
2074 Ga0207683_10097166
2075 Ga0207683_10303670
2076 Ga0207683_10316897
2077 Ga0207683_10664172
2078 Ga0207683_10803045
2079 Ga0207698_10030727
2080 Ga0207698_10091810
2081 Ga0207698_10480190
2082 Ga0207698_10804404
2083 Ga0207698_10817049
2084 Ga0207698_11771031
2085 Ga0209996_1060768
2086 Ga0209968_1033876
2087 Ga0207428_10000986
2088 Ga0207428_10004387
2089 Ga0207428_10361777
2090 Ga0207428_10700454
2091 Ga0268266_10026277
2092 Ga0268266_10110959
2093 Ga0268265_10001817
2094 Ga0268265_10025542
2095 Ga0268264_10002343
2096 Ga0268264_10053776
2097 Ga0268264_10071606
2098 Ga0268264_10196846
2099 Ga0268264_10225866
2100 Ga0268264_10372553
2101 Ga0268264_10416631
2102 Ga0268264_10844520
2103 Ga0268264_10925075
2104 Ga0268264_11044295
2105 Ga0268264_11817961
2106 Ga0265762_1078418
2107 Ga0265760_10039341
2108 Ga0265314_10003122
2109 Ga0307416_100229966
2110 Ga0373934_0000376
2111 Ga0373934_0047781
2112 Ga0373934_0105131
2113 Ga0373940_0111804
2114 Ga0373949_0047917
2115 Ga0373932_0100219
2116 Ga0373941_0430996
2117 Ga0373953_0008851
2118 Ga0373953_0037484
2119 Ga0373953_0092149
2120 Ga0373953_0287218
2121 Ga0373954_0000350
2122 Ga0373954_0000935
2123 Ga0373954_0001398
2124 Ga0373954_0006742
2125 Ga0373954_0352894
2126 Ga0373956_0162962
2127 Ga0373956_0180697
2128 Ga0373956_0635659
2129 Ga0373957_0001881
2130 Ga0373960_0115180
2131 Ga0373955_0043575
2132 Ga0373961_0011244
2133 Ga0373961_0387892
2134 Ga0373931_0509328
2135 Ga0373931_0686574
2136 Ga0373935_0091475
2137 Ga0373927_0105607
2138 Ga0373927_0464574
2139 Ga0373933_0014824
2140 Ga0373933_0015115
2141 Ga0373933_0234548
2142 Ga0373933_0497722
2143 Ga0373933_0594695
2144 Ga0373933_0894118
2145 Ga0373947_0646041
2146 Ga0373937_0002174
2147 Ga0373937_0005074
2148 Ga0373937_0005118
2149 Ga0373937_0007547
2150 Ga0373937_0011117
2151 Ga0373937_0031595
2152 Ga0373937_0244870
2153 Ga0373937_0354287
2154 Ga0373937_0572310
2155 Ga0373937_1134027
2156 Ga0373925_0086373
2157 Ga0373925_0110419
2158 Ga0373925_0394537
2159 Ga0373925_0574429
2160 Ga0373925_1048003
2161 Ga0436364_1138878
2162 Ga0436363_0546662
2163 Ga0436363_0635755
2164 Ga0436362_0188994
2165 Ga0439464_0069982
2166 Ga0451577_0773381
2167 Ga0453683_0851988
2168 Ga0451576_0031110
2169 Ga0451576_0086745
2170 Ga0451576_0107691
2171 Ga0451576_0712302
2172 Ga0451576_0801062
2173 Ga0495592_0122741
2174 Ga0495641_0356437
2175 Ga0495651_0385634
2176 Ga0495651_0548110
2177 Ga0495580_0033712
2178 Ga0495580_0043694
2179 Ga0495580_0646323
2180 Ga0495582_0201285
2181 Ga0495608_0145613
2182 Ga0495628_0955427
2183 Ga0495630_0547161
2184 Ga0495630_1500837
2185 Ga0495644_0215317
2186 Ga0495642_0355345
2187 Ga0495652_0006912
2188 Ga0495665_0097187
2189 Ga0495665_0184212
2190 Ga0495640_0479591
2191 Ga0495586_0161832
2192 Ga0495586_0214424
2193 Ga0495587_0142205
2194 Ga0495587_0298598
2195 Ga0495587_0507361
2196 Ga0495598_0032282
2197 Ga0495597_0199490
2198 Ga0495645_0021213
2199 Ga0495667_0038465
2200 Ga0495656_0108088
2201 Ga0495656_0326512
2202 Ga0495634_0123994
2203 Ga0495634_0249624
2204 Ga0495659_0037097
2205 Ga0495588_0162062
2206 Ga0495599_0001991
2207 Ga0495623_0186866
2208 Ga0495658_0020114
2209 Ga0495613_0027552
2210 Ga0495613_0296911
2211 Ga0495600_0298326
2212 Ga0495604_0112088
2213 Ga0495636_0017086
2214 Ga0495674_0579368
2215 Ga0495680_0126597
2216 Ga0495680_0193981
2217 Ga0495680_0207404
2218 Ga0495680_0518060
2219 Ga0495675_0038181
2220 Ga0495675_0503833
2221 Ga0495684_0006087
2222 Ga0495684_0017963
2223 Ga0495684_0020127
2224 Ga0495684_0211261
2225 Ga0495602_0453031
2226 Ga0496100_0017245
2227 Ga0496101_0006359
2228 Ga0496102_0109248
2229 Ga0496104_0139245
2230 Ga0496104_0342995
2231 Ga0496104_0727354
2232 Ga0496106_0035342
2233 Ga0496106_1043358
2234 Ga0496106_1469377
2235 Ga0496112_0223205
2236 Ga0496112_1371074
2237 Ga0496114_0002532
2238 Ga0496114_0539275
2239 Ga0496115_0387577
2240 Ga0501033_0625600
2241 Ga0501036_0016212
2242 Ga0501038_0736700
2243 Ga0501039_0289807
2244 Ga0501040_0044231
2245 Ga0501041_0016496
2246 Ga0501041_0200472
2247 Ga0501042_0410391
2248 Ga0501046_0016197
2249 Ga0501068_0353240
2250 Ga0501072_1024170
2251 Ga0501075_0549821
2252 Ga0501076_0014376
2253 Ga0501079_0003042
2254 Ga0501081_0154815
2255 Ga0501045_0761787
2256 nmdc:mga05p37_245414_c1
2257 nmdc:mga05p37_36011_c1
2258 nmdc:mga05p37_3678_c1
2259 nmdc:mga05p37_4305_c1
2260 nmdc:mga05p37_54320_c1
2261 nmdc:mga05p37_69413_c1
2262 nmdc:mga05p37_777690_c1
2263 nmdc:mga09592_107377_c1
2264 nmdc:mga09592_119986_c1
2265 nmdc:mga09592_15185_c1
2266 nmdc:mga0qj67_1031_c1
2267 nmdc:mga0qj67_889323_c1
2268 nmdc:mga06r32_92505_c1
2269 nmdc:mga06r32_9715_c1
2270 nmdc:mga08y16_109136_c1
2271 nmdc:mga08y16_1160642_c1
2272 nmdc:mga08y16_12324_c1
2273 nmdc:mga08y16_31440_c1
2274 nmdc:mga08y16_561780_c1
2275 nmdc:mga08y16_784347_c1
2276 nmdc:mga0n895_1034525_c1
2277 nmdc:mga0n895_1118260_c1
2278 nmdc:mga0n895_5526_c1
2279 nmdc:mga0n895_590198_c1
2280 nmdc:mga0n895_61306_c1
2281 nmdc:mga0n895_69297_c1
2282 nmdc:mga0n895_7683_c1
2283 nmdc:mga0n895_963186_c1
2284 nmdc:mga0rr50_181033_c1
2285 nmdc:mga0rr50_243166_c1
2286 nmdc:mga0rr50_361212_c1
2287 nmdc:mga0rr50_63211_c1
2288 nmdc:mga0rr50_79805_c1
2289 nmdc:mga08x19_1166421_c1
2290 nmdc:mga08x19_69351_c1
2291 nmdc:mga0a205_131939_c1
2292 nmdc:mga0a205_1627_c1
2293 nmdc:mga0a205_190191_c1
2294 nmdc:mga0a205_537800_c1
2295 nmdc:mga0a205_58889_c1
2296 nmdc:mga0a205_806302_c1
2297 Ga0495601_0127376
2298 Ga0495595_0750858
2299 Ga0495619_0170709
2300 Ga0501084_0006540
2301 Ga0501082_0017413
2302 Ga0530510_0062594

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

46

145

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7833 39 72
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7811 39 72
8foc-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i 0.7656 38 72
8foe-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex bound to a template dna 0.7613 38 72
4fvm-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha 0.7613 38 72
ID Description Score Start End Superfamily
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8275 37 97 2.40.50.140
af_Q9TZG4_240_302_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.788 39 72 2.60.40.1180
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7733 36 119 2.40.50.140
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7731 37 98 2.40.50.140
af_Q95Y97_40_169_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7633 35 118 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9709 32 125
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9608 31 123
AF-A0A2V8LU00-F1-model_v4 OB domain-containing protein 0.9604 37 122
AF-A0A521RFX0-F1-model_v4 Uncharacterized protein 0.9471 31 128
AF-A0A381VHI2-F1-model_v4 Uncharacterized protein 0.9469 35 132

Map