F490861
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1151 | 294 | 2302 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10076513|Ga0105245_100765135 |
| Length | 177 |
| Sequence | MIAARRLENQVALDMNRDEAEIRHKLRGWRGIMAIRPSGIWRLTAGLTLLASALLAHHSFGAEYDATKPVMLTGVITKIDWTNPHSYFFIDVKDDKGNVANWKLEGYPPSVLSRTGWKKDVTMKVGDTVTVFGWHARDGSNWAHSRQVTFADGKKLFFGPPAGTGDGGNTPAVEVLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 218 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 219 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.22 |
| Rhizosphere | 98.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 34.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105245_10076513 | 3300009098 | Bacteria | 3049 |
| 2 | JGI24750J21931_1070484 | 3300002070 | Unclassified | 570 |
| 3 | JGI24742J22300_10128337 | 3300002244 | Unclassified | 504 |
| 4 | Ga0065714_10320666 | 3300005288 | Unclassified | 669 |
| 5 | Ga0065712_10004025 | 3300005290 | Bacteria | 4359 |
| 6 | Ga0065712_10158284 | 3300005290 | Unclassified | 1320 |
| 7 | Ga0065715_10000766 | 3300005293 | Bacteria | 8488 |
| 8 | Ga0065715_10057764 | 3300005293 | Unclassified | 1054 |
| 9 | Ga0065707_10004492 | 3300005295 | Unclassified | 3187 |
| 10 | Ga0065707_10023923 | 3300005295 | Bacteria | 1624 |
| 11 | Ga0065707_10118664 | 3300005295 | Bacteria | 2179 |
| 12 | Ga0070676_10002130 | 3300005328 | Bacteria | 10080 |
| 13 | Ga0070676_10048093 | 3300005328 | Bacteria | 2493 |
| 14 | Ga0070676_10414367 | 3300005328 | Bacteria | 940 |
| 15 | Ga0070676_11024512 | 3300005328 | Unclassified | 621 |
| 16 | Ga0070683_100077941 | 3300005329 | Unclassified | 3100 |
| 17 | Ga0070683_100146928 | 3300005329 | Bacteria | 2234 |
| 18 | Ga0070683_100779229 | 3300005329 | Unclassified | 916 |
| 19 | Ga0070683_101106159 | 3300005329 | Unclassified | 761 |
| 20 | Ga0070690_100035456 | 3300005330 | Unclassified | 3130 |
| 21 | Ga0070690_100067424 | 3300005330 | Bacteria | 2319 |
| 22 | Ga0070690_100094602 | 3300005330 | Unclassified | 1972 |
| 23 | Ga0070690_100584678 | 3300005330 | Unclassified | 846 |
| 24 | Ga0070690_100643323 | 3300005330 | Bacteria | 809 |
| 25 | Ga0070690_100667856 | 3300005330 | Unclassified | 795 |
| 26 | Ga0070690_101470421 | 3300005330 | Unclassified | 550 |
| 27 | Ga0070670_100001376 | 3300005331 | Bacteria | 19487 |
| 28 | Ga0070670_100004397 | 3300005331 | Bacteria | 11795 |
| 29 | Ga0070670_100019553 | 3300005331 | Bacteria | 5813 |
| 30 | Ga0070670_101534914 | 3300005331 | Bacteria | 612 |
| 31 | Ga0070677_10002121 | 3300005333 | Bacteria | 6329 |
| 32 | Ga0070677_10004228 | 3300005333 | Unclassified | 4679 |
| 33 | Ga0070677_10010228 | 3300005333 | Bacteria | 3204 |
| 34 | Ga0068869_100006944 | 3300005334 | Bacteria | 7206 |
| 35 | Ga0068869_100008081 | 3300005334 | Bacteria | 6764 |
| 36 | Ga0068869_100021377 | 3300005334 | Bacteria | 4450 |
| 37 | Ga0068869_100075528 | 3300005334 | Unclassified | 2504 |
| 38 | Ga0068869_100144020 | 3300005334 | Bacteria | 1843 |
| 39 | Ga0068869_100485186 | 3300005334 | Bacteria | 1030 |
| 40 | Ga0070666_10004014 | 3300005335 | Bacteria | 8934 |
| 41 | Ga0070666_10097527 | 3300005335 | Bacteria | 2024 |
| 42 | Ga0070666_10173254 | 3300005335 | Unclassified | 1512 |
| 43 | Ga0070666_10320909 | 3300005335 | Unclassified | 1105 |
| 44 | Ga0070666_10460392 | 3300005335 | Bacteria | 919 |
| 45 | Ga0070680_100727533 | 3300005336 | Unclassified | 854 |
| 46 | Ga0070682_100482790 | 3300005337 | Archaea | 956 |
| 47 | Ga0070682_100945636 | 3300005337 | Unclassified | 711 |
| 48 | Ga0068868_100028746 | 3300005338 | Unclassified | 4253 |
| 49 | Ga0068868_100089529 | 3300005338 | Bacteria | 2478 |
| 50 | Ga0068868_101140055 | 3300005338 | Unclassified | 719 |
| 51 | Ga0070660_100028114 | 3300005339 | Bacteria | 4204 |
| 52 | Ga0070660_100631980 | 3300005339 | Unclassified | 896 |
| 53 | Ga0070689_100009058 | 3300005340 | Bacteria | 7046 |
| 54 | Ga0070689_100013527 | 3300005340 | Bacteria | 5909 |
| 55 | Ga0070689_100030022 | 3300005340 | Bacteria | 4122 |
| 56 | Ga0070689_100133112 | 3300005340 | Bacteria | 1995 |
| 57 | Ga0070689_101185293 | 3300005340 | Unclassified | 685 |
| 58 | Ga0070689_101241118 | 3300005340 | Unclassified | 670 |
| 59 | Ga0070689_101975288 | 3300005340 | Unclassified | 533 |
| 60 | Ga0070691_10004994 | 3300005341 | Bacteria | 6034 |
| 61 | Ga0070691_11078052 | 3300005341 | Unclassified | 505 |
| 62 | Ga0070687_100004620 | 3300005343 | Bacteria | 5504 |
| 63 | Ga0070687_100009945 | 3300005343 | Bacteria | 4092 |
| 64 | Ga0070687_100024088 | 3300005343 | Unclassified | 2901 |
| 65 | Ga0070661_100009957 | 3300005344 | Bacteria | 6593 |
| 66 | Ga0070661_100102423 | 3300005344 | Bacteria | 2131 |
| 67 | Ga0070661_100670914 | 3300005344 | Bacteria | 843 |
| 68 | Ga0070692_10078733 | 3300005345 | Unclassified | 1771 |
| 69 | Ga0070692_10323632 | 3300005345 | Bacteria | 949 |
| 70 | Ga0070692_11079316 | 3300005345 | Unclassified | 566 |
| 71 | Ga0070668_100045307 | 3300005347 | Unclassified | 3375 |
| 72 | Ga0070668_100070669 | 3300005347 | Unclassified | 2718 |
| 73 | Ga0070668_101061616 | 3300005347 | Unclassified | 730 |
| 74 | Ga0070668_101176370 | 3300005347 | Bacteria | 694 |
| 75 | Ga0070669_100012416 | 3300005353 | Bacteria | 6043 |
| 76 | Ga0070669_100060674 | 3300005353 | Unclassified | 2778 |
| 77 | Ga0070669_100411049 | 3300005353 | Unclassified | 1109 |
| 78 | Ga0070669_100467023 | 3300005353 | Bacteria | 1042 |
| 79 | Ga0070669_101138583 | 3300005353 | Unclassified | 673 |
| 80 | Ga0070669_101173617 | 3300005353 | Bacteria | 663 |
| 81 | Ga0070675_100001521 | 3300005354 | Bacteria | 17146 |
| 82 | Ga0070675_100003288 | 3300005354 | Bacteria | 12256 |
| 83 | Ga0070675_100023946 | 3300005354 | Bacteria | 4886 |
| 84 | Ga0070675_100113344 | 3300005354 | Bacteria | 2296 |
| 85 | Ga0070675_100127903 | 3300005354 | Bacteria | 2163 |
| 86 | Ga0070675_100182487 | 3300005354 | Bacteria | 1815 |
| 87 | Ga0070675_100952594 | 3300005354 | Unclassified | 787 |
| 88 | Ga0070671_100006397 | 3300005355 | Bacteria | 9411 |
| 89 | Ga0070671_100041594 | 3300005355 | Bacteria | 3820 |
| 90 | Ga0070671_100065471 | 3300005355 | Bacteria | 3027 |
| 91 | Ga0070671_100224783 | 3300005355 | Unclassified | 1593 |
| 92 | Ga0070671_101723623 | 3300005355 | Unclassified | 556 |
| 93 | Ga0070674_100001992 | 3300005356 | Bacteria | 11184 |
| 94 | Ga0070674_100156985 | 3300005356 | Bacteria | 1722 |
| 95 | Ga0070674_100518021 | 3300005356 | Unclassified | 996 |
| 96 | Ga0070674_100831246 | 3300005356 | Bacteria | 800 |
| 97 | Ga0070673_100013101 | 3300005364 | Bacteria | 5722 |
| 98 | Ga0070673_100043845 | 3300005364 | Bacteria | 3460 |
| 99 | Ga0070673_100135883 | 3300005364 | Bacteria | 2069 |
| 100 | Ga0070673_100207522 | 3300005364 | Unclassified | 1690 |
| 101 | Ga0070673_100362668 | 3300005364 | Bacteria | 1288 |
| 102 | Ga0070673_100373248 | 3300005364 | Bacteria | 1270 |
| 103 | Ga0070673_100495249 | 3300005364 | Bacteria | 1105 |
| 104 | Ga0070673_100552490 | 3300005364 | Bacteria | 1046 |
| 105 | Ga0070688_100004251 | 3300005365 | Bacteria | 7447 |
| 106 | Ga0070688_100020983 | 3300005365 | Unclassified | 3808 |
| 107 | Ga0070688_100030277 | 3300005365 | Bacteria | 3247 |
| 108 | Ga0070688_100088699 | 3300005365 | Bacteria | 2017 |
| 109 | Ga0070688_100509177 | 3300005365 | Bacteria | 909 |
| 110 | Ga0070688_101659293 | 3300005365 | Bacteria | 523 |
| 111 | Ga0070659_100070829 | 3300005366 | Unclassified | 2771 |
| 112 | Ga0070659_100258750 | 3300005366 | Bacteria | 1444 |
| 113 | Ga0070659_100297110 | 3300005366 | Unclassified | 1346 |
| 114 | Ga0070659_100471592 | 3300005366 | Bacteria | 1067 |
| 115 | Ga0070667_100021283 | 3300005367 | Bacteria | 5387 |
| 116 | Ga0070667_100620397 | 3300005367 | Bacteria | 997 |
| 117 | Ga0070703_10264793 | 3300005406 | Unclassified | 703 |
| 118 | Ga0070709_10191112 | 3300005434 | Bacteria | 1444 |
| 119 | Ga0070713_100190238 | 3300005436 | Bacteria | 1849 |
| 120 | Ga0070713_100231938 | 3300005436 | Bacteria | 1678 |
| 121 | Ga0070710_10529894 | 3300005437 | Unclassified | 810 |
| 122 | Ga0070710_10798294 | 3300005437 | Unclassified | 674 |
| 123 | Ga0070701_10050245 | 3300005438 | Bacteria | 2158 |
| 124 | Ga0070701_10054352 | 3300005438 | Unclassified | 2088 |
| 125 | Ga0070701_10135373 | 3300005438 | Unclassified | 1404 |
| 126 | Ga0070701_10594376 | 3300005438 | Bacteria | 732 |
| 127 | Ga0070701_10989098 | 3300005438 | Unclassified | 586 |
| 128 | Ga0070711_100078558 | 3300005439 | Bacteria | 2345 |
| 129 | Ga0070711_100766664 | 3300005439 | Unclassified | 816 |
| 130 | Ga0070705_100000409 | 3300005440 | Bacteria | 24706 |
| 131 | Ga0070705_100006513 | 3300005440 | Bacteria | 5731 |
| 132 | Ga0070705_100065077 | 3300005440 | Unclassified | 2181 |
| 133 | Ga0070705_100071149 | 3300005440 | Unclassified | 2103 |
| 134 | Ga0070705_101076117 | 3300005440 | Bacteria | 657 |
| 135 | Ga0070705_101131408 | 3300005440 | Unclassified | 642 |
| 136 | Ga0070700_100008474 | 3300005441 | Bacteria | 5598 |
| 137 | Ga0070700_100053330 | 3300005441 | Bacteria | 2523 |
| 138 | Ga0070694_100015841 | 3300005444 | Bacteria | 4743 |
| 139 | Ga0070694_100027628 | 3300005444 | Bacteria | 3687 |
| 140 | Ga0070694_100046602 | 3300005444 | Bacteria | 2911 |
| 141 | Ga0070694_100111506 | 3300005444 | Unclassified | 1949 |
| 142 | Ga0070694_100485903 | 3300005444 | Bacteria | 980 |
| 143 | Ga0070694_100505429 | 3300005444 | Unclassified | 962 |
| 144 | Ga0070708_100280275 | 3300005445 | Bacteria | 1569 |
| 145 | Ga0070708_100315854 | 3300005445 | Bacteria | 1472 |
| 146 | Ga0070708_100555176 | 3300005445 | Bacteria | 1083 |
| 147 | Ga0070708_101072349 | 3300005445 | Unclassified | 755 |
| 148 | Ga0070663_100698133 | 3300005455 | Unclassified | 862 |
| 149 | Ga0070678_100086413 | 3300005456 | Bacteria | 2392 |
| 150 | Ga0070678_100108054 | 3300005456 | Bacteria | 2171 |
| 151 | Ga0070678_100237148 | 3300005456 | Bacteria | 1523 |
| 152 | Ga0070678_100981241 | 3300005456 | Bacteria | 776 |
| 153 | Ga0070678_101503576 | 3300005456 | Unclassified | 631 |
| 154 | Ga0070662_100025944 | 3300005457 | Unclassified | 4052 |
| 155 | Ga0070662_100028891 | 3300005457 | Bacteria | 3865 |
| 156 | Ga0070662_100041285 | 3300005457 | Bacteria | 3290 |
| 157 | Ga0070662_100044446 | 3300005457 | Unclassified | 3182 |
| 158 | Ga0070662_100438280 | 3300005457 | Bacteria | 1083 |
| 159 | Ga0070662_101362747 | 3300005457 | Bacteria | 611 |
| 160 | Ga0070681_10044836 | 3300005458 | Bacteria | 4427 |
| 161 | Ga0070681_10189217 | 3300005458 | Bacteria | 1978 |
| 162 | Ga0070681_10315014 | 3300005458 | Bacteria | 1474 |
| 163 | Ga0070681_10350788 | 3300005458 | Bacteria | 1386 |
| 164 | Ga0070681_11272787 | 3300005458 | Unclassified | 658 |
| 165 | Ga0068867_100009440 | 3300005459 | Bacteria | 6879 |
| 166 | Ga0068867_100013742 | 3300005459 | Bacteria | 5732 |
| 167 | Ga0068867_100019384 | 3300005459 | Unclassified | 4848 |
| 168 | Ga0068867_100097892 | 3300005459 | Bacteria | 2236 |
| 169 | Ga0068867_100213309 | 3300005459 | Bacteria | 1552 |
| 170 | Ga0068867_100228021 | 3300005459 | Unclassified | 1504 |
| 171 | Ga0068867_100275791 | 3300005459 | Bacteria | 1377 |
| 172 | Ga0068867_100306445 | 3300005459 | Unclassified | 1311 |
| 173 | Ga0068867_100609693 | 3300005459 | Bacteria | 953 |
| 174 | Ga0068867_100632200 | 3300005459 | Unclassified | 937 |
| 175 | Ga0068867_100711690 | 3300005459 | Bacteria | 887 |
| 176 | Ga0068867_100903960 | 3300005459 | Bacteria | 795 |
| 177 | Ga0068867_100935571 | 3300005459 | Unclassified | 782 |
| 178 | Ga0068867_102265460 | 3300005459 | Unclassified | 516 |
| 179 | Ga0070685_10004167 | 3300005466 | Bacteria | 7292 |
| 180 | Ga0070685_10130794 | 3300005466 | Unclassified | 1569 |
| 181 | Ga0070706_100810115 | 3300005467 | Bacteria | 867 |
| 182 | Ga0070706_100856739 | 3300005467 | Bacteria | 840 |
| 183 | Ga0070706_101465729 | 3300005467 | Unclassified | 624 |
| 184 | Ga0070707_100124549 | 3300005468 | Bacteria | 2503 |
| 185 | Ga0070707_100309931 | 3300005468 | Unclassified | 1534 |
| 186 | Ga0070707_100356008 | 3300005468 | Unclassified | 1422 |
| 187 | Ga0070707_100570644 | 3300005468 | Bacteria | 1094 |
| 188 | Ga0070707_100584661 | 3300005468 | Unclassified | 1079 |
| 189 | Ga0070698_100008437 | 3300005471 | Bacteria | 11136 |
| 190 | Ga0070698_100050520 | 3300005471 | Bacteria | 4239 |
| 191 | Ga0070698_100060971 | 3300005471 | Bacteria | 3805 |
| 192 | Ga0070698_100789690 | 3300005471 | Bacteria | 893 |
| 193 | Ga0070698_101813752 | 3300005471 | Bacteria | 563 |
| 194 | Ga0070698_102153942 | 3300005471 | Unclassified | 511 |
| 195 | Ga0070699_100005570 | 3300005518 | Bacteria | 11041 |
| 196 | Ga0070699_100006887 | 3300005518 | Bacteria | 9885 |
| 197 | Ga0070699_100021255 | 3300005518 | Bacteria | 5596 |
| 198 | Ga0070699_100111782 | 3300005518 | Unclassified | 2399 |
| 199 | Ga0070699_100547452 | 3300005518 | Bacteria | 1053 |
| 200 | Ga0070699_100823973 | 3300005518 | Unclassified | 849 |
| 201 | Ga0070679_100000937 | 3300005530 | Bacteria | 25354 |
| 202 | Ga0070679_100591614 | 3300005530 | Unclassified | 1053 |
| 203 | Ga0070679_100628067 | 3300005530 | Unclassified | 1017 |
| 204 | Ga0070684_100000220 | 3300005535 | Bacteria | 39930 |
| 205 | Ga0070684_100033979 | 3300005535 | Bacteria | 4358 |
| 206 | Ga0070684_100058609 | 3300005535 | Bacteria | 3365 |
| 207 | Ga0070684_100079422 | 3300005535 | Bacteria | 2900 |
| 208 | Ga0070684_100272009 | 3300005535 | Bacteria | 1551 |
| 209 | Ga0070684_100277320 | 3300005535 | Bacteria | 1535 |
| 210 | Ga0070684_100395913 | 3300005535 | Bacteria | 1273 |
| 211 | Ga0070684_100523744 | 3300005535 | Bacteria | 1099 |
| 212 | Ga0070697_100038660 | 3300005536 | Unclassified | 3856 |
| 213 | Ga0070697_101047296 | 3300005536 | Unclassified | 726 |
| 214 | Ga0068853_100009310 | 3300005539 | Bacteria | 7920 |
| 215 | Ga0068853_100315548 | 3300005539 | Bacteria | 1448 |
| 216 | Ga0068853_100572665 | 3300005539 | Bacteria | 1071 |
| 217 | Ga0070672_100013202 | 3300005543 | Bacteria | 5826 |
| 218 | Ga0070672_100024022 | 3300005543 | Bacteria | 4497 |
| 219 | Ga0070672_100038806 | 3300005543 | Unclassified | 3642 |
| 220 | Ga0070672_100216377 | 3300005543 | Unclassified | 1606 |
| 221 | Ga0070672_100285181 | 3300005543 | Bacteria | 1397 |
| 222 | Ga0070672_100415658 | 3300005543 | Bacteria | 1154 |
| 223 | Ga0070672_100479835 | 3300005543 | Unclassified | 1073 |
| 224 | Ga0070686_100008216 | 3300005544 | Bacteria | 5842 |
| 225 | Ga0070686_100039392 | 3300005544 | Bacteria | 2945 |
| 226 | Ga0070686_100354280 | 3300005544 | Unclassified | 1104 |
| 227 | Ga0070686_101247657 | 3300005544 | Bacteria | 619 |
| 228 | Ga0070695_100000063 | 3300005545 | Bacteria | 42774 |
| 229 | Ga0070695_100471741 | 3300005545 | Bacteria | 965 |
| 230 | Ga0070695_101309635 | 3300005545 | Bacteria | 599 |
| 231 | Ga0070696_100000064 | 3300005546 | Bacteria | 50839 |
| 232 | Ga0070696_100006244 | 3300005546 | Bacteria | 7975 |
| 233 | Ga0070696_100022663 | 3300005546 | Bacteria | 4268 |
| 234 | Ga0070696_100026342 | 3300005546 | Bacteria | 3956 |
| 235 | Ga0070696_100565622 | 3300005546 | Bacteria | 913 |
| 236 | Ga0070693_101331948 | 3300005547 | Unclassified | 556 |
| 237 | Ga0070665_100009896 | 3300005548 | Bacteria | 9641 |
| 238 | Ga0070665_100262390 | 3300005548 | Unclassified | 1728 |
| 239 | Ga0070704_100010532 | 3300005549 | Bacteria | 5629 |
| 240 | Ga0070704_100039327 | 3300005549 | Unclassified | 3247 |
| 241 | Ga0070704_100058306 | 3300005549 | Unclassified | 2750 |
| 242 | Ga0070704_100100992 | 3300005549 | Unclassified | 2173 |
| 243 | Ga0070704_100266263 | 3300005549 | Unclassified | 1414 |
| 244 | Ga0070704_100462718 | 3300005549 | Bacteria | 1094 |
| 245 | Ga0070704_101864830 | 3300005549 | Unclassified | 557 |
| 246 | Ga0068855_100008856 | 3300005563 | Bacteria | 12166 |
| 247 | Ga0068855_100084626 | 3300005563 | Bacteria | 3671 |
| 248 | Ga0068855_100121694 | 3300005563 | Bacteria | 2986 |
| 249 | Ga0068855_100623617 | 3300005563 | Bacteria | 1161 |
| 250 | Ga0070664_100005747 | 3300005564 | Bacteria | 10003 |
| 251 | Ga0070664_100147595 | 3300005564 | Bacteria | 2075 |
| 252 | Ga0070664_100394524 | 3300005564 | Unclassified | 1265 |
| 253 | Ga0070664_100543121 | 3300005564 | Unclassified | 1074 |
| 254 | Ga0068857_100009482 | 3300005577 | Bacteria | 8454 |
| 255 | Ga0068857_100025305 | 3300005577 | Bacteria | 5227 |
| 256 | Ga0068857_100027803 | 3300005577 | Bacteria | 4987 |
| 257 | Ga0068857_100047994 | 3300005577 | Bacteria | 3791 |
| 258 | Ga0068857_100072561 | 3300005577 | Plasmid | 3068 |
| 259 | Ga0068857_100196133 | 3300005577 | Bacteria | 1840 |
| 260 | Ga0068857_100945624 | 3300005577 | Bacteria | 828 |
| 261 | Ga0068854_100014894 | 3300005578 | Bacteria | 5135 |
| 262 | Ga0068854_100222872 | 3300005578 | Bacteria | 1493 |
| 263 | Ga0068854_101815217 | 3300005578 | Unclassified | 559 |
| 264 | Ga0068854_101967528 | 3300005578 | Unclassified | 538 |
| 265 | Ga0068856_100039344 | 3300005614 | Bacteria | 4643 |
| 266 | Ga0068856_100041958 | 3300005614 | Bacteria | 4499 |
| 267 | Ga0068856_100146923 | 3300005614 | Archaea | 2365 |
| 268 | Ga0068856_100163258 | 3300005614 | Bacteria | 2239 |
| 269 | Ga0068856_100259219 | 3300005614 | Bacteria | 1754 |
| 270 | Ga0068856_100296875 | 3300005614 | Unclassified | 1633 |
| 271 | Ga0068856_100396143 | 3300005614 | Bacteria | 1400 |
| 272 | Ga0068856_100527098 | 3300005614 | Unclassified | 1202 |
| 273 | Ga0068856_100657821 | 3300005614 | Unclassified | 1068 |
| 274 | Ga0068856_102123550 | 3300005614 | Unclassified | 571 |
| 275 | Ga0070702_100002366 | 3300005615 | Bacteria | 8105 |
| 276 | Ga0070702_100061746 | 3300005615 | Bacteria | 2183 |
| 277 | Ga0070702_100202611 | 3300005615 | Unclassified | 1315 |
| 278 | Ga0070702_100233231 | 3300005615 | Bacteria | 1238 |
| 279 | Ga0068852_100020042 | 3300005616 | Bacteria | 5311 |
| 280 | Ga0068852_100053272 | 3300005616 | Bacteria | 3482 |
| 281 | Ga0068852_100470696 | 3300005616 | Bacteria | 1247 |
| 282 | Ga0068852_101033047 | 3300005616 | Bacteria | 841 |
| 283 | Ga0068859_100008792 | 3300005617 | Bacteria | 10194 |
| 284 | Ga0068859_100013417 | 3300005617 | Bacteria | 8216 |
| 285 | Ga0068859_100133533 | 3300005617 | Unclassified | 2554 |
| 286 | Ga0068859_100137164 | 3300005617 | Bacteria | 2520 |
| 287 | Ga0068859_100403507 | 3300005617 | Bacteria | 1463 |
| 288 | Ga0068859_100959951 | 3300005617 | Unclassified | 938 |
| 289 | Ga0068859_101314117 | 3300005617 | Unclassified | 797 |
| 290 | Ga0068859_101733187 | 3300005617 | Unclassified | 690 |
| 291 | Ga0068864_100029090 | 3300005618 | Bacteria | 4675 |
| 292 | Ga0068864_100060069 | 3300005618 | Bacteria | 3291 |
| 293 | Ga0068864_100209586 | 3300005618 | Unclassified | 1794 |
| 294 | Ga0068864_100217175 | 3300005618 | Bacteria | 1763 |
| 295 | Ga0068864_100885136 | 3300005618 | Unclassified | 881 |
| 296 | Ga0068866_10007943 | 3300005718 | Bacteria | 4454 |
| 297 | Ga0068866_10140289 | 3300005718 | Bacteria | 1386 |
| 298 | Ga0068866_10203369 | 3300005718 | Bacteria | 1185 |
| 299 | Ga0068861_100000410 | 3300005719 | Bacteria | 24782 |
| 300 | Ga0068861_100017323 | 3300005719 | Bacteria | 5113 |
| 301 | Ga0068861_100055161 | 3300005719 | Bacteria | 3029 |
| 302 | Ga0068861_100410199 | 3300005719 | Bacteria | 1204 |
| 303 | Ga0068861_100819868 | 3300005719 | Bacteria | 875 |
| 304 | Ga0068861_101207383 | 3300005719 | Unclassified | 732 |
| 305 | Ga0068851_10010649 | 3300005834 | Bacteria | 4294 |
| 306 | Ga0068851_10467994 | 3300005834 | Unclassified | 751 |
| 307 | Ga0068870_10000872 | 3300005840 | Bacteria | 11786 |
| 308 | Ga0068870_10004033 | 3300005840 | Bacteria | 6273 |
| 309 | Ga0068870_10021478 | 3300005840 | Unclassified | 3158 |
| 310 | Ga0068870_10155288 | 3300005840 | Bacteria | 1352 |
| 311 | Ga0068870_10214742 | 3300005840 | Bacteria | 1174 |
| 312 | Ga0068870_10287168 | 3300005840 | Bacteria | 1034 |
| 313 | Ga0068870_10348530 | 3300005840 | Bacteria | 950 |
| 314 | Ga0068870_10950660 | 3300005840 | Unclassified | 610 |
| 315 | Ga0068870_11038272 | 3300005840 | Unclassified | 586 |
| 316 | Ga0068863_100002061 | 3300005841 | Bacteria | 19922 |
| 317 | Ga0068863_100068374 | 3300005841 | Unclassified | 3360 |
| 318 | Ga0068863_100069788 | 3300005841 | Bacteria | 3322 |
| 319 | Ga0068863_100089605 | 3300005841 | Bacteria | 2917 |
| 320 | Ga0068863_101589276 | 3300005841 | Bacteria | 663 |
| 321 | Ga0068863_102284085 | 3300005841 | Unclassified | 551 |
| 322 | Ga0068858_100018687 | 3300005842 | Bacteria | 6488 |
| 323 | Ga0068858_100058040 | 3300005842 | Bacteria | 3578 |
| 324 | Ga0068858_100122236 | 3300005842 | Bacteria | 2435 |
| 325 | Ga0068858_100308191 | 3300005842 | Bacteria | 1511 |
| 326 | Ga0068858_101290364 | 3300005842 | Unclassified | 718 |
| 327 | Ga0068858_101342782 | 3300005842 | Bacteria | 704 |
| 328 | Ga0068860_100002194 | 3300005843 | Bacteria | 20537 |
| 329 | Ga0068860_100023907 | 3300005843 | Bacteria | 5906 |
| 330 | Ga0068860_100028328 | 3300005843 | Bacteria | 5391 |
| 331 | Ga0068860_100070347 | 3300005843 | Bacteria | 3327 |
| 332 | Ga0068860_100303771 | 3300005843 | Bacteria | 1564 |
| 333 | Ga0068860_100423539 | 3300005843 | Bacteria | 1320 |
| 334 | Ga0068860_100456534 | 3300005843 | Unclassified | 1271 |
| 335 | Ga0068860_100511543 | 3300005843 | Unclassified | 1200 |
| 336 | Ga0068860_100873152 | 3300005843 | Bacteria | 915 |
| 337 | Ga0068860_100990675 | 3300005843 | Bacteria | 858 |
| 338 | Ga0068860_101052916 | 3300005843 | Unclassified | 832 |
| 339 | Ga0068860_101343123 | 3300005843 | Unclassified | 736 |
| 340 | Ga0068860_101929773 | 3300005843 | Bacteria | 612 |
| 341 | Ga0068862_100003220 | 3300005844 | Bacteria | 14137 |
| 342 | Ga0068862_100569162 | 3300005844 | Unclassified | 1084 |
| 343 | Ga0068862_101685687 | 3300005844 | Unclassified | 642 |
| 344 | Ga0081455_10116340 | 3300005937 | Bacteria | 2115 |
| 345 | Ga0081455_10489905 | 3300005937 | Bacteria | 829 |
| 346 | Ga0070717_10923740 | 3300006028 | Unclassified | 794 |
| 347 | Ga0097621_100029485 | 3300006237 | Unclassified | 4334 |
| 348 | Ga0097621_100039382 | 3300006237 | Bacteria | 3796 |
| 349 | Ga0097621_100039987 | 3300006237 | Bacteria | 3768 |
| 350 | Ga0097621_100048756 | 3300006237 | Unclassified | 3438 |
| 351 | Ga0097621_100080595 | 3300006237 | Unclassified | 2708 |
| 352 | Ga0097621_100123936 | 3300006237 | Bacteria | 2194 |
| 353 | Ga0097621_100130234 | 3300006237 | Bacteria | 2141 |
| 354 | Ga0097621_100157845 | 3300006237 | Unclassified | 1948 |
| 355 | Ga0097621_100537675 | 3300006237 | Unclassified | 1062 |
| 356 | Ga0097621_100653481 | 3300006237 | Bacteria | 965 |
| 357 | Ga0097621_101375952 | 3300006237 | Bacteria | 668 |
| 358 | Ga0068871_100013498 | 3300006358 | Bacteria | 6065 |
| 359 | Ga0068871_100019371 | 3300006358 | Bacteria | 5196 |
| 360 | Ga0068871_100020714 | 3300006358 | Bacteria | 5043 |
| 361 | Ga0068871_100024112 | 3300006358 | Bacteria | 4715 |
| 362 | Ga0068871_100053946 | 3300006358 | Bacteria | 3260 |
| 363 | Ga0068871_100079486 | 3300006358 | Unclassified | 2713 |
| 364 | Ga0068871_100117842 | 3300006358 | Unclassified | 2240 |
| 365 | Ga0068871_100162161 | 3300006358 | Bacteria | 1913 |
| 366 | Ga0068871_100588501 | 3300006358 | Bacteria | 1011 |
| 367 | Ga0068871_100621333 | 3300006358 | Bacteria | 984 |
| 368 | Ga0068871_100709966 | 3300006358 | Unclassified | 922 |
| 369 | Ga0068871_100738288 | 3300006358 | Unclassified | 904 |
| 370 | Ga0075428_100033591 | 3300006844 | Bacteria | 5663 |
| 371 | Ga0075428_100037354 | 3300006844 | Bacteria | 5348 |
| 372 | Ga0075428_100085873 | 3300006844 | Bacteria | 3432 |
| 373 | Ga0075428_100120531 | 3300006844 | Unclassified | 2856 |
| 374 | Ga0075428_100133559 | 3300006844 | Bacteria | 2699 |
| 375 | Ga0075428_100172891 | 3300006844 | Unclassified | 2341 |
| 376 | Ga0075428_100217301 | 3300006844 | Bacteria | 2064 |
| 377 | Ga0075428_101246106 | 3300006844 | Unclassified | 783 |
| 378 | Ga0075428_101567422 | 3300006844 | Unclassified | 689 |
| 379 | Ga0075430_100003769 | 3300006846 | Bacteria | 12738 |
| 380 | Ga0075430_100089728 | 3300006846 | Bacteria | 2572 |
| 381 | Ga0075431_100018585 | 3300006847 | Bacteria | 7081 |
| 382 | Ga0075431_100129847 | 3300006847 | Unclassified | 2600 |
| 383 | Ga0075431_101159055 | 3300006847 | Unclassified | 736 |
| 384 | Ga0075433_10002662 | 3300006852 | Bacteria | 13632 |
| 385 | Ga0075433_10120708 | 3300006852 | Bacteria | 2327 |
| 386 | Ga0075433_10158456 | 3300006852 | Bacteria | 2014 |
| 387 | Ga0075433_10330313 | 3300006852 | Bacteria | 1348 |
| 388 | Ga0075433_10590156 | 3300006852 | Unclassified | 976 |
| 389 | Ga0075433_10696772 | 3300006852 | Bacteria | 890 |
| 390 | Ga0075434_100047389 | 3300006871 | Bacteria | 4265 |
| 391 | Ga0075434_100085384 | 3300006871 | Unclassified | 3155 |
| 392 | Ga0075434_100096545 | 3300006871 | Unclassified | 2960 |
| 393 | Ga0075434_100119420 | 3300006871 | Unclassified | 2650 |
| 394 | Ga0075434_100140198 | 3300006871 | Bacteria | 2437 |
| 395 | Ga0075434_100165630 | 3300006871 | Unclassified | 2230 |
| 396 | Ga0075434_100233006 | 3300006871 | Bacteria | 1861 |
| 397 | Ga0075434_100306602 | 3300006871 | Bacteria | 1608 |
| 398 | Ga0075434_100328658 | 3300006871 | Bacteria | 1549 |
| 399 | Ga0075434_100425718 | 3300006871 | Unclassified | 1349 |
| 400 | Ga0075434_100685161 | 3300006871 | Unclassified | 1043 |
| 401 | Ga0075434_101152270 | 3300006871 | Unclassified | 788 |
| 402 | Ga0075434_102470681 | 3300006871 | Unclassified | 521 |
| 403 | Ga0075429_100049770 | 3300006880 | Unclassified | 3645 |
| 404 | Ga0075429_100117268 | 3300006880 | Unclassified | 2327 |
| 405 | Ga0075429_100194529 | 3300006880 | Unclassified | 1776 |
| 406 | Ga0075429_100339637 | 3300006880 | Unclassified | 1315 |
| 407 | Ga0075429_100476534 | 3300006880 | Bacteria | 1094 |
| 408 | Ga0068865_100010239 | 3300006881 | Bacteria | 5831 |
| 409 | Ga0068865_100013640 | 3300006881 | Bacteria | 5144 |
| 410 | Ga0068865_100114681 | 3300006881 | Bacteria | 1993 |
| 411 | Ga0068865_100133264 | 3300006881 | Bacteria | 1864 |
| 412 | Ga0068865_100211295 | 3300006881 | Bacteria | 1512 |
| 413 | Ga0068865_100219518 | 3300006881 | Bacteria | 1486 |
| 414 | Ga0068865_100417728 | 3300006881 | Bacteria | 1102 |
| 415 | Ga0068865_100594296 | 3300006881 | Unclassified | 935 |
| 416 | Ga0075436_100663870 | 3300006914 | Bacteria | 771 |
| 417 | Ga0075436_100847908 | 3300006914 | Unclassified | 682 |
| 418 | Ga0097620_100008792 | 3300006931 | Bacteria | 10194 |
| 419 | Ga0097620_100013417 | 3300006931 | Bacteria | 8216 |
| 420 | Ga0097620_100133539 | 3300006931 | Unclassified | 2554 |
| 421 | Ga0097620_100137166 | 3300006931 | Bacteria | 2520 |
| 422 | Ga0097620_100403527 | 3300006931 | Bacteria | 1463 |
| 423 | Ga0097620_100959881 | 3300006931 | Unclassified | 938 |
| 424 | Ga0097620_101314188 | 3300006931 | Unclassified | 797 |
| 425 | Ga0097620_101733172 | 3300006931 | Unclassified | 690 |
| 426 | Ga0075435_100022668 | 3300007076 | Unclassified | 4846 |
| 427 | Ga0075435_100040029 | 3300007076 | Unclassified | 3742 |
| 428 | Ga0075435_100113926 | 3300007076 | Unclassified | 2251 |
| 429 | Ga0075435_100149793 | 3300007076 | Bacteria | 1961 |
| 430 | Ga0075435_100304615 | 3300007076 | Bacteria | 1363 |
| 431 | Ga0075435_100304728 | 3300007076 | Bacteria | 1363 |
| 432 | Ga0075435_100351842 | 3300007076 | Bacteria | 1263 |
| 433 | Ga0075435_100595014 | 3300007076 | Bacteria | 959 |
| 434 | Ga0075435_100948791 | 3300007076 | Unclassified | 751 |
| 435 | Ga0075435_100968742 | 3300007076 | Unclassified | 742 |
| 436 | Ga0099794_10039852 | 3300007265 | Unclassified | 2231 |
| 437 | Ga0105240_10003663 | 3300009093 | Bacteria | 23765 |
| 438 | Ga0105240_10020135 | 3300009093 | Bacteria | 8905 |
| 439 | Ga0105240_10064169 | 3300009093 | Unclassified | 4565 |
| 440 | Ga0105240_10166412 | 3300009093 | Unclassified | 2615 |
| 441 | Ga0105240_10227599 | 3300009093 | Bacteria | 2169 |
| 442 | Ga0105240_11440380 | 3300009093 | Bacteria | 723 |
| 443 | Ga0111539_10016172 | 3300009094 | Bacteria | 9256 |
| 444 | Ga0111539_10044634 | 3300009094 | Bacteria | 5309 |
| 445 | Ga0111539_10070479 | 3300009094 | Unclassified | 4127 |
| 446 | Ga0111539_10175430 | 3300009094 | Bacteria | 2504 |
| 447 | Ga0111539_10251201 | 3300009094 | Bacteria | 2059 |
| 448 | Ga0111539_10704830 | 3300009094 | Bacteria | 1175 |
| 449 | Ga0111539_10730743 | 3300009094 | Bacteria | 1152 |
| 450 | Ga0105245_10006391 | 3300009098 | Bacteria | 10368 |
| 451 | Ga0105245_10010932 | 3300009098 | Bacteria | 7897 |
| 452 | Ga0105245_10205035 | 3300009098 | Bacteria | 1895 |
| 453 | Ga0105245_10223273 | 3300009098 | Bacteria | 1819 |
| 454 | Ga0105245_10852495 | 3300009098 | Bacteria | 951 |
| 455 | Ga0105245_10966040 | 3300009098 | Bacteria | 895 |
| 456 | Ga0105245_10969270 | 3300009098 | Unclassified | 894 |
| 457 | Ga0105245_10997376 | 3300009098 | Unclassified | 882 |
| 458 | Ga0105245_11406372 | 3300009098 | Bacteria | 748 |
| 459 | Ga0105245_11494283 | 3300009098 | Unclassified | 726 |
| 460 | Ga0105245_12271001 | 3300009098 | Unclassified | 596 |
| 461 | Ga0105245_12293727 | 3300009098 | Unclassified | 593 |
| 462 | Ga0105245_12337930 | 3300009098 | Unclassified | 588 |
| 463 | Ga0105247_10006873 | 3300009101 | Bacteria | 7011 |
| 464 | Ga0105247_10702164 | 3300009101 | Unclassified | 761 |
| 465 | Ga0114129_10002325 | 3300009147 | Bacteria | 26400 |
| 466 | Ga0114129_10025741 | 3300009147 | Bacteria | 8334 |
| 467 | Ga0114129_10029196 | 3300009147 | Bacteria | 7811 |
| 468 | Ga0114129_10050075 | 3300009147 | Bacteria | 5868 |
| 469 | Ga0114129_10069233 | 3300009147 | Bacteria | 4919 |
| 470 | Ga0114129_10478082 | 3300009147 | Bacteria | 1630 |
| 471 | Ga0114129_10507032 | 3300009147 | Unclassified | 1575 |
| 472 | Ga0114129_10593386 | 3300009147 | Unclassified | 1436 |
| 473 | Ga0114129_10772522 | 3300009147 | Unclassified | 1228 |
| 474 | Ga0114129_11128970 | 3300009147 | Bacteria | 980 |
| 475 | Ga0105243_10013693 | 3300009148 | Bacteria | 6136 |
| 476 | Ga0105243_10014817 | 3300009148 | Bacteria | 5899 |
| 477 | Ga0105243_10016503 | 3300009148 | Bacteria | 5583 |
| 478 | Ga0105243_10175564 | 3300009148 | Bacteria | 1859 |
| 479 | Ga0105243_10181181 | 3300009148 | Bacteria | 1832 |
| 480 | Ga0105243_10468310 | 3300009148 | Unclassified | 1186 |
| 481 | Ga0105243_11908025 | 3300009148 | Unclassified | 627 |
| 482 | Ga0105241_10020683 | 3300009174 | Bacteria | 4862 |
| 483 | Ga0105241_10024599 | 3300009174 | Bacteria | 4472 |
| 484 | Ga0105241_10049390 | 3300009174 | Bacteria | 3204 |
| 485 | Ga0105241_10069983 | 3300009174 | Bacteria | 2721 |
| 486 | Ga0105241_10091837 | 3300009174 | Unclassified | 2396 |
| 487 | Ga0105241_10193333 | 3300009174 | Unclassified | 1695 |
| 488 | Ga0105241_10282514 | 3300009174 | Bacteria | 1418 |
| 489 | Ga0105241_10883890 | 3300009174 | Unclassified | 829 |
| 490 | Ga0105242_10015811 | 3300009176 | Bacteria | 5862 |
| 491 | Ga0105242_10020652 | 3300009176 | Bacteria | 5167 |
| 492 | Ga0105242_10026637 | 3300009176 | Unclassified | 4583 |
| 493 | Ga0105242_10029211 | 3300009176 | Bacteria | 4395 |
| 494 | Ga0105242_10091744 | 3300009176 | Bacteria | 2558 |
| 495 | Ga0105242_10106653 | 3300009176 | Bacteria | 2381 |
| 496 | Ga0105242_10206468 | 3300009176 | Unclassified | 1747 |
| 497 | Ga0105242_10262885 | 3300009176 | Bacteria | 1560 |
| 498 | Ga0105242_10341942 | 3300009176 | Bacteria | 1379 |
| 499 | Ga0105242_10468515 | 3300009176 | Unclassified | 1191 |
| 500 | Ga0105242_11878081 | 3300009176 | Bacteria | 639 |
| 501 | Ga0105242_13006680 | 3300009176 | Unclassified | 522 |
| 502 | Ga0105248_10060955 | 3300009177 | Bacteria | 4235 |
| 503 | Ga0105248_10106134 | 3300009177 | Bacteria | 3167 |
| 504 | Ga0105248_10113816 | 3300009177 | Bacteria | 3051 |
| 505 | Ga0105248_10171127 | 3300009177 | Bacteria | 2448 |
| 506 | Ga0105248_10208234 | 3300009177 | Bacteria | 2203 |
| 507 | Ga0105248_10257140 | 3300009177 | Bacteria | 1966 |
| 508 | Ga0105248_10611923 | 3300009177 | Bacteria | 1229 |
| 509 | Ga0105248_10726673 | 3300009177 | Unclassified | 1120 |
| 510 | Ga0105248_11110556 | 3300009177 | Bacteria | 894 |
| 511 | Ga0105237_10006103 | 3300009545 | Bacteria | 13467 |
| 512 | Ga0105237_10008051 | 3300009545 | Bacteria | 11462 |
| 513 | Ga0105237_10012134 | 3300009545 | Bacteria | 9089 |
| 514 | Ga0105237_10146161 | 3300009545 | Unclassified | 2359 |
| 515 | Ga0105237_10266671 | 3300009545 | Bacteria | 1715 |
| 516 | Ga0105237_10303500 | 3300009545 | Bacteria | 1600 |
| 517 | Ga0105237_10707403 | 3300009545 | Unclassified | 1014 |
| 518 | Ga0105237_11321534 | 3300009545 | Unclassified | 727 |
| 519 | Ga0105237_11656020 | 3300009545 | Bacteria | 647 |
| 520 | Ga0105238_10004906 | 3300009551 | Bacteria | 13238 |
| 521 | Ga0105238_10028228 | 3300009551 | Bacteria | 5717 |
| 522 | Ga0105238_10062533 | 3300009551 | Bacteria | 3723 |
| 523 | Ga0105238_10067738 | 3300009551 | Bacteria | 3570 |
| 524 | Ga0105238_10070174 | 3300009551 | Bacteria | 3504 |
| 525 | Ga0105249_10001517 | 3300009553 | Bacteria | 20379 |
| 526 | Ga0105249_10324208 | 3300009553 | Unclassified | 1552 |
| 527 | Ga0105249_10623001 | 3300009553 | Bacteria | 1135 |
| 528 | Ga0105249_11210733 | 3300009553 | Bacteria | 826 |
| 529 | Ga0105249_11341102 | 3300009553 | Bacteria | 787 |
| 530 | Ga0105249_11407032 | 3300009553 | Unclassified | 769 |
| 531 | Ga0105239_10008018 | 3300010375 | Bacteria | 12057 |
| 532 | Ga0105239_10011847 | 3300010375 | Bacteria | 9729 |
| 533 | Ga0105239_10109635 | 3300010375 | Bacteria | 3059 |
| 534 | Ga0105239_10703520 | 3300010375 | Bacteria | 1155 |
| 535 | Ga0105246_10006946 | 3300011119 | Bacteria | 6924 |
| 536 | Ga0105246_10054272 | 3300011119 | Bacteria | 2761 |
| 537 | Ga0105246_10081006 | 3300011119 | Unclassified | 2312 |
| 538 | Ga0105246_10400069 | 3300011119 | Bacteria | 1140 |
| 539 | Ga0105246_10901759 | 3300011119 | Unclassified | 793 |
| 540 | Ga0105246_11864741 | 3300011119 | Unclassified | 576 |
| 541 | Ga0157370_10002320 | 3300013104 | Bacteria | 23045 |
| 542 | Ga0157370_10013256 | 3300013104 | Bacteria | 8495 |
| 543 | Ga0157369_10000856 | 3300013105 | Bacteria | 38815 |
| 544 | Ga0157369_10020341 | 3300013105 | Bacteria | 7420 |
| 545 | Ga0157369_10235325 | 3300013105 | Unclassified | 1914 |
| 546 | Ga0157369_10997637 | 3300013105 | Unclassified | 857 |
| 547 | Ga0157369_11027969 | 3300013105 | Bacteria | 843 |
| 548 | Ga0157374_10004706 | 3300013296 | Bacteria | 11461 |
| 549 | Ga0157374_10057967 | 3300013296 | Bacteria | 3619 |
| 550 | Ga0157374_10097378 | 3300013296 | Unclassified | 2815 |
| 551 | Ga0157374_10141716 | 3300013296 | Unclassified | 2334 |
| 552 | Ga0157374_10477631 | 3300013296 | Unclassified | 1250 |
| 553 | Ga0157374_10523884 | 3300013296 | Bacteria | 1191 |
| 554 | Ga0157374_11576381 | 3300013296 | Bacteria | 681 |
| 555 | Ga0157378_10004469 | 3300013297 | Bacteria | 12281 |
| 556 | Ga0157378_10069719 | 3300013297 | Bacteria | 3155 |
| 557 | Ga0157378_10153012 | 3300013297 | Bacteria | 2150 |
| 558 | Ga0157378_10628827 | 3300013297 | Bacteria | 1087 |
| 559 | Ga0157378_11063431 | 3300013297 | Unclassified | 845 |
| 560 | Ga0163162_10007906 | 3300013306 | Bacteria | 10363 |
| 561 | Ga0163162_10167605 | 3300013306 | Bacteria | 2320 |
| 562 | Ga0163162_10365959 | 3300013306 | Bacteria | 1575 |
| 563 | Ga0163162_10763451 | 3300013306 | Unclassified | 1086 |
| 564 | Ga0163162_10864437 | 3300013306 | Bacteria | 1019 |
| 565 | Ga0163162_10884522 | 3300013306 | Unclassified | 1007 |
| 566 | Ga0163162_12073710 | 3300013306 | Bacteria | 652 |
| 567 | Ga0157372_10020489 | 3300013307 | Bacteria | 7136 |
| 568 | Ga0157372_10024353 | 3300013307 | Bacteria | 6574 |
| 569 | Ga0157372_10068428 | 3300013307 | Bacteria | 3992 |
| 570 | Ga0157372_10279702 | 3300013307 | Unclassified | 1940 |
| 571 | Ga0157372_10309247 | 3300013307 | Unclassified | 1839 |
| 572 | Ga0157372_10312674 | 3300013307 | Bacteria | 1829 |
| 573 | Ga0157372_10770830 | 3300013307 | Bacteria | 1118 |
| 574 | Ga0157372_11115339 | 3300013307 | Unclassified | 912 |
| 575 | Ga0157375_10006342 | 3300013308 | Bacteria | 10311 |
| 576 | Ga0157375_10013179 | 3300013308 | Bacteria | 7350 |
| 577 | Ga0157375_10058331 | 3300013308 | Bacteria | 3818 |
| 578 | Ga0157375_10073966 | 3300013308 | Bacteria | 3428 |
| 579 | Ga0157375_10101653 | 3300013308 | Unclassified | 2958 |
| 580 | Ga0157375_10305473 | 3300013308 | Unclassified | 1755 |
| 581 | Ga0157375_10503260 | 3300013308 | Bacteria | 1375 |
| 582 | Ga0157375_11314982 | 3300013308 | Unclassified | 850 |
| 583 | Ga0157375_11487154 | 3300013308 | Bacteria | 799 |
| 584 | Ga0157375_11585722 | 3300013308 | Unclassified | 774 |
| 585 | Ga0163163_10004905 | 3300014325 | Bacteria | 11506 |
| 586 | Ga0163163_10185940 | 3300014325 | Bacteria | 2125 |
| 587 | Ga0163163_10198573 | 3300014325 | Bacteria | 2054 |
| 588 | Ga0163163_10236688 | 3300014325 | Bacteria | 1875 |
| 589 | Ga0163163_10383455 | 3300014325 | Bacteria | 1463 |
| 590 | Ga0163163_11808929 | 3300014325 | Unclassified | 671 |
| 591 | Ga0163163_11812206 | 3300014325 | Unclassified | 670 |
| 592 | Ga0157380_10001628 | 3300014326 | Archaea | 14808 |
| 593 | Ga0157380_10033205 | 3300014326 | Unclassified | 3973 |
| 594 | Ga0157380_10035075 | 3300014326 | Bacteria | 3873 |
| 595 | Ga0157380_10040834 | 3300014326 | Bacteria | 3617 |
| 596 | Ga0157380_10057405 | 3300014326 | Bacteria | 3100 |
| 597 | Ga0157380_10137318 | 3300014326 | Bacteria | 2095 |
| 598 | Ga0157380_10235205 | 3300014326 | Bacteria | 1648 |
| 599 | Ga0157380_10372187 | 3300014326 | Bacteria | 1345 |
| 600 | Ga0157377_10005177 | 3300014745 | Bacteria | 6100 |
| 601 | Ga0157379_10006764 | 3300014968 | Bacteria | 9908 |
| 602 | Ga0157379_10066570 | 3300014968 | Bacteria | 3220 |
| 603 | Ga0157379_10093858 | 3300014968 | Bacteria | 2692 |
| 604 | Ga0157379_10386298 | 3300014968 | Bacteria | 1285 |
| 605 | Ga0157379_10860219 | 3300014968 | Unclassified | 858 |
| 606 | Ga0157379_10911158 | 3300014968 | Bacteria | 834 |
| 607 | Ga0157379_11382689 | 3300014968 | Unclassified | 682 |
| 608 | Ga0157376_10064091 | 3300014969 | Unclassified | 3098 |
| 609 | Ga0157376_10104084 | 3300014969 | Bacteria | 2487 |
| 610 | Ga0157376_10119831 | 3300014969 | Bacteria | 2330 |
| 611 | Ga0157376_10182589 | 3300014969 | Unclassified | 1919 |
| 612 | Ga0157376_10298798 | 3300014969 | Unclassified | 1523 |
| 613 | Ga0157376_10302807 | 3300014969 | Bacteria | 1514 |
| 614 | Ga0157376_10351170 | 3300014969 | Bacteria | 1411 |
| 615 | Ga0157376_10547673 | 3300014969 | Bacteria | 1144 |
| 616 | Ga0163161_10024908 | 3300017792 | Bacteria | 4230 |
| 617 | Ga0163161_10951212 | 3300017792 | Unclassified | 731 |
| 618 | Ga0163161_11061894 | 3300017792 | Unclassified | 694 |
| 619 | Ga0206352_10276273 | 3300020078 | Unclassified | 852 |
| 620 | Ga0213875_10020183 | 3300021388 | Unclassified | 3197 |
| 621 | Ga0207673_1015351 | 3300025290 | Bacteria | 1013 |
| 622 | Ga0207697_10001790 | 3300025315 | Bacteria | 11496 |
| 623 | Ga0207656_10044342 | 3300025321 | Bacteria | 1899 |
| 624 | Ga0207653_10038169 | 3300025885 | Bacteria | 1569 |
| 625 | Ga0207682_10002980 | 3300025893 | Bacteria | 7427 |
| 626 | Ga0207682_10003881 | 3300025893 | Bacteria | 6393 |
| 627 | Ga0207682_10035183 | 3300025893 | Bacteria | 2022 |
| 628 | Ga0207692_10447154 | 3300025898 | Unclassified | 813 |
| 629 | Ga0207642_10031206 | 3300025899 | Bacteria | 2229 |
| 630 | Ga0207642_10106625 | 3300025899 | Unclassified | 1418 |
| 631 | Ga0207642_10259319 | 3300025899 | Bacteria | 990 |
| 632 | Ga0207642_10522134 | 3300025899 | Unclassified | 730 |
| 633 | Ga0207710_10016079 | 3300025900 | Bacteria | 3165 |
| 634 | Ga0207688_10002313 | 3300025901 | Bacteria | 10244 |
| 635 | Ga0207680_10283130 | 3300025903 | Bacteria | 1152 |
| 636 | Ga0207680_10291311 | 3300025903 | Bacteria | 1136 |
| 637 | Ga0207680_10884041 | 3300025903 | Unclassified | 640 |
| 638 | Ga0207647_10239478 | 3300025904 | Unclassified | 1042 |
| 639 | Ga0207699_10308459 | 3300025906 | Bacteria | 1107 |
| 640 | Ga0207645_10004825 | 3300025907 | Bacteria | 9904 |
| 641 | Ga0207645_10013798 | 3300025907 | Bacteria | 5422 |
| 642 | Ga0207645_10050497 | 3300025907 | Bacteria | 2656 |
| 643 | Ga0207645_10094311 | 3300025907 | Bacteria | 1926 |
| 644 | Ga0207643_10000719 | 3300025908 | Bacteria | 20342 |
| 645 | Ga0207643_10003155 | 3300025908 | Bacteria | 8878 |
| 646 | Ga0207643_10021602 | 3300025908 | Bacteria | 3538 |
| 647 | Ga0207643_10036366 | 3300025908 | Bacteria | 2761 |
| 648 | Ga0207643_10098401 | 3300025908 | Bacteria | 1713 |
| 649 | Ga0207643_10239236 | 3300025908 | Bacteria | 1115 |
| 650 | Ga0207643_10276967 | 3300025908 | Unclassified | 1040 |
| 651 | Ga0207643_10775757 | 3300025908 | Unclassified | 621 |
| 652 | Ga0207654_10018789 | 3300025911 | Bacteria | 3633 |
| 653 | Ga0207654_10082009 | 3300025911 | Unclassified | 1944 |
| 654 | Ga0207654_10084206 | 3300025911 | Bacteria | 1922 |
| 655 | Ga0207654_10142895 | 3300025911 | Unclassified | 1528 |
| 656 | Ga0207654_10164816 | 3300025911 | Unclassified | 1434 |
| 657 | Ga0207654_10289068 | 3300025911 | Bacteria | 1111 |
| 658 | Ga0207654_10610968 | 3300025911 | Unclassified | 779 |
| 659 | Ga0207654_11151322 | 3300025911 | Bacteria | 565 |
| 660 | Ga0207707_10039969 | 3300025912 | Bacteria | 4098 |
| 661 | Ga0207707_10177490 | 3300025912 | Bacteria | 1860 |
| 662 | Ga0207707_10640197 | 3300025912 | Unclassified | 897 |
| 663 | Ga0207707_10868193 | 3300025912 | Bacteria | 748 |
| 664 | Ga0207695_10000302 | 3300025913 | Bacteria | 121140 |
| 665 | Ga0207695_10019328 | 3300025913 | Bacteria | 7845 |
| 666 | Ga0207695_10034902 | 3300025913 | Bacteria | 5462 |
| 667 | Ga0207695_10129150 | 3300025913 | Bacteria | 2486 |
| 668 | Ga0207695_10393048 | 3300025913 | Unclassified | 1271 |
| 669 | Ga0207695_10757591 | 3300025913 | Unclassified | 851 |
| 670 | Ga0207695_11461321 | 3300025913 | Bacteria | 564 |
| 671 | Ga0207671_10006862 | 3300025914 | Bacteria | 10046 |
| 672 | Ga0207671_10010106 | 3300025914 | Bacteria | 7822 |
| 673 | Ga0207671_10037469 | 3300025914 | Bacteria | 3596 |
| 674 | Ga0207671_10330361 | 3300025914 | Unclassified | 1207 |
| 675 | Ga0207671_10434503 | 3300025914 | Bacteria | 1045 |
| 676 | Ga0207671_10462504 | 3300025914 | Bacteria | 1011 |
| 677 | Ga0207671_10728108 | 3300025914 | Unclassified | 788 |
| 678 | Ga0207671_10856694 | 3300025914 | Unclassified | 719 |
| 679 | Ga0207660_10061029 | 3300025917 | Bacteria | 2713 |
| 680 | Ga0207660_10448120 | 3300025917 | Unclassified | 1044 |
| 681 | Ga0207662_10004573 | 3300025918 | Bacteria | 7292 |
| 682 | Ga0207662_10007357 | 3300025918 | Bacteria | 5991 |
| 683 | Ga0207662_10051246 | 3300025918 | Bacteria | 2455 |
| 684 | Ga0207662_10546311 | 3300025918 | Unclassified | 802 |
| 685 | Ga0207657_10036023 | 3300025919 | Bacteria | 4432 |
| 686 | Ga0207657_10765974 | 3300025919 | Unclassified | 747 |
| 687 | Ga0207649_10219824 | 3300025920 | Unclassified | 1352 |
| 688 | Ga0207649_10334313 | 3300025920 | Unclassified | 1117 |
| 689 | Ga0207649_10490681 | 3300025920 | Bacteria | 933 |
| 690 | Ga0207649_10645621 | 3300025920 | Bacteria | 817 |
| 691 | Ga0207652_10141636 | 3300025921 | Bacteria | 2150 |
| 692 | Ga0207646_10113720 | 3300025922 | Bacteria | 2430 |
| 693 | Ga0207646_10307493 | 3300025922 | Unclassified | 1432 |
| 694 | Ga0207646_10509236 | 3300025922 | Unclassified | 1084 |
| 695 | Ga0207646_10761770 | 3300025922 | Unclassified | 863 |
| 696 | Ga0207646_10789060 | 3300025922 | Unclassified | 846 |
| 697 | Ga0207681_10001889 | 3300025923 | Bacteria | 13405 |
| 698 | Ga0207681_10029885 | 3300025923 | Bacteria | 3547 |
| 699 | Ga0207681_10041243 | 3300025923 | Unclassified | 3076 |
| 700 | Ga0207681_10266226 | 3300025923 | Unclassified | 1344 |
| 701 | Ga0207681_10338832 | 3300025923 | Unclassified | 1201 |
| 702 | Ga0207694_10003179 | 3300025924 | Bacteria | 13105 |
| 703 | Ga0207694_10006554 | 3300025924 | Bacteria | 8847 |
| 704 | Ga0207694_10006776 | 3300025924 | Bacteria | 8699 |
| 705 | Ga0207694_10040780 | 3300025924 | Unclassified | 3576 |
| 706 | Ga0207694_10043525 | 3300025924 | Unclassified | 3466 |
| 707 | Ga0207694_10049427 | 3300025924 | Bacteria | 3256 |
| 708 | Ga0207694_10057282 | 3300025924 | Bacteria | 3029 |
| 709 | Ga0207694_10067430 | 3300025924 | Bacteria | 2793 |
| 710 | Ga0207694_10071198 | 3300025924 | Bacteria | 2717 |
| 711 | Ga0207694_10229719 | 3300025924 | Bacteria | 1515 |
| 712 | Ga0207650_10021575 | 3300025925 | Bacteria | 4550 |
| 713 | Ga0207650_10133913 | 3300025925 | Bacteria | 1942 |
| 714 | Ga0207650_10247174 | 3300025925 | Bacteria | 1443 |
| 715 | Ga0207659_10000726 | 3300025926 | Bacteria | 19497 |
| 716 | Ga0207659_10003073 | 3300025926 | Bacteria | 9962 |
| 717 | Ga0207659_10045577 | 3300025926 | Bacteria | 3092 |
| 718 | Ga0207659_10088025 | 3300025926 | Bacteria | 2313 |
| 719 | Ga0207659_10090677 | 3300025926 | Bacteria | 2282 |
| 720 | Ga0207659_10120472 | 3300025926 | Bacteria | 2010 |
| 721 | Ga0207659_10218141 | 3300025926 | Bacteria | 1532 |
| 722 | Ga0207687_10002357 | 3300025927 | Bacteria | 12838 |
| 723 | Ga0207687_10003605 | 3300025927 | Bacteria | 10423 |
| 724 | Ga0207687_10026900 | 3300025927 | Unclassified | 3855 |
| 725 | Ga0207687_10055686 | 3300025927 | Bacteria | 2772 |
| 726 | Ga0207687_10061616 | 3300025927 | Bacteria | 2650 |
| 727 | Ga0207687_10080962 | 3300025927 | Bacteria | 2345 |
| 728 | Ga0207687_10831387 | 3300025927 | Bacteria | 788 |
| 729 | Ga0207700_10035307 | 3300025928 | Unclassified | 3600 |
| 730 | Ga0207700_10296739 | 3300025928 | Unclassified | 1394 |
| 731 | Ga0207700_10427868 | 3300025928 | Unclassified | 1164 |
| 732 | Ga0207644_10026183 | 3300025931 | Unclassified | 4016 |
| 733 | Ga0207644_10028476 | 3300025931 | Bacteria | 3868 |
| 734 | Ga0207644_10060754 | 3300025931 | Bacteria | 2735 |
| 735 | Ga0207644_11674373 | 3300025931 | Unclassified | 533 |
| 736 | Ga0207690_10235165 | 3300025932 | Bacteria | 1409 |
| 737 | Ga0207690_10654109 | 3300025932 | Unclassified | 861 |
| 738 | Ga0207690_10936082 | 3300025932 | Unclassified | 719 |
| 739 | Ga0207706_10009301 | 3300025933 | Bacteria | 9023 |
| 740 | Ga0207706_10045295 | 3300025933 | Bacteria | 3898 |
| 741 | Ga0207706_10054690 | 3300025933 | Bacteria | 3522 |
| 742 | Ga0207706_10061632 | 3300025933 | Bacteria | 3303 |
| 743 | Ga0207706_10581059 | 3300025933 | Bacteria | 963 |
| 744 | Ga0207706_10829271 | 3300025933 | Unclassified | 784 |
| 745 | Ga0207686_10010199 | 3300025934 | Bacteria | 5108 |
| 746 | Ga0207686_10018809 | 3300025934 | Bacteria | 3917 |
| 747 | Ga0207686_10024018 | 3300025934 | Bacteria | 3526 |
| 748 | Ga0207686_10058845 | 3300025934 | Unclassified | 2425 |
| 749 | Ga0207686_10069484 | 3300025934 | Unclassified | 2260 |
| 750 | Ga0207686_10148547 | 3300025934 | Unclassified | 1629 |
| 751 | Ga0207686_10180564 | 3300025934 | Bacteria | 1496 |
| 752 | Ga0207686_10269260 | 3300025934 | Unclassified | 1252 |
| 753 | Ga0207686_10293014 | 3300025934 | Bacteria | 1206 |
| 754 | Ga0207709_10005436 | 3300025935 | Bacteria | 7240 |
| 755 | Ga0207709_10016161 | 3300025935 | Bacteria | 4147 |
| 756 | Ga0207709_10051331 | 3300025935 | Unclassified | 2528 |
| 757 | Ga0207709_10307692 | 3300025935 | Bacteria | 1181 |
| 758 | Ga0207709_11049445 | 3300025935 | Unclassified | 668 |
| 759 | Ga0207709_11271722 | 3300025935 | Unclassified | 607 |
| 760 | Ga0207670_10005770 | 3300025936 | Bacteria | 6832 |
| 761 | Ga0207670_10099410 | 3300025936 | Bacteria | 2075 |
| 762 | Ga0207670_10103355 | 3300025936 | Bacteria | 2039 |
| 763 | Ga0207670_10196224 | 3300025936 | Bacteria | 1531 |
| 764 | Ga0207670_10365846 | 3300025936 | Bacteria | 1145 |
| 765 | Ga0207670_10510616 | 3300025936 | Bacteria | 977 |
| 766 | Ga0207670_10828805 | 3300025936 | Unclassified | 772 |
| 767 | Ga0207669_10003825 | 3300025937 | Bacteria | 6559 |
| 768 | Ga0207669_10147131 | 3300025937 | Bacteria | 1644 |
| 769 | Ga0207669_10678587 | 3300025937 | Bacteria | 845 |
| 770 | Ga0207669_11426062 | 3300025937 | Unclassified | 590 |
| 771 | Ga0207704_10008623 | 3300025938 | Bacteria | 4885 |
| 772 | Ga0207704_10012832 | 3300025938 | Bacteria | 4170 |
| 773 | Ga0207704_10042913 | 3300025938 | Unclassified | 2666 |
| 774 | Ga0207704_10149767 | 3300025938 | Unclassified | 1645 |
| 775 | Ga0207704_10188600 | 3300025938 | Bacteria | 1498 |
| 776 | Ga0207704_10552935 | 3300025938 | Unclassified | 936 |
| 777 | Ga0207704_10572430 | 3300025938 | Unclassified | 921 |
| 778 | Ga0207704_10917595 | 3300025938 | Bacteria | 737 |
| 779 | Ga0207691_10021926 | 3300025940 | Bacteria | 6027 |
| 780 | Ga0207691_10055697 | 3300025940 | Bacteria | 3603 |
| 781 | Ga0207691_10063756 | 3300025940 | Unclassified | 3342 |
| 782 | Ga0207691_10064866 | 3300025940 | Unclassified | 3308 |
| 783 | Ga0207691_10098762 | 3300025940 | Unclassified | 2607 |
| 784 | Ga0207691_10333934 | 3300025940 | Bacteria | 1298 |
| 785 | Ga0207691_10779058 | 3300025940 | Unclassified | 804 |
| 786 | Ga0207711_10000342 | 3300025941 | Bacteria | 49421 |
| 787 | Ga0207711_10009349 | 3300025941 | Bacteria | 8185 |
| 788 | Ga0207711_10020105 | 3300025941 | Bacteria | 5563 |
| 789 | Ga0207711_10043690 | 3300025941 | Bacteria | 3824 |
| 790 | Ga0207711_10249310 | 3300025941 | Bacteria | 1630 |
| 791 | Ga0207711_10562707 | 3300025941 | Bacteria | 1063 |
| 792 | Ga0207711_10975516 | 3300025941 | Bacteria | 787 |
| 793 | Ga0207711_11872147 | 3300025941 | Bacteria | 543 |
| 794 | Ga0207689_10003931 | 3300025942 | Bacteria | 13530 |
| 795 | Ga0207689_10009664 | 3300025942 | Bacteria | 8311 |
| 796 | Ga0207689_10060470 | 3300025942 | Bacteria | 3116 |
| 797 | Ga0207689_10105601 | 3300025942 | Bacteria | 2314 |
| 798 | Ga0207689_10110845 | 3300025942 | Bacteria | 2255 |
| 799 | Ga0207689_10164903 | 3300025942 | Viruses | 1826 |
| 800 | Ga0207689_10217737 | 3300025942 | Bacteria | 1578 |
| 801 | Ga0207689_10426477 | 3300025942 | Bacteria | 1107 |
| 802 | Ga0207689_10710123 | 3300025942 | Bacteria | 848 |
| 803 | Ga0207689_11259247 | 3300025942 | Unclassified | 622 |
| 804 | Ga0207661_10005099 | 3300025944 | Bacteria | 9219 |
| 805 | Ga0207661_10008090 | 3300025944 | Bacteria | 7500 |
| 806 | Ga0207661_10043293 | 3300025944 | Unclassified | 3553 |
| 807 | Ga0207661_10058658 | 3300025944 | Unclassified | 3098 |
| 808 | Ga0207661_10087213 | 3300025944 | Bacteria | 2591 |
| 809 | Ga0207661_10337990 | 3300025944 | Bacteria | 1356 |
| 810 | Ga0207661_10345244 | 3300025944 | Bacteria | 1342 |
| 811 | Ga0207661_10946725 | 3300025944 | Unclassified | 793 |
| 812 | Ga0207679_10024068 | 3300025945 | Unclassified | 4172 |
| 813 | Ga0207679_10108841 | 3300025945 | Bacteria | 2183 |
| 814 | Ga0207679_10204346 | 3300025945 | Unclassified | 1652 |
| 815 | Ga0207679_10312104 | 3300025945 | Bacteria | 1359 |
| 816 | Ga0207679_10445370 | 3300025945 | Bacteria | 1148 |
| 817 | Ga0207667_10003211 | 3300025949 | Bacteria | 20189 |
| 818 | Ga0207667_10009573 | 3300025949 | Bacteria | 11401 |
| 819 | Ga0207667_10032373 | 3300025949 | Bacteria | 5636 |
| 820 | Ga0207667_10141050 | 3300025949 | Bacteria | 2481 |
| 821 | Ga0207667_10171662 | 3300025949 | Bacteria | 2228 |
| 822 | Ga0207651_10006064 | 3300025960 | Bacteria | 6280 |
| 823 | Ga0207651_10010414 | 3300025960 | Bacteria | 5155 |
| 824 | Ga0207651_10017293 | 3300025960 | Bacteria | 4256 |
| 825 | Ga0207651_10151471 | 3300025960 | Bacteria | 1806 |
| 826 | Ga0207651_10201759 | 3300025960 | Bacteria | 1594 |
| 827 | Ga0207651_10213306 | 3300025960 | Bacteria | 1555 |
| 828 | Ga0207651_10229888 | 3300025960 | Bacteria | 1505 |
| 829 | Ga0207651_10322090 | 3300025960 | Bacteria | 1292 |
| 830 | Ga0207712_10238318 | 3300025961 | Bacteria | 1464 |
| 831 | Ga0207712_10264433 | 3300025961 | Bacteria | 1396 |
| 832 | Ga0207712_10505596 | 3300025961 | Unclassified | 1033 |
| 833 | Ga0207712_10555735 | 3300025961 | Bacteria | 988 |
| 834 | Ga0207712_10599467 | 3300025961 | Bacteria | 953 |
| 835 | Ga0207712_11559829 | 3300025961 | Unclassified | 592 |
| 836 | Ga0207668_10033425 | 3300025972 | Unclassified | 3407 |
| 837 | Ga0207668_10104947 | 3300025972 | Bacteria | 2108 |
| 838 | Ga0207668_10798828 | 3300025972 | Bacteria | 835 |
| 839 | Ga0207640_10058539 | 3300025981 | Unclassified | 2539 |
| 840 | Ga0207640_10248067 | 3300025981 | Bacteria | 1380 |
| 841 | Ga0207640_11705955 | 3300025981 | Bacteria | 569 |
| 842 | Ga0207658_10455901 | 3300025986 | Bacteria | 1133 |
| 843 | Ga0207658_10769747 | 3300025986 | Unclassified | 873 |
| 844 | Ga0207658_10775242 | 3300025986 | Bacteria | 869 |
| 845 | Ga0207677_10377706 | 3300026023 | Bacteria | 1195 |
| 846 | Ga0207677_10805736 | 3300026023 | Unclassified | 841 |
| 847 | Ga0207677_10931563 | 3300026023 | Unclassified | 785 |
| 848 | Ga0207703_10019568 | 3300026035 | Bacteria | 5291 |
| 849 | Ga0207703_10025716 | 3300026035 | Bacteria | 4631 |
| 850 | Ga0207703_10101243 | 3300026035 | Bacteria | 2442 |
| 851 | Ga0207703_10107008 | 3300026035 | Bacteria | 2380 |
| 852 | Ga0207703_10135402 | 3300026035 | Bacteria | 2132 |
| 853 | Ga0207703_10215527 | 3300026035 | Bacteria | 1714 |
| 854 | Ga0207703_10434905 | 3300026035 | Bacteria | 1223 |
| 855 | Ga0207703_10491215 | 3300026035 | Bacteria | 1151 |
| 856 | Ga0207703_11156583 | 3300026035 | Bacteria | 744 |
| 857 | Ga0207639_10066477 | 3300026041 | Bacteria | 2802 |
| 858 | Ga0207639_10068096 | 3300026041 | Unclassified | 2772 |
| 859 | Ga0207639_10326808 | 3300026041 | Unclassified | 1363 |
| 860 | Ga0207639_10355922 | 3300026041 | Unclassified | 1309 |
| 861 | Ga0207639_10390590 | 3300026041 | Bacteria | 1251 |
| 862 | Ga0207678_10186485 | 3300026067 | Bacteria | 1772 |
| 863 | Ga0207708_10017373 | 3300026075 | Bacteria | 5416 |
| 864 | Ga0207708_10020438 | 3300026075 | Bacteria | 4994 |
| 865 | Ga0207708_10045783 | 3300026075 | Unclassified | 3334 |
| 866 | Ga0207708_10106910 | 3300026075 | Bacteria | 2170 |
| 867 | Ga0207708_11795648 | 3300026075 | Unclassified | 538 |
| 868 | Ga0207708_11947547 | 3300026075 | Unclassified | 515 |
| 869 | Ga0207702_10005246 | 3300026078 | Bacteria | 11377 |
| 870 | Ga0207702_10047871 | 3300026078 | Bacteria | 3604 |
| 871 | Ga0207702_10147795 | 3300026078 | Bacteria | 2135 |
| 872 | Ga0207702_10261594 | 3300026078 | Unclassified | 1629 |
| 873 | Ga0207702_10274331 | 3300026078 | Bacteria | 1592 |
| 874 | Ga0207702_10529960 | 3300026078 | Unclassified | 1150 |
| 875 | Ga0207702_10545814 | 3300026078 | Unclassified | 1133 |
| 876 | Ga0207641_10035499 | 3300026088 | Unclassified | 4154 |
| 877 | Ga0207641_10086199 | 3300026088 | Bacteria | 2738 |
| 878 | Ga0207641_10142164 | 3300026088 | Unclassified | 2166 |
| 879 | Ga0207641_10580195 | 3300026088 | Bacteria | 1096 |
| 880 | Ga0207641_10984121 | 3300026088 | Bacteria | 840 |
| 881 | Ga0207641_10997502 | 3300026088 | Bacteria | 834 |
| 882 | Ga0207641_11185301 | 3300026088 | Bacteria | 763 |
| 883 | Ga0207648_10003945 | 3300026089 | Bacteria | 15434 |
| 884 | Ga0207648_10018835 | 3300026089 | Bacteria | 6239 |
| 885 | Ga0207648_10019273 | 3300026089 | Bacteria | 6159 |
| 886 | Ga0207648_10025354 | 3300026089 | Bacteria | 5284 |
| 887 | Ga0207648_10035630 | 3300026089 | Unclassified | 4384 |
| 888 | Ga0207648_10104897 | 3300026089 | Bacteria | 2479 |
| 889 | Ga0207648_10175432 | 3300026089 | Bacteria | 1895 |
| 890 | Ga0207648_10226907 | 3300026089 | Bacteria | 1661 |
| 891 | Ga0207648_10262897 | 3300026089 | Bacteria | 1540 |
| 892 | Ga0207648_10309254 | 3300026089 | Bacteria | 1418 |
| 893 | Ga0207648_10429152 | 3300026089 | Bacteria | 1201 |
| 894 | Ga0207648_10797051 | 3300026089 | Bacteria | 879 |
| 895 | Ga0207648_10976299 | 3300026089 | Unclassified | 793 |
| 896 | Ga0207648_11365668 | 3300026089 | Unclassified | 666 |
| 897 | Ga0207676_10040361 | 3300026095 | Bacteria | 3577 |
| 898 | Ga0207676_10044689 | 3300026095 | Bacteria | 3419 |
| 899 | Ga0207676_10166965 | 3300026095 | Unclassified | 1913 |
| 900 | Ga0207676_11159103 | 3300026095 | Unclassified | 765 |
| 901 | Ga0207676_11608905 | 3300026095 | Unclassified | 647 |
| 902 | Ga0207676_12540293 | 3300026095 | Unclassified | 509 |
| 903 | Ga0207674_10001765 | 3300026116 | Bacteria | 27659 |
| 904 | Ga0207674_10012664 | 3300026116 | Bacteria | 9424 |
| 905 | Ga0207674_10048681 | 3300026116 | Bacteria | 4338 |
| 906 | Ga0207674_10050355 | 3300026116 | Unclassified | 4256 |
| 907 | Ga0207674_10058693 | 3300026116 | Bacteria | 3897 |
| 908 | Ga0207674_10223020 | 3300026116 | Bacteria | 1833 |
| 909 | Ga0207674_10298481 | 3300026116 | Unclassified | 1560 |
| 910 | Ga0207674_10663864 | 3300026116 | Bacteria | 1007 |
| 911 | Ga0207674_11174578 | 3300026116 | Bacteria | 737 |
| 912 | Ga0207675_100001637 | 3300026118 | Bacteria | 22454 |
| 913 | Ga0207675_100017102 | 3300026118 | Bacteria | 6772 |
| 914 | Ga0207675_100022288 | 3300026118 | Bacteria | 5897 |
| 915 | Ga0207675_100048376 | 3300026118 | Bacteria | 3969 |
| 916 | Ga0207675_100122370 | 3300026118 | Bacteria | 2463 |
| 917 | Ga0207675_100232072 | 3300026118 | Bacteria | 1781 |
| 918 | Ga0207675_100628842 | 3300026118 | Unclassified | 1078 |
| 919 | Ga0207675_100646833 | 3300026118 | Bacteria | 1063 |
| 920 | Ga0207675_100812753 | 3300026118 | Bacteria | 949 |
| 921 | Ga0207683_10009184 | 3300026121 | Bacteria | 8424 |
| 922 | Ga0207683_10054261 | 3300026121 | Unclassified | 3514 |
| 923 | Ga0207683_10097166 | 3300026121 | Bacteria | 2626 |
| 924 | Ga0207683_10303670 | 3300026121 | Bacteria | 1460 |
| 925 | Ga0207683_10316897 | 3300026121 | Bacteria | 1428 |
| 926 | Ga0207683_10664172 | 3300026121 | Bacteria | 966 |
| 927 | Ga0207683_10803045 | 3300026121 | Bacteria | 873 |
| 928 | Ga0207698_10030727 | 3300026142 | Unclassified | 3868 |
| 929 | Ga0207698_10091810 | 3300026142 | Bacteria | 2487 |
| 930 | Ga0207698_10480190 | 3300026142 | Bacteria | 1205 |
| 931 | Ga0207698_10804404 | 3300026142 | Unclassified | 942 |
| 932 | Ga0207698_10817049 | 3300026142 | Unclassified | 935 |
| 933 | Ga0207698_11771031 | 3300026142 | Unclassified | 633 |
| 934 | Ga0209996_1060768 | 3300027395 | Unclassified | 580 |
| 935 | Ga0209968_1033876 | 3300027526 | Unclassified | 860 |
| 936 | Ga0207428_10000986 | 3300027907 | Bacteria | 31515 |
| 937 | Ga0207428_10004387 | 3300027907 | Bacteria | 13451 |
| 938 | Ga0207428_10361777 | 3300027907 | Bacteria | 1066 |
| 939 | Ga0207428_10700454 | 3300027907 | Bacteria | 724 |
| 940 | Ga0268266_10026277 | 3300028379 | Unclassified | 4954 |
| 941 | Ga0268266_10110959 | 3300028379 | Bacteria | 2430 |
| 942 | Ga0268265_10001817 | 3300028380 | Bacteria | 17054 |
| 943 | Ga0268265_10025542 | 3300028380 | Unclassified | 4195 |
| 944 | Ga0268264_10002343 | 3300028381 | Bacteria | 16749 |
| 945 | Ga0268264_10053776 | 3300028381 | Bacteria | 3360 |
| 946 | Ga0268264_10071606 | 3300028381 | Bacteria | 2938 |
| 947 | Ga0268264_10196846 | 3300028381 | Bacteria | 1841 |
| 948 | Ga0268264_10225866 | 3300028381 | Bacteria | 1726 |
| 949 | Ga0268264_10372553 | 3300028381 | Unclassified | 1365 |
| 950 | Ga0268264_10416631 | 3300028381 | Unclassified | 1294 |
| 951 | Ga0268264_10844520 | 3300028381 | Unclassified | 917 |
| 952 | Ga0268264_10925075 | 3300028381 | Bacteria | 876 |
| 953 | Ga0268264_11044295 | 3300028381 | Unclassified | 824 |
| 954 | Ga0268264_11817961 | 3300028381 | Unclassified | 619 |
| 955 | Ga0265762_1078418 | 3300030760 | Bacteria | 704 |
| 956 | Ga0265760_10039341 | 3300031090 | Unclassified | 1407 |
| 957 | Ga0265314_10003122 | 3300031711 | Bacteria | 16288 |
| 958 | Ga0307416_100229966 | 3300032002 | Unclassified | 1787 |
| 959 | Ga0373934_0000376 | 3300035086 | Bacteria | 15611 |
| 960 | Ga0373934_0047781 | 3300035086 | Bacteria | 1693 |
| 961 | Ga0373934_0105131 | 3300035086 | Bacteria | 1143 |
| 962 | Ga0373940_0111804 | 3300035088 | Bacteria | 839 |
| 963 | Ga0373949_0047917 | 3300035090 | Bacteria | 1069 |
| 964 | Ga0373932_0100219 | 3300035112 | Bacteria | 941 |
| 965 | Ga0373941_0430996 | 3300035115 | Unclassified | 550 |
| 966 | Ga0373953_0008851 | 3300035117 | Bacteria | 3436 |
| 967 | Ga0373953_0037484 | 3300035117 | Unclassified | 1914 |
| 968 | Ga0373953_0092149 | 3300035117 | Bacteria | 1268 |
| 969 | Ga0373953_0287218 | 3300035117 | Bacteria | 717 |
| 970 | Ga0373954_0000350 | 3300035118 | Bacteria | 16985 |
| 971 | Ga0373954_0000935 | 3300035118 | Bacteria | 11356 |
| 972 | Ga0373954_0001398 | 3300035118 | Bacteria | 9777 |
| 973 | Ga0373954_0006742 | 3300035118 | Bacteria | 5010 |
| 974 | Ga0373954_0352894 | 3300035118 | Unclassified | 726 |
| 975 | Ga0373956_0162962 | 3300035119 | Bacteria | 1051 |
| 976 | Ga0373956_0180697 | 3300035119 | Unclassified | 997 |
| 977 | Ga0373956_0635659 | 3300035119 | Unclassified | 509 |
| 978 | Ga0373957_0001881 | 3300035120 | Bacteria | 5828 |
| 979 | Ga0373960_0115180 | 3300035121 | Bacteria | 886 |
| 980 | Ga0373955_0043575 | 3300035172 | Bacteria | 2414 |
| 981 | Ga0373961_0011244 | 3300035241 | Bacteria | 2219 |
| 982 | Ga0373961_0387892 | 3300035241 | Unclassified | 534 |
| 983 | Ga0373931_0509328 | 3300035691 | Unclassified | 777 |
| 984 | Ga0373931_0686574 | 3300035691 | Unclassified | 675 |
| 985 | Ga0373935_0091475 | 3300035692 | Bacteria | 1993 |
| 986 | Ga0373927_0105607 | 3300035695 | Unclassified | 1834 |
| 987 | Ga0373927_0464574 | 3300035695 | Unclassified | 836 |
| 988 | Ga0373933_0014824 | 3300035724 | Bacteria | 4337 |
| 989 | Ga0373933_0015115 | 3300035724 | Bacteria | 4303 |
| 990 | Ga0373933_0234548 | 3300035724 | Bacteria | 1179 |
| 991 | Ga0373933_0497722 | 3300035724 | Bacteria | 798 |
| 992 | Ga0373933_0594695 | 3300035724 | Unclassified | 726 |
| 993 | Ga0373933_0894118 | 3300035724 | Bacteria | 585 |
| 994 | Ga0373947_0646041 | 3300035725 | Unclassified | 721 |
| 995 | Ga0373937_0002174 | 3300036401 | Bacteria | 16408 |
| 996 | Ga0373937_0005074 | 3300036401 | Bacteria | 11209 |
| 997 | Ga0373937_0005118 | 3300036401 | Bacteria | 11172 |
| 998 | Ga0373937_0007547 | 3300036401 | Bacteria | 9420 |
| 999 | Ga0373937_0011117 | 3300036401 | Bacteria | 7889 |
| 1000 | Ga0373937_0031595 | 3300036401 | Unclassified | 4799 |
| 1001 | Ga0373937_0244870 | 3300036401 | Bacteria | 1690 |
| 1002 | Ga0373937_0354287 | 3300036401 | Bacteria | 1390 |
| 1003 | Ga0373937_0572310 | 3300036401 | Unclassified | 1073 |
| 1004 | Ga0373937_1134027 | 3300036401 | Bacteria | 731 |
| 1005 | Ga0373925_0086373 | 3300037068 | Bacteria | 2393 |
| 1006 | Ga0373925_0110419 | 3300037068 | Bacteria | 2124 |
| 1007 | Ga0373925_0394537 | 3300037068 | Bacteria | 1128 |
| 1008 | Ga0373925_0574429 | 3300037068 | Unclassified | 928 |
| 1009 | Ga0373925_1048003 | 3300037068 | Unclassified | 671 |
| 1010 | Ga0436364_1138878 | 3300037853 | Bacteria | 1942 |
| 1011 | Ga0436363_0546662 | 3300039450 | Unclassified | 658 |
| 1012 | Ga0436363_0635755 | 3300039450 | Unclassified | 580 |
| 1013 | Ga0436362_0188994 | 3300039453 | Unclassified | 530 |
| 1014 | Ga0439464_0069982 | 3300042439 | Bacteria | 1037 |
| 1015 | Ga0451577_0773381 | 3300042876 | Unclassified | 868 |
| 1016 | Ga0453683_0851988 | 3300044673 | Unclassified | 601 |
| 1017 | Ga0451576_0031110 | 3300045051 | Bacteria | 5693 |
| 1018 | Ga0451576_0086745 | 3300045051 | Bacteria | 3255 |
| 1019 | Ga0451576_0107691 | 3300045051 | Bacteria | 2900 |
| 1020 | Ga0451576_0712302 | 3300045051 | Bacteria | 1054 |
| 1021 | Ga0451576_0801062 | 3300045051 | Unclassified | 989 |
| 1022 | Ga0495592_0122741 | 3300046454 | Unclassified | 1825 |
| 1023 | Ga0495641_0356437 | 3300046461 | Bacteria | 662 |
| 1024 | Ga0495651_0385634 | 3300046462 | Unclassified | 918 |
| 1025 | Ga0495651_0548110 | 3300046462 | Unclassified | 735 |
| 1026 | Ga0495580_0033712 | 3300046472 | Unclassified | 3688 |
| 1027 | Ga0495580_0043694 | 3300046472 | Bacteria | 3189 |
| 1028 | Ga0495580_0646323 | 3300046472 | Unclassified | 696 |
| 1029 | Ga0495582_0201285 | 3300046473 | Unclassified | 1137 |
| 1030 | Ga0495608_0145613 | 3300046511 | Bacteria | 1511 |
| 1031 | Ga0495628_0955427 | 3300046516 | Bacteria | 592 |
| 1032 | Ga0495630_0547161 | 3300046517 | Bacteria | 888 |
| 1033 | Ga0495630_1500837 | 3300046517 | Bacteria | 506 |
| 1034 | Ga0495644_0215317 | 3300046523 | Bacteria | 742 |
| 1035 | Ga0495642_0355345 | 3300046528 | Unclassified | 644 |
| 1036 | Ga0495652_0006912 | 3300046529 | Bacteria | 10501 |
| 1037 | Ga0495665_0097187 | 3300046531 | Bacteria | 1546 |
| 1038 | Ga0495665_0184212 | 3300046531 | Unclassified | 1084 |
| 1039 | Ga0495640_0479591 | 3300046533 | Bacteria | 758 |
| 1040 | Ga0495586_0161832 | 3300046535 | Unclassified | 1262 |
| 1041 | Ga0495586_0214424 | 3300046535 | Bacteria | 1093 |
| 1042 | Ga0495587_0142205 | 3300046536 | Bacteria | 1369 |
| 1043 | Ga0495587_0298598 | 3300046536 | Bacteria | 901 |
| 1044 | Ga0495587_0507361 | 3300046536 | Unclassified | 667 |
| 1045 | Ga0495598_0032282 | 3300046537 | Bacteria | 1479 |
| 1046 | Ga0495597_0199490 | 3300046542 | Unclassified | 802 |
| 1047 | Ga0495645_0021213 | 3300046543 | Unclassified | 4695 |
| 1048 | Ga0495667_0038465 | 3300046559 | Unclassified | 3185 |
| 1049 | Ga0495656_0108088 | 3300046615 | Bacteria | 1297 |
| 1050 | Ga0495656_0326512 | 3300046615 | Bacteria | 791 |
| 1051 | Ga0495634_0123994 | 3300046642 | Unclassified | 1652 |
| 1052 | Ga0495634_0249624 | 3300046642 | Bacteria | 1086 |
| 1053 | Ga0495659_0037097 | 3300046664 | Bacteria | 1725 |
| 1054 | Ga0495588_0162062 | 3300046674 | Bacteria | 1183 |
| 1055 | Ga0495599_0001991 | 3300046678 | Bacteria | 11814 |
| 1056 | Ga0495623_0186866 | 3300046679 | Bacteria | 1200 |
| 1057 | Ga0495658_0020114 | 3300046683 | Bacteria | 3497 |
| 1058 | Ga0495613_0027552 | 3300046689 | Bacteria | 4229 |
| 1059 | Ga0495613_0296911 | 3300046689 | Unclassified | 1119 |
| 1060 | Ga0495600_0298326 | 3300046809 | Unclassified | 1017 |
| 1061 | Ga0495604_0112088 | 3300047317 | Bacteria | 1988 |
| 1062 | Ga0495636_0017086 | 3300047318 | Bacteria | 2903 |
| 1063 | Ga0495674_0579368 | 3300047319 | Bacteria | 891 |
| 1064 | Ga0495680_0126597 | 3300047322 | Bacteria | 1881 |
| 1065 | Ga0495680_0193981 | 3300047322 | Bacteria | 1460 |
| 1066 | Ga0495680_0207404 | 3300047322 | Bacteria | 1404 |
| 1067 | Ga0495680_0518060 | 3300047322 | Unclassified | 807 |
| 1068 | Ga0495675_0038181 | 3300047444 | Bacteria | 3058 |
| 1069 | Ga0495675_0503833 | 3300047444 | Unclassified | 695 |
| 1070 | Ga0495684_0006087 | 3300047471 | Bacteria | 9383 |
| 1071 | Ga0495684_0017963 | 3300047471 | Bacteria | 5449 |
| 1072 | Ga0495684_0020127 | 3300047471 | Bacteria | 5138 |
| 1073 | Ga0495684_0211261 | 3300047471 | Bacteria | 1427 |
| 1074 | Ga0495602_0453031 | 3300048088 | Unclassified | 905 |
| 1075 | Ga0496100_0017245 | 3300048903 | Bacteria | 4259 |
| 1076 | Ga0496101_0006359 | 3300048904 | Bacteria | 7605 |
| 1077 | Ga0496102_0109248 | 3300048905 | Bacteria | 2577 |
| 1078 | Ga0496104_0139245 | 3300048907 | Bacteria | 2332 |
| 1079 | Ga0496104_0342995 | 3300048907 | Unclassified | 1407 |
| 1080 | Ga0496104_0727354 | 3300048907 | Unclassified | 900 |
| 1081 | Ga0496106_0035342 | 3300048909 | Bacteria | 3737 |
| 1082 | Ga0496106_1043358 | 3300048909 | Unclassified | 642 |
| 1083 | Ga0496106_1469377 | 3300048909 | Unclassified | 525 |
| 1084 | Ga0496112_0223205 | 3300048915 | Bacteria | 1840 |
| 1085 | Ga0496112_1371074 | 3300048915 | Unclassified | 622 |
| 1086 | Ga0496114_0002532 | 3300048917 | Bacteria | 13959 |
| 1087 | Ga0496114_0539275 | 3300048917 | Unclassified | 1031 |
| 1088 | Ga0496115_0387577 | 3300048918 | Bacteria | 1135 |
| 1089 | Ga0501033_0625600 | 3300049570 | Unclassified | 737 |
| 1090 | Ga0501036_0016212 | 3300049572 | Bacteria | 6223 |
| 1091 | Ga0501038_0736700 | 3300049574 | Unclassified | 736 |
| 1092 | Ga0501039_0289807 | 3300049575 | Bacteria | 1287 |
| 1093 | Ga0501040_0044231 | 3300049576 | Bacteria | 3036 |
| 1094 | Ga0501041_0016496 | 3300049577 | Bacteria | 4391 |
| 1095 | Ga0501041_0200472 | 3300049577 | Bacteria | 1251 |
| 1096 | Ga0501042_0410391 | 3300049578 | Unclassified | 981 |
| 1097 | Ga0501046_0016197 | 3300049580 | Bacteria | 6249 |
| 1098 | Ga0501068_0353240 | 3300049584 | Unclassified | 945 |
| 1099 | Ga0501072_1024170 | 3300049588 | Bacteria | 643 |
| 1100 | Ga0501075_0549821 | 3300049591 | Unclassified | 881 |
| 1101 | Ga0501076_0014376 | 3300049592 | Bacteria | 5962 |
| 1102 | Ga0501079_0003042 | 3300049741 | Bacteria | 12278 |
| 1103 | Ga0501081_0154815 | 3300049743 | Bacteria | 1648 |
| 1104 | Ga0501045_0761787 | 3300049824 | Unclassified | 713 |
| 1105 | nmdc:mga05p37_245414_c1 | 3300050507 | Bacteria | 2150 |
| 1106 | nmdc:mga05p37_36011_c1 | 3300050507 | Bacteria | 6072 |
| 1107 | nmdc:mga05p37_3678_c1 | 3300050507 | Bacteria | 17931 |
| 1108 | nmdc:mga05p37_4305_c1 | 3300050507 | Bacteria | 16620 |
| 1109 | nmdc:mga05p37_54320_c1 | 3300050507 | Bacteria | 1797 |
| 1110 | nmdc:mga05p37_69413_c1 | 3300050507 | Bacteria | 4335 |
| 1111 | nmdc:mga05p37_777690_c1 | 3300050507 | Unclassified | 1051 |
| 1112 | nmdc:mga09592_107377_c1 | 3300050508 | Unclassified | 2394 |
| 1113 | nmdc:mga09592_119986_c1 | 3300050508 | Bacteria | 2258 |
| 1114 | nmdc:mga09592_15185_c1 | 3300050508 | Bacteria | 6293 |
| 1115 | nmdc:mga0qj67_1031_c1 | 3300050509 | Bacteria | 19266 |
| 1116 | nmdc:mga0qj67_889323_c1 | 3300050509 | Unclassified | 702 |
| 1117 | nmdc:mga06r32_92505_c1 | 3300050510 | Unclassified | 2957 |
| 1118 | nmdc:mga06r32_9715_c1 | 3300050510 | Bacteria | 8691 |
| 1119 | nmdc:mga08y16_109136_c1 | 3300050511 | Unclassified | 2881 |
| 1120 | nmdc:mga08y16_1160642_c1 | 3300050511 | Bacteria | 745 |
| 1121 | nmdc:mga08y16_12324_c1 | 3300050511 | Bacteria | 8991 |
| 1122 | nmdc:mga08y16_31440_c1 | 3300050511 | Bacteria | 5583 |
| 1123 | nmdc:mga08y16_561780_c1 | 3300050511 | Bacteria | 1154 |
| 1124 | nmdc:mga08y16_784347_c1 | 3300050511 | Bacteria | 947 |
| 1125 | nmdc:mga0n895_1034525_c1 | 3300050512 | Bacteria | 801 |
| 1126 | nmdc:mga0n895_1118260_c1 | 3300050512 | Unclassified | 765 |
| 1127 | nmdc:mga0n895_5526_c1 | 3300050512 | Bacteria | 10582 |
| 1128 | nmdc:mga0n895_590198_c1 | 3300050512 | Unclassified | 1114 |
| 1129 | nmdc:mga0n895_61306_c1 | 3300050512 | Unclassified | 3713 |
| 1130 | nmdc:mga0n895_69297_c1 | 3300050512 | Bacteria | 3494 |
| 1131 | nmdc:mga0n895_7683_c1 | 3300050512 | Bacteria | 9275 |
| 1132 | nmdc:mga0n895_963186_c1 | 3300050512 | Unclassified | 836 |
| 1133 | nmdc:mga0rr50_181033_c1 | 3300050513 | Bacteria | 1723 |
| 1134 | nmdc:mga0rr50_243166_c1 | 3300050513 | Bacteria | 1492 |
| 1135 | nmdc:mga0rr50_361212_c1 | 3300050513 | Bacteria | 1222 |
| 1136 | nmdc:mga0rr50_63211_c1 | 3300050513 | Unclassified | 2795 |
| 1137 | nmdc:mga0rr50_79805_c1 | 3300050513 | Bacteria | 2521 |
| 1138 | nmdc:mga08x19_1166421_c1 | 3300050514 | Unclassified | 546 |
| 1139 | nmdc:mga08x19_69351_c1 | 3300050514 | Unclassified | 2296 |
| 1140 | nmdc:mga0a205_131939_c1 | 3300050515 | Unclassified | 2399 |
| 1141 | nmdc:mga0a205_1627_c1 | 3300050515 | Bacteria | 19317 |
| 1142 | nmdc:mga0a205_190191_c1 | 3300050515 | Bacteria | 1945 |
| 1143 | nmdc:mga0a205_537800_c1 | 3300050515 | Bacteria | 1024 |
| 1144 | nmdc:mga0a205_58889_c1 | 3300050515 | Bacteria | 3710 |
| 1145 | nmdc:mga0a205_806302_c1 | 3300050515 | Unclassified | 787 |
| 1146 | Ga0495601_0127376 | 3300053077 | Unclassified | 1657 |
| 1147 | Ga0495595_0750858 | 3300053084 | Unclassified | 501 |
| 1148 | Ga0495619_0170709 | 3300053085 | Unclassified | 1504 |
| 1149 | Ga0501084_0006540 | 3300054114 | Bacteria | 9578 |
| 1150 | Ga0501082_0017413 | 3300060353 | Bacteria | 6190 |
| 1151 | Ga0530510_0062594 | 3300061734 | Bacteria | 2693 |
| 1152 | Ga0105245_10076513 | |||
| 1153 | JGI24750J21931_1070484 | |||
| 1154 | JGI24742J22300_10128337 | |||
| 1155 | Ga0065714_10320666 | |||
| 1156 | Ga0065712_10004025 | |||
| 1157 | Ga0065712_10158284 | |||
| 1158 | Ga0065715_10000766 | |||
| 1159 | Ga0065715_10057764 | |||
| 1160 | Ga0065707_10004492 | |||
| 1161 | Ga0065707_10023923 | |||
| 1162 | Ga0065707_10118664 | |||
| 1163 | Ga0070676_10002130 | |||
| 1164 | Ga0070676_10048093 | |||
| 1165 | Ga0070676_10414367 | |||
| 1166 | Ga0070676_11024512 | |||
| 1167 | Ga0070683_100077941 | |||
| 1168 | Ga0070683_100146928 | |||
| 1169 | Ga0070683_100779229 | |||
| 1170 | Ga0070683_101106159 | |||
| 1171 | Ga0070690_100035456 | |||
| 1172 | Ga0070690_100067424 | |||
| 1173 | Ga0070690_100094602 | |||
| 1174 | Ga0070690_100584678 | |||
| 1175 | Ga0070690_100643323 | |||
| 1176 | Ga0070690_100667856 | |||
| 1177 | Ga0070690_101470421 | |||
| 1178 | Ga0070670_100001376 | |||
| 1179 | Ga0070670_100004397 | |||
| 1180 | Ga0070670_100019553 | |||
| 1181 | Ga0070670_101534914 | |||
| 1182 | Ga0070677_10002121 | |||
| 1183 | Ga0070677_10004228 | |||
| 1184 | Ga0070677_10010228 | |||
| 1185 | Ga0068869_100006944 | |||
| 1186 | Ga0068869_100008081 | |||
| 1187 | Ga0068869_100021377 | |||
| 1188 | Ga0068869_100075528 | |||
| 1189 | Ga0068869_100144020 | |||
| 1190 | Ga0068869_100485186 | |||
| 1191 | Ga0070666_10004014 | |||
| 1192 | Ga0070666_10097527 | |||
| 1193 | Ga0070666_10173254 | |||
| 1194 | Ga0070666_10320909 | |||
| 1195 | Ga0070666_10460392 | |||
| 1196 | Ga0070680_100727533 | |||
| 1197 | Ga0070682_100482790 | |||
| 1198 | Ga0070682_100945636 | |||
| 1199 | Ga0068868_100028746 | |||
| 1200 | Ga0068868_100089529 | |||
| 1201 | Ga0068868_101140055 | |||
| 1202 | Ga0070660_100028114 | |||
| 1203 | Ga0070660_100631980 | |||
| 1204 | Ga0070689_100009058 | |||
| 1205 | Ga0070689_100013527 | |||
| 1206 | Ga0070689_100030022 | |||
| 1207 | Ga0070689_100133112 | |||
| 1208 | Ga0070689_101185293 | |||
| 1209 | Ga0070689_101241118 | |||
| 1210 | Ga0070689_101975288 | |||
| 1211 | Ga0070691_10004994 | |||
| 1212 | Ga0070691_11078052 | |||
| 1213 | Ga0070687_100004620 | |||
| 1214 | Ga0070687_100009945 | |||
| 1215 | Ga0070687_100024088 | |||
| 1216 | Ga0070661_100009957 | |||
| 1217 | Ga0070661_100102423 | |||
| 1218 | Ga0070661_100670914 | |||
| 1219 | Ga0070692_10078733 | |||
| 1220 | Ga0070692_10323632 | |||
| 1221 | Ga0070692_11079316 | |||
| 1222 | Ga0070668_100045307 | |||
| 1223 | Ga0070668_100070669 | |||
| 1224 | Ga0070668_101061616 | |||
| 1225 | Ga0070668_101176370 | |||
| 1226 | Ga0070669_100012416 | |||
| 1227 | Ga0070669_100060674 | |||
| 1228 | Ga0070669_100411049 | |||
| 1229 | Ga0070669_100467023 | |||
| 1230 | Ga0070669_101138583 | |||
| 1231 | Ga0070669_101173617 | |||
| 1232 | Ga0070675_100001521 | |||
| 1233 | Ga0070675_100003288 | |||
| 1234 | Ga0070675_100023946 | |||
| 1235 | Ga0070675_100113344 | |||
| 1236 | Ga0070675_100127903 | |||
| 1237 | Ga0070675_100182487 | |||
| 1238 | Ga0070675_100952594 | |||
| 1239 | Ga0070671_100006397 | |||
| 1240 | Ga0070671_100041594 | |||
| 1241 | Ga0070671_100065471 | |||
| 1242 | Ga0070671_100224783 | |||
| 1243 | Ga0070671_101723623 | |||
| 1244 | Ga0070674_100001992 | |||
| 1245 | Ga0070674_100156985 | |||
| 1246 | Ga0070674_100518021 | |||
| 1247 | Ga0070674_100831246 | |||
| 1248 | Ga0070673_100013101 | |||
| 1249 | Ga0070673_100043845 | |||
| 1250 | Ga0070673_100135883 | |||
| 1251 | Ga0070673_100207522 | |||
| 1252 | Ga0070673_100362668 | |||
| 1253 | Ga0070673_100373248 | |||
| 1254 | Ga0070673_100495249 | |||
| 1255 | Ga0070673_100552490 | |||
| 1256 | Ga0070688_100004251 | |||
| 1257 | Ga0070688_100020983 | |||
| 1258 | Ga0070688_100030277 | |||
| 1259 | Ga0070688_100088699 | |||
| 1260 | Ga0070688_100509177 | |||
| 1261 | Ga0070688_101659293 | |||
| 1262 | Ga0070659_100070829 | |||
| 1263 | Ga0070659_100258750 | |||
| 1264 | Ga0070659_100297110 | |||
| 1265 | Ga0070659_100471592 | |||
| 1266 | Ga0070667_100021283 | |||
| 1267 | Ga0070667_100620397 | |||
| 1268 | Ga0070703_10264793 | |||
| 1269 | Ga0070709_10191112 | |||
| 1270 | Ga0070713_100190238 | |||
| 1271 | Ga0070713_100231938 | |||
| 1272 | Ga0070710_10529894 | |||
| 1273 | Ga0070710_10798294 | |||
| 1274 | Ga0070701_10050245 | |||
| 1275 | Ga0070701_10054352 | |||
| 1276 | Ga0070701_10135373 | |||
| 1277 | Ga0070701_10594376 | |||
| 1278 | Ga0070701_10989098 | |||
| 1279 | Ga0070711_100078558 | |||
| 1280 | Ga0070711_100766664 | |||
| 1281 | Ga0070705_100000409 | |||
| 1282 | Ga0070705_100006513 | |||
| 1283 | Ga0070705_100065077 | |||
| 1284 | Ga0070705_100071149 | |||
| 1285 | Ga0070705_101076117 | |||
| 1286 | Ga0070705_101131408 | |||
| 1287 | Ga0070700_100008474 | |||
| 1288 | Ga0070700_100053330 | |||
| 1289 | Ga0070694_100015841 | |||
| 1290 | Ga0070694_100027628 | |||
| 1291 | Ga0070694_100046602 | |||
| 1292 | Ga0070694_100111506 | |||
| 1293 | Ga0070694_100485903 | |||
| 1294 | Ga0070694_100505429 | |||
| 1295 | Ga0070708_100280275 | |||
| 1296 | Ga0070708_100315854 | |||
| 1297 | Ga0070708_100555176 | |||
| 1298 | Ga0070708_101072349 | |||
| 1299 | Ga0070663_100698133 | |||
| 1300 | Ga0070678_100086413 | |||
| 1301 | Ga0070678_100108054 | |||
| 1302 | Ga0070678_100237148 | |||
| 1303 | Ga0070678_100981241 | |||
| 1304 | Ga0070678_101503576 | |||
| 1305 | Ga0070662_100025944 | |||
| 1306 | Ga0070662_100028891 | |||
| 1307 | Ga0070662_100041285 | |||
| 1308 | Ga0070662_100044446 | |||
| 1309 | Ga0070662_100438280 | |||
| 1310 | Ga0070662_101362747 | |||
| 1311 | Ga0070681_10044836 | |||
| 1312 | Ga0070681_10189217 | |||
| 1313 | Ga0070681_10315014 | |||
| 1314 | Ga0070681_10350788 | |||
| 1315 | Ga0070681_11272787 | |||
| 1316 | Ga0068867_100009440 | |||
| 1317 | Ga0068867_100013742 | |||
| 1318 | Ga0068867_100019384 | |||
| 1319 | Ga0068867_100097892 | |||
| 1320 | Ga0068867_100213309 | |||
| 1321 | Ga0068867_100228021 | |||
| 1322 | Ga0068867_100275791 | |||
| 1323 | Ga0068867_100306445 | |||
| 1324 | Ga0068867_100609693 | |||
| 1325 | Ga0068867_100632200 | |||
| 1326 | Ga0068867_100711690 | |||
| 1327 | Ga0068867_100903960 | |||
| 1328 | Ga0068867_100935571 | |||
| 1329 | Ga0068867_102265460 | |||
| 1330 | Ga0070685_10004167 | |||
| 1331 | Ga0070685_10130794 | |||
| 1332 | Ga0070706_100810115 | |||
| 1333 | Ga0070706_100856739 | |||
| 1334 | Ga0070706_101465729 | |||
| 1335 | Ga0070707_100124549 | |||
| 1336 | Ga0070707_100309931 | |||
| 1337 | Ga0070707_100356008 | |||
| 1338 | Ga0070707_100570644 | |||
| 1339 | Ga0070707_100584661 | |||
| 1340 | Ga0070698_100008437 | |||
| 1341 | Ga0070698_100050520 | |||
| 1342 | Ga0070698_100060971 | |||
| 1343 | Ga0070698_100789690 | |||
| 1344 | Ga0070698_101813752 | |||
| 1345 | Ga0070698_102153942 | |||
| 1346 | Ga0070699_100005570 | |||
| 1347 | Ga0070699_100006887 | |||
| 1348 | Ga0070699_100021255 | |||
| 1349 | Ga0070699_100111782 | |||
| 1350 | Ga0070699_100547452 | |||
| 1351 | Ga0070699_100823973 | |||
| 1352 | Ga0070679_100000937 | |||
| 1353 | Ga0070679_100591614 | |||
| 1354 | Ga0070679_100628067 | |||
| 1355 | Ga0070684_100000220 | |||
| 1356 | Ga0070684_100033979 | |||
| 1357 | Ga0070684_100058609 | |||
| 1358 | Ga0070684_100079422 | |||
| 1359 | Ga0070684_100272009 | |||
| 1360 | Ga0070684_100277320 | |||
| 1361 | Ga0070684_100395913 | |||
| 1362 | Ga0070684_100523744 | |||
| 1363 | Ga0070697_100038660 | |||
| 1364 | Ga0070697_101047296 | |||
| 1365 | Ga0068853_100009310 | |||
| 1366 | Ga0068853_100315548 | |||
| 1367 | Ga0068853_100572665 | |||
| 1368 | Ga0070672_100013202 | |||
| 1369 | Ga0070672_100024022 | |||
| 1370 | Ga0070672_100038806 | |||
| 1371 | Ga0070672_100216377 | |||
| 1372 | Ga0070672_100285181 | |||
| 1373 | Ga0070672_100415658 | |||
| 1374 | Ga0070672_100479835 | |||
| 1375 | Ga0070686_100008216 | |||
| 1376 | Ga0070686_100039392 | |||
| 1377 | Ga0070686_100354280 | |||
| 1378 | Ga0070686_101247657 | |||
| 1379 | Ga0070695_100000063 | |||
| 1380 | Ga0070695_100471741 | |||
| 1381 | Ga0070695_101309635 | |||
| 1382 | Ga0070696_100000064 | |||
| 1383 | Ga0070696_100006244 | |||
| 1384 | Ga0070696_100022663 | |||
| 1385 | Ga0070696_100026342 | |||
| 1386 | Ga0070696_100565622 | |||
| 1387 | Ga0070693_101331948 | |||
| 1388 | Ga0070665_100009896 | |||
| 1389 | Ga0070665_100262390 | |||
| 1390 | Ga0070704_100010532 | |||
| 1391 | Ga0070704_100039327 | |||
| 1392 | Ga0070704_100058306 | |||
| 1393 | Ga0070704_100100992 | |||
| 1394 | Ga0070704_100266263 | |||
| 1395 | Ga0070704_100462718 | |||
| 1396 | Ga0070704_101864830 | |||
| 1397 | Ga0068855_100008856 | |||
| 1398 | Ga0068855_100084626 | |||
| 1399 | Ga0068855_100121694 | |||
| 1400 | Ga0068855_100623617 | |||
| 1401 | Ga0070664_100005747 | |||
| 1402 | Ga0070664_100147595 | |||
| 1403 | Ga0070664_100394524 | |||
| 1404 | Ga0070664_100543121 | |||
| 1405 | Ga0068857_100009482 | |||
| 1406 | Ga0068857_100025305 | |||
| 1407 | Ga0068857_100027803 | |||
| 1408 | Ga0068857_100047994 | |||
| 1409 | Ga0068857_100072561 | |||
| 1410 | Ga0068857_100196133 | |||
| 1411 | Ga0068857_100945624 | |||
| 1412 | Ga0068854_100014894 | |||
| 1413 | Ga0068854_100222872 | |||
| 1414 | Ga0068854_101815217 | |||
| 1415 | Ga0068854_101967528 | |||
| 1416 | Ga0068856_100039344 | |||
| 1417 | Ga0068856_100041958 | |||
| 1418 | Ga0068856_100146923 | |||
| 1419 | Ga0068856_100163258 | |||
| 1420 | Ga0068856_100259219 | |||
| 1421 | Ga0068856_100296875 | |||
| 1422 | Ga0068856_100396143 | |||
| 1423 | Ga0068856_100527098 | |||
| 1424 | Ga0068856_100657821 | |||
| 1425 | Ga0068856_102123550 | |||
| 1426 | Ga0070702_100002366 | |||
| 1427 | Ga0070702_100061746 | |||
| 1428 | Ga0070702_100202611 | |||
| 1429 | Ga0070702_100233231 | |||
| 1430 | Ga0068852_100020042 | |||
| 1431 | Ga0068852_100053272 | |||
| 1432 | Ga0068852_100470696 | |||
| 1433 | Ga0068852_101033047 | |||
| 1434 | Ga0068859_100008792 | |||
| 1435 | Ga0068859_100013417 | |||
| 1436 | Ga0068859_100133533 | |||
| 1437 | Ga0068859_100137164 | |||
| 1438 | Ga0068859_100403507 | |||
| 1439 | Ga0068859_100959951 | |||
| 1440 | Ga0068859_101314117 | |||
| 1441 | Ga0068859_101733187 | |||
| 1442 | Ga0068864_100029090 | |||
| 1443 | Ga0068864_100060069 | |||
| 1444 | Ga0068864_100209586 | |||
| 1445 | Ga0068864_100217175 | |||
| 1446 | Ga0068864_100885136 | |||
| 1447 | Ga0068866_10007943 | |||
| 1448 | Ga0068866_10140289 | |||
| 1449 | Ga0068866_10203369 | |||
| 1450 | Ga0068861_100000410 | |||
| 1451 | Ga0068861_100017323 | |||
| 1452 | Ga0068861_100055161 | |||
| 1453 | Ga0068861_100410199 | |||
| 1454 | Ga0068861_100819868 | |||
| 1455 | Ga0068861_101207383 | |||
| 1456 | Ga0068851_10010649 | |||
| 1457 | Ga0068851_10467994 | |||
| 1458 | Ga0068870_10000872 | |||
| 1459 | Ga0068870_10004033 | |||
| 1460 | Ga0068870_10021478 | |||
| 1461 | Ga0068870_10155288 | |||
| 1462 | Ga0068870_10214742 | |||
| 1463 | Ga0068870_10287168 | |||
| 1464 | Ga0068870_10348530 | |||
| 1465 | Ga0068870_10950660 | |||
| 1466 | Ga0068870_11038272 | |||
| 1467 | Ga0068863_100002061 | |||
| 1468 | Ga0068863_100068374 | |||
| 1469 | Ga0068863_100069788 | |||
| 1470 | Ga0068863_100089605 | |||
| 1471 | Ga0068863_101589276 | |||
| 1472 | Ga0068863_102284085 | |||
| 1473 | Ga0068858_100018687 | |||
| 1474 | Ga0068858_100058040 | |||
| 1475 | Ga0068858_100122236 | |||
| 1476 | Ga0068858_100308191 | |||
| 1477 | Ga0068858_101290364 | |||
| 1478 | Ga0068858_101342782 | |||
| 1479 | Ga0068860_100002194 | |||
| 1480 | Ga0068860_100023907 | |||
| 1481 | Ga0068860_100028328 | |||
| 1482 | Ga0068860_100070347 | |||
| 1483 | Ga0068860_100303771 | |||
| 1484 | Ga0068860_100423539 | |||
| 1485 | Ga0068860_100456534 | |||
| 1486 | Ga0068860_100511543 | |||
| 1487 | Ga0068860_100873152 | |||
| 1488 | Ga0068860_100990675 | |||
| 1489 | Ga0068860_101052916 | |||
| 1490 | Ga0068860_101343123 | |||
| 1491 | Ga0068860_101929773 | |||
| 1492 | Ga0068862_100003220 | |||
| 1493 | Ga0068862_100569162 | |||
| 1494 | Ga0068862_101685687 | |||
| 1495 | Ga0081455_10116340 | |||
| 1496 | Ga0081455_10489905 | |||
| 1497 | Ga0070717_10923740 | |||
| 1498 | Ga0097621_100029485 | |||
| 1499 | Ga0097621_100039382 | |||
| 1500 | Ga0097621_100039987 | |||
| 1501 | Ga0097621_100048756 | |||
| 1502 | Ga0097621_100080595 | |||
| 1503 | Ga0097621_100123936 | |||
| 1504 | Ga0097621_100130234 | |||
| 1505 | Ga0097621_100157845 | |||
| 1506 | Ga0097621_100537675 | |||
| 1507 | Ga0097621_100653481 | |||
| 1508 | Ga0097621_101375952 | |||
| 1509 | Ga0068871_100013498 | |||
| 1510 | Ga0068871_100019371 | |||
| 1511 | Ga0068871_100020714 | |||
| 1512 | Ga0068871_100024112 | |||
| 1513 | Ga0068871_100053946 | |||
| 1514 | Ga0068871_100079486 | |||
| 1515 | Ga0068871_100117842 | |||
| 1516 | Ga0068871_100162161 | |||
| 1517 | Ga0068871_100588501 | |||
| 1518 | Ga0068871_100621333 | |||
| 1519 | Ga0068871_100709966 | |||
| 1520 | Ga0068871_100738288 | |||
| 1521 | Ga0075428_100033591 | |||
| 1522 | Ga0075428_100037354 | |||
| 1523 | Ga0075428_100085873 | |||
| 1524 | Ga0075428_100120531 | |||
| 1525 | Ga0075428_100133559 | |||
| 1526 | Ga0075428_100172891 | |||
| 1527 | Ga0075428_100217301 | |||
| 1528 | Ga0075428_101246106 | |||
| 1529 | Ga0075428_101567422 | |||
| 1530 | Ga0075430_100003769 | |||
| 1531 | Ga0075430_100089728 | |||
| 1532 | Ga0075431_100018585 | |||
| 1533 | Ga0075431_100129847 | |||
| 1534 | Ga0075431_101159055 | |||
| 1535 | Ga0075433_10002662 | |||
| 1536 | Ga0075433_10120708 | |||
| 1537 | Ga0075433_10158456 | |||
| 1538 | Ga0075433_10330313 | |||
| 1539 | Ga0075433_10590156 | |||
| 1540 | Ga0075433_10696772 | |||
| 1541 | Ga0075434_100047389 | |||
| 1542 | Ga0075434_100085384 | |||
| 1543 | Ga0075434_100096545 | |||
| 1544 | Ga0075434_100119420 | |||
| 1545 | Ga0075434_100140198 | |||
| 1546 | Ga0075434_100165630 | |||
| 1547 | Ga0075434_100233006 | |||
| 1548 | Ga0075434_100306602 | |||
| 1549 | Ga0075434_100328658 | |||
| 1550 | Ga0075434_100425718 | |||
| 1551 | Ga0075434_100685161 | |||
| 1552 | Ga0075434_101152270 | |||
| 1553 | Ga0075434_102470681 | |||
| 1554 | Ga0075429_100049770 | |||
| 1555 | Ga0075429_100117268 | |||
| 1556 | Ga0075429_100194529 | |||
| 1557 | Ga0075429_100339637 | |||
| 1558 | Ga0075429_100476534 | |||
| 1559 | Ga0068865_100010239 | |||
| 1560 | Ga0068865_100013640 | |||
| 1561 | Ga0068865_100114681 | |||
| 1562 | Ga0068865_100133264 | |||
| 1563 | Ga0068865_100211295 | |||
| 1564 | Ga0068865_100219518 | |||
| 1565 | Ga0068865_100417728 | |||
| 1566 | Ga0068865_100594296 | |||
| 1567 | Ga0075436_100663870 | |||
| 1568 | Ga0075436_100847908 | |||
| 1569 | Ga0097620_100008792 | |||
| 1570 | Ga0097620_100013417 | |||
| 1571 | Ga0097620_100133539 | |||
| 1572 | Ga0097620_100137166 | |||
| 1573 | Ga0097620_100403527 | |||
| 1574 | Ga0097620_100959881 | |||
| 1575 | Ga0097620_101314188 | |||
| 1576 | Ga0097620_101733172 | |||
| 1577 | Ga0075435_100022668 | |||
| 1578 | Ga0075435_100040029 | |||
| 1579 | Ga0075435_100113926 | |||
| 1580 | Ga0075435_100149793 | |||
| 1581 | Ga0075435_100304615 | |||
| 1582 | Ga0075435_100304728 | |||
| 1583 | Ga0075435_100351842 | |||
| 1584 | Ga0075435_100595014 | |||
| 1585 | Ga0075435_100948791 | |||
| 1586 | Ga0075435_100968742 | |||
| 1587 | Ga0099794_10039852 | |||
| 1588 | Ga0105240_10003663 | |||
| 1589 | Ga0105240_10020135 | |||
| 1590 | Ga0105240_10064169 | |||
| 1591 | Ga0105240_10166412 | |||
| 1592 | Ga0105240_10227599 | |||
| 1593 | Ga0105240_11440380 | |||
| 1594 | Ga0111539_10016172 | |||
| 1595 | Ga0111539_10044634 | |||
| 1596 | Ga0111539_10070479 | |||
| 1597 | Ga0111539_10175430 | |||
| 1598 | Ga0111539_10251201 | |||
| 1599 | Ga0111539_10704830 | |||
| 1600 | Ga0111539_10730743 | |||
| 1601 | Ga0105245_10006391 | |||
| 1602 | Ga0105245_10010932 | |||
| 1603 | Ga0105245_10205035 | |||
| 1604 | Ga0105245_10223273 | |||
| 1605 | Ga0105245_10852495 | |||
| 1606 | Ga0105245_10966040 | |||
| 1607 | Ga0105245_10969270 | |||
| 1608 | Ga0105245_10997376 | |||
| 1609 | Ga0105245_11406372 | |||
| 1610 | Ga0105245_11494283 | |||
| 1611 | Ga0105245_12271001 | |||
| 1612 | Ga0105245_12293727 | |||
| 1613 | Ga0105245_12337930 | |||
| 1614 | Ga0105247_10006873 | |||
| 1615 | Ga0105247_10702164 | |||
| 1616 | Ga0114129_10002325 | |||
| 1617 | Ga0114129_10025741 | |||
| 1618 | Ga0114129_10029196 | |||
| 1619 | Ga0114129_10050075 | |||
| 1620 | Ga0114129_10069233 | |||
| 1621 | Ga0114129_10478082 | |||
| 1622 | Ga0114129_10507032 | |||
| 1623 | Ga0114129_10593386 | |||
| 1624 | Ga0114129_10772522 | |||
| 1625 | Ga0114129_11128970 | |||
| 1626 | Ga0105243_10013693 | |||
| 1627 | Ga0105243_10014817 | |||
| 1628 | Ga0105243_10016503 | |||
| 1629 | Ga0105243_10175564 | |||
| 1630 | Ga0105243_10181181 | |||
| 1631 | Ga0105243_10468310 | |||
| 1632 | Ga0105243_11908025 | |||
| 1633 | Ga0105241_10020683 | |||
| 1634 | Ga0105241_10024599 | |||
| 1635 | Ga0105241_10049390 | |||
| 1636 | Ga0105241_10069983 | |||
| 1637 | Ga0105241_10091837 | |||
| 1638 | Ga0105241_10193333 | |||
| 1639 | Ga0105241_10282514 | |||
| 1640 | Ga0105241_10883890 | |||
| 1641 | Ga0105242_10015811 | |||
| 1642 | Ga0105242_10020652 | |||
| 1643 | Ga0105242_10026637 | |||
| 1644 | Ga0105242_10029211 | |||
| 1645 | Ga0105242_10091744 | |||
| 1646 | Ga0105242_10106653 | |||
| 1647 | Ga0105242_10206468 | |||
| 1648 | Ga0105242_10262885 | |||
| 1649 | Ga0105242_10341942 | |||
| 1650 | Ga0105242_10468515 | |||
| 1651 | Ga0105242_11878081 | |||
| 1652 | Ga0105242_13006680 | |||
| 1653 | Ga0105248_10060955 | |||
| 1654 | Ga0105248_10106134 | |||
| 1655 | Ga0105248_10113816 | |||
| 1656 | Ga0105248_10171127 | |||
| 1657 | Ga0105248_10208234 | |||
| 1658 | Ga0105248_10257140 | |||
| 1659 | Ga0105248_10611923 | |||
| 1660 | Ga0105248_10726673 | |||
| 1661 | Ga0105248_11110556 | |||
| 1662 | Ga0105237_10006103 | |||
| 1663 | Ga0105237_10008051 | |||
| 1664 | Ga0105237_10012134 | |||
| 1665 | Ga0105237_10146161 | |||
| 1666 | Ga0105237_10266671 | |||
| 1667 | Ga0105237_10303500 | |||
| 1668 | Ga0105237_10707403 | |||
| 1669 | Ga0105237_11321534 | |||
| 1670 | Ga0105237_11656020 | |||
| 1671 | Ga0105238_10004906 | |||
| 1672 | Ga0105238_10028228 | |||
| 1673 | Ga0105238_10062533 | |||
| 1674 | Ga0105238_10067738 | |||
| 1675 | Ga0105238_10070174 | |||
| 1676 | Ga0105249_10001517 | |||
| 1677 | Ga0105249_10324208 | |||
| 1678 | Ga0105249_10623001 | |||
| 1679 | Ga0105249_11210733 | |||
| 1680 | Ga0105249_11341102 | |||
| 1681 | Ga0105249_11407032 | |||
| 1682 | Ga0105239_10008018 | |||
| 1683 | Ga0105239_10011847 | |||
| 1684 | Ga0105239_10109635 | |||
| 1685 | Ga0105239_10703520 | |||
| 1686 | Ga0105246_10006946 | |||
| 1687 | Ga0105246_10054272 | |||
| 1688 | Ga0105246_10081006 | |||
| 1689 | Ga0105246_10400069 | |||
| 1690 | Ga0105246_10901759 | |||
| 1691 | Ga0105246_11864741 | |||
| 1692 | Ga0157370_10002320 | |||
| 1693 | Ga0157370_10013256 | |||
| 1694 | Ga0157369_10000856 | |||
| 1695 | Ga0157369_10020341 | |||
| 1696 | Ga0157369_10235325 | |||
| 1697 | Ga0157369_10997637 | |||
| 1698 | Ga0157369_11027969 | |||
| 1699 | Ga0157374_10004706 | |||
| 1700 | Ga0157374_10057967 | |||
| 1701 | Ga0157374_10097378 | |||
| 1702 | Ga0157374_10141716 | |||
| 1703 | Ga0157374_10477631 | |||
| 1704 | Ga0157374_10523884 | |||
| 1705 | Ga0157374_11576381 | |||
| 1706 | Ga0157378_10004469 | |||
| 1707 | Ga0157378_10069719 | |||
| 1708 | Ga0157378_10153012 | |||
| 1709 | Ga0157378_10628827 | |||
| 1710 | Ga0157378_11063431 | |||
| 1711 | Ga0163162_10007906 | |||
| 1712 | Ga0163162_10167605 | |||
| 1713 | Ga0163162_10365959 | |||
| 1714 | Ga0163162_10763451 | |||
| 1715 | Ga0163162_10864437 | |||
| 1716 | Ga0163162_10884522 | |||
| 1717 | Ga0163162_12073710 | |||
| 1718 | Ga0157372_10020489 | |||
| 1719 | Ga0157372_10024353 | |||
| 1720 | Ga0157372_10068428 | |||
| 1721 | Ga0157372_10279702 | |||
| 1722 | Ga0157372_10309247 | |||
| 1723 | Ga0157372_10312674 | |||
| 1724 | Ga0157372_10770830 | |||
| 1725 | Ga0157372_11115339 | |||
| 1726 | Ga0157375_10006342 | |||
| 1727 | Ga0157375_10013179 | |||
| 1728 | Ga0157375_10058331 | |||
| 1729 | Ga0157375_10073966 | |||
| 1730 | Ga0157375_10101653 | |||
| 1731 | Ga0157375_10305473 | |||
| 1732 | Ga0157375_10503260 | |||
| 1733 | Ga0157375_11314982 | |||
| 1734 | Ga0157375_11487154 | |||
| 1735 | Ga0157375_11585722 | |||
| 1736 | Ga0163163_10004905 | |||
| 1737 | Ga0163163_10185940 | |||
| 1738 | Ga0163163_10198573 | |||
| 1739 | Ga0163163_10236688 | |||
| 1740 | Ga0163163_10383455 | |||
| 1741 | Ga0163163_11808929 | |||
| 1742 | Ga0163163_11812206 | |||
| 1743 | Ga0157380_10001628 | |||
| 1744 | Ga0157380_10033205 | |||
| 1745 | Ga0157380_10035075 | |||
| 1746 | Ga0157380_10040834 | |||
| 1747 | Ga0157380_10057405 | |||
| 1748 | Ga0157380_10137318 | |||
| 1749 | Ga0157380_10235205 | |||
| 1750 | Ga0157380_10372187 | |||
| 1751 | Ga0157377_10005177 | |||
| 1752 | Ga0157379_10006764 | |||
| 1753 | Ga0157379_10066570 | |||
| 1754 | Ga0157379_10093858 | |||
| 1755 | Ga0157379_10386298 | |||
| 1756 | Ga0157379_10860219 | |||
| 1757 | Ga0157379_10911158 | |||
| 1758 | Ga0157379_11382689 | |||
| 1759 | Ga0157376_10064091 | |||
| 1760 | Ga0157376_10104084 | |||
| 1761 | Ga0157376_10119831 | |||
| 1762 | Ga0157376_10182589 | |||
| 1763 | Ga0157376_10298798 | |||
| 1764 | Ga0157376_10302807 | |||
| 1765 | Ga0157376_10351170 | |||
| 1766 | Ga0157376_10547673 | |||
| 1767 | Ga0163161_10024908 | |||
| 1768 | Ga0163161_10951212 | |||
| 1769 | Ga0163161_11061894 | |||
| 1770 | Ga0206352_10276273 | |||
| 1771 | Ga0213875_10020183 | |||
| 1772 | Ga0207673_1015351 | |||
| 1773 | Ga0207697_10001790 | |||
| 1774 | Ga0207656_10044342 | |||
| 1775 | Ga0207653_10038169 | |||
| 1776 | Ga0207682_10002980 | |||
| 1777 | Ga0207682_10003881 | |||
| 1778 | Ga0207682_10035183 | |||
| 1779 | Ga0207692_10447154 | |||
| 1780 | Ga0207642_10031206 | |||
| 1781 | Ga0207642_10106625 | |||
| 1782 | Ga0207642_10259319 | |||
| 1783 | Ga0207642_10522134 | |||
| 1784 | Ga0207710_10016079 | |||
| 1785 | Ga0207688_10002313 | |||
| 1786 | Ga0207680_10283130 | |||
| 1787 | Ga0207680_10291311 | |||
| 1788 | Ga0207680_10884041 | |||
| 1789 | Ga0207647_10239478 | |||
| 1790 | Ga0207699_10308459 | |||
| 1791 | Ga0207645_10004825 | |||
| 1792 | Ga0207645_10013798 | |||
| 1793 | Ga0207645_10050497 | |||
| 1794 | Ga0207645_10094311 | |||
| 1795 | Ga0207643_10000719 | |||
| 1796 | Ga0207643_10003155 | |||
| 1797 | Ga0207643_10021602 | |||
| 1798 | Ga0207643_10036366 | |||
| 1799 | Ga0207643_10098401 | |||
| 1800 | Ga0207643_10239236 | |||
| 1801 | Ga0207643_10276967 | |||
| 1802 | Ga0207643_10775757 | |||
| 1803 | Ga0207654_10018789 | |||
| 1804 | Ga0207654_10082009 | |||
| 1805 | Ga0207654_10084206 | |||
| 1806 | Ga0207654_10142895 | |||
| 1807 | Ga0207654_10164816 | |||
| 1808 | Ga0207654_10289068 | |||
| 1809 | Ga0207654_10610968 | |||
| 1810 | Ga0207654_11151322 | |||
| 1811 | Ga0207707_10039969 | |||
| 1812 | Ga0207707_10177490 | |||
| 1813 | Ga0207707_10640197 | |||
| 1814 | Ga0207707_10868193 | |||
| 1815 | Ga0207695_10000302 | |||
| 1816 | Ga0207695_10019328 | |||
| 1817 | Ga0207695_10034902 | |||
| 1818 | Ga0207695_10129150 | |||
| 1819 | Ga0207695_10393048 | |||
| 1820 | Ga0207695_10757591 | |||
| 1821 | Ga0207695_11461321 | |||
| 1822 | Ga0207671_10006862 | |||
| 1823 | Ga0207671_10010106 | |||
| 1824 | Ga0207671_10037469 | |||
| 1825 | Ga0207671_10330361 | |||
| 1826 | Ga0207671_10434503 | |||
| 1827 | Ga0207671_10462504 | |||
| 1828 | Ga0207671_10728108 | |||
| 1829 | Ga0207671_10856694 | |||
| 1830 | Ga0207660_10061029 | |||
| 1831 | Ga0207660_10448120 | |||
| 1832 | Ga0207662_10004573 | |||
| 1833 | Ga0207662_10007357 | |||
| 1834 | Ga0207662_10051246 | |||
| 1835 | Ga0207662_10546311 | |||
| 1836 | Ga0207657_10036023 | |||
| 1837 | Ga0207657_10765974 | |||
| 1838 | Ga0207649_10219824 | |||
| 1839 | Ga0207649_10334313 | |||
| 1840 | Ga0207649_10490681 | |||
| 1841 | Ga0207649_10645621 | |||
| 1842 | Ga0207652_10141636 | |||
| 1843 | Ga0207646_10113720 | |||
| 1844 | Ga0207646_10307493 | |||
| 1845 | Ga0207646_10509236 | |||
| 1846 | Ga0207646_10761770 | |||
| 1847 | Ga0207646_10789060 | |||
| 1848 | Ga0207681_10001889 | |||
| 1849 | Ga0207681_10029885 | |||
| 1850 | Ga0207681_10041243 | |||
| 1851 | Ga0207681_10266226 | |||
| 1852 | Ga0207681_10338832 | |||
| 1853 | Ga0207694_10003179 | |||
| 1854 | Ga0207694_10006554 | |||
| 1855 | Ga0207694_10006776 | |||
| 1856 | Ga0207694_10040780 | |||
| 1857 | Ga0207694_10043525 | |||
| 1858 | Ga0207694_10049427 | |||
| 1859 | Ga0207694_10057282 | |||
| 1860 | Ga0207694_10067430 | |||
| 1861 | Ga0207694_10071198 | |||
| 1862 | Ga0207694_10229719 | |||
| 1863 | Ga0207650_10021575 | |||
| 1864 | Ga0207650_10133913 | |||
| 1865 | Ga0207650_10247174 | |||
| 1866 | Ga0207659_10000726 | |||
| 1867 | Ga0207659_10003073 | |||
| 1868 | Ga0207659_10045577 | |||
| 1869 | Ga0207659_10088025 | |||
| 1870 | Ga0207659_10090677 | |||
| 1871 | Ga0207659_10120472 | |||
| 1872 | Ga0207659_10218141 | |||
| 1873 | Ga0207687_10002357 | |||
| 1874 | Ga0207687_10003605 | |||
| 1875 | Ga0207687_10026900 | |||
| 1876 | Ga0207687_10055686 | |||
| 1877 | Ga0207687_10061616 | |||
| 1878 | Ga0207687_10080962 | |||
| 1879 | Ga0207687_10831387 | |||
| 1880 | Ga0207700_10035307 | |||
| 1881 | Ga0207700_10296739 | |||
| 1882 | Ga0207700_10427868 | |||
| 1883 | Ga0207644_10026183 | |||
| 1884 | Ga0207644_10028476 | |||
| 1885 | Ga0207644_10060754 | |||
| 1886 | Ga0207644_11674373 | |||
| 1887 | Ga0207690_10235165 | |||
| 1888 | Ga0207690_10654109 | |||
| 1889 | Ga0207690_10936082 | |||
| 1890 | Ga0207706_10009301 | |||
| 1891 | Ga0207706_10045295 | |||
| 1892 | Ga0207706_10054690 | |||
| 1893 | Ga0207706_10061632 | |||
| 1894 | Ga0207706_10581059 | |||
| 1895 | Ga0207706_10829271 | |||
| 1896 | Ga0207686_10010199 | |||
| 1897 | Ga0207686_10018809 | |||
| 1898 | Ga0207686_10024018 | |||
| 1899 | Ga0207686_10058845 | |||
| 1900 | Ga0207686_10069484 | |||
| 1901 | Ga0207686_10148547 | |||
| 1902 | Ga0207686_10180564 | |||
| 1903 | Ga0207686_10269260 | |||
| 1904 | Ga0207686_10293014 | |||
| 1905 | Ga0207709_10005436 | |||
| 1906 | Ga0207709_10016161 | |||
| 1907 | Ga0207709_10051331 | |||
| 1908 | Ga0207709_10307692 | |||
| 1909 | Ga0207709_11049445 | |||
| 1910 | Ga0207709_11271722 | |||
| 1911 | Ga0207670_10005770 | |||
| 1912 | Ga0207670_10099410 | |||
| 1913 | Ga0207670_10103355 | |||
| 1914 | Ga0207670_10196224 | |||
| 1915 | Ga0207670_10365846 | |||
| 1916 | Ga0207670_10510616 | |||
| 1917 | Ga0207670_10828805 | |||
| 1918 | Ga0207669_10003825 | |||
| 1919 | Ga0207669_10147131 | |||
| 1920 | Ga0207669_10678587 | |||
| 1921 | Ga0207669_11426062 | |||
| 1922 | Ga0207704_10008623 | |||
| 1923 | Ga0207704_10012832 | |||
| 1924 | Ga0207704_10042913 | |||
| 1925 | Ga0207704_10149767 | |||
| 1926 | Ga0207704_10188600 | |||
| 1927 | Ga0207704_10552935 | |||
| 1928 | Ga0207704_10572430 | |||
| 1929 | Ga0207704_10917595 | |||
| 1930 | Ga0207691_10021926 | |||
| 1931 | Ga0207691_10055697 | |||
| 1932 | Ga0207691_10063756 | |||
| 1933 | Ga0207691_10064866 | |||
| 1934 | Ga0207691_10098762 | |||
| 1935 | Ga0207691_10333934 | |||
| 1936 | Ga0207691_10779058 | |||
| 1937 | Ga0207711_10000342 | |||
| 1938 | Ga0207711_10009349 | |||
| 1939 | Ga0207711_10020105 | |||
| 1940 | Ga0207711_10043690 | |||
| 1941 | Ga0207711_10249310 | |||
| 1942 | Ga0207711_10562707 | |||
| 1943 | Ga0207711_10975516 | |||
| 1944 | Ga0207711_11872147 | |||
| 1945 | Ga0207689_10003931 | |||
| 1946 | Ga0207689_10009664 | |||
| 1947 | Ga0207689_10060470 | |||
| 1948 | Ga0207689_10105601 | |||
| 1949 | Ga0207689_10110845 | |||
| 1950 | Ga0207689_10164903 | |||
| 1951 | Ga0207689_10217737 | |||
| 1952 | Ga0207689_10426477 | |||
| 1953 | Ga0207689_10710123 | |||
| 1954 | Ga0207689_11259247 | |||
| 1955 | Ga0207661_10005099 | |||
| 1956 | Ga0207661_10008090 | |||
| 1957 | Ga0207661_10043293 | |||
| 1958 | Ga0207661_10058658 | |||
| 1959 | Ga0207661_10087213 | |||
| 1960 | Ga0207661_10337990 | |||
| 1961 | Ga0207661_10345244 | |||
| 1962 | Ga0207661_10946725 | |||
| 1963 | Ga0207679_10024068 | |||
| 1964 | Ga0207679_10108841 | |||
| 1965 | Ga0207679_10204346 | |||
| 1966 | Ga0207679_10312104 | |||
| 1967 | Ga0207679_10445370 | |||
| 1968 | Ga0207667_10003211 | |||
| 1969 | Ga0207667_10009573 | |||
| 1970 | Ga0207667_10032373 | |||
| 1971 | Ga0207667_10141050 | |||
| 1972 | Ga0207667_10171662 | |||
| 1973 | Ga0207651_10006064 | |||
| 1974 | Ga0207651_10010414 | |||
| 1975 | Ga0207651_10017293 | |||
| 1976 | Ga0207651_10151471 | |||
| 1977 | Ga0207651_10201759 | |||
| 1978 | Ga0207651_10213306 | |||
| 1979 | Ga0207651_10229888 | |||
| 1980 | Ga0207651_10322090 | |||
| 1981 | Ga0207712_10238318 | |||
| 1982 | Ga0207712_10264433 | |||
| 1983 | Ga0207712_10505596 | |||
| 1984 | Ga0207712_10555735 | |||
| 1985 | Ga0207712_10599467 | |||
| 1986 | Ga0207712_11559829 | |||
| 1987 | Ga0207668_10033425 | |||
| 1988 | Ga0207668_10104947 | |||
| 1989 | Ga0207668_10798828 | |||
| 1990 | Ga0207640_10058539 | |||
| 1991 | Ga0207640_10248067 | |||
| 1992 | Ga0207640_11705955 | |||
| 1993 | Ga0207658_10455901 | |||
| 1994 | Ga0207658_10769747 | |||
| 1995 | Ga0207658_10775242 | |||
| 1996 | Ga0207677_10377706 | |||
| 1997 | Ga0207677_10805736 | |||
| 1998 | Ga0207677_10931563 | |||
| 1999 | Ga0207703_10019568 | |||
| 2000 | Ga0207703_10025716 | |||
| 2001 | Ga0207703_10101243 | |||
| 2002 | Ga0207703_10107008 | |||
| 2003 | Ga0207703_10135402 | |||
| 2004 | Ga0207703_10215527 | |||
| 2005 | Ga0207703_10434905 | |||
| 2006 | Ga0207703_10491215 | |||
| 2007 | Ga0207703_11156583 | |||
| 2008 | Ga0207639_10066477 | |||
| 2009 | Ga0207639_10068096 | |||
| 2010 | Ga0207639_10326808 | |||
| 2011 | Ga0207639_10355922 | |||
| 2012 | Ga0207639_10390590 | |||
| 2013 | Ga0207678_10186485 | |||
| 2014 | Ga0207708_10017373 | |||
| 2015 | Ga0207708_10020438 | |||
| 2016 | Ga0207708_10045783 | |||
| 2017 | Ga0207708_10106910 | |||
| 2018 | Ga0207708_11795648 | |||
| 2019 | Ga0207708_11947547 | |||
| 2020 | Ga0207702_10005246 | |||
| 2021 | Ga0207702_10047871 | |||
| 2022 | Ga0207702_10147795 | |||
| 2023 | Ga0207702_10261594 | |||
| 2024 | Ga0207702_10274331 | |||
| 2025 | Ga0207702_10529960 | |||
| 2026 | Ga0207702_10545814 | |||
| 2027 | Ga0207641_10035499 | |||
| 2028 | Ga0207641_10086199 | |||
| 2029 | Ga0207641_10142164 | |||
| 2030 | Ga0207641_10580195 | |||
| 2031 | Ga0207641_10984121 | |||
| 2032 | Ga0207641_10997502 | |||
| 2033 | Ga0207641_11185301 | |||
| 2034 | Ga0207648_10003945 | |||
| 2035 | Ga0207648_10018835 | |||
| 2036 | Ga0207648_10019273 | |||
| 2037 | Ga0207648_10025354 | |||
| 2038 | Ga0207648_10035630 | |||
| 2039 | Ga0207648_10104897 | |||
| 2040 | Ga0207648_10175432 | |||
| 2041 | Ga0207648_10226907 | |||
| 2042 | Ga0207648_10262897 | |||
| 2043 | Ga0207648_10309254 | |||
| 2044 | Ga0207648_10429152 | |||
| 2045 | Ga0207648_10797051 | |||
| 2046 | Ga0207648_10976299 | |||
| 2047 | Ga0207648_11365668 | |||
| 2048 | Ga0207676_10040361 | |||
| 2049 | Ga0207676_10044689 | |||
| 2050 | Ga0207676_10166965 | |||
| 2051 | Ga0207676_11159103 | |||
| 2052 | Ga0207676_11608905 | |||
| 2053 | Ga0207676_12540293 | |||
| 2054 | Ga0207674_10001765 | |||
| 2055 | Ga0207674_10012664 | |||
| 2056 | Ga0207674_10048681 | |||
| 2057 | Ga0207674_10050355 | |||
| 2058 | Ga0207674_10058693 | |||
| 2059 | Ga0207674_10223020 | |||
| 2060 | Ga0207674_10298481 | |||
| 2061 | Ga0207674_10663864 | |||
| 2062 | Ga0207674_11174578 | |||
| 2063 | Ga0207675_100001637 | |||
| 2064 | Ga0207675_100017102 | |||
| 2065 | Ga0207675_100022288 | |||
| 2066 | Ga0207675_100048376 | |||
| 2067 | Ga0207675_100122370 | |||
| 2068 | Ga0207675_100232072 | |||
| 2069 | Ga0207675_100628842 | |||
| 2070 | Ga0207675_100646833 | |||
| 2071 | Ga0207675_100812753 | |||
| 2072 | Ga0207683_10009184 | |||
| 2073 | Ga0207683_10054261 | |||
| 2074 | Ga0207683_10097166 | |||
| 2075 | Ga0207683_10303670 | |||
| 2076 | Ga0207683_10316897 | |||
| 2077 | Ga0207683_10664172 | |||
| 2078 | Ga0207683_10803045 | |||
| 2079 | Ga0207698_10030727 | |||
| 2080 | Ga0207698_10091810 | |||
| 2081 | Ga0207698_10480190 | |||
| 2082 | Ga0207698_10804404 | |||
| 2083 | Ga0207698_10817049 | |||
| 2084 | Ga0207698_11771031 | |||
| 2085 | Ga0209996_1060768 | |||
| 2086 | Ga0209968_1033876 | |||
| 2087 | Ga0207428_10000986 | |||
| 2088 | Ga0207428_10004387 | |||
| 2089 | Ga0207428_10361777 | |||
| 2090 | Ga0207428_10700454 | |||
| 2091 | Ga0268266_10026277 | |||
| 2092 | Ga0268266_10110959 | |||
| 2093 | Ga0268265_10001817 | |||
| 2094 | Ga0268265_10025542 | |||
| 2095 | Ga0268264_10002343 | |||
| 2096 | Ga0268264_10053776 | |||
| 2097 | Ga0268264_10071606 | |||
| 2098 | Ga0268264_10196846 | |||
| 2099 | Ga0268264_10225866 | |||
| 2100 | Ga0268264_10372553 | |||
| 2101 | Ga0268264_10416631 | |||
| 2102 | Ga0268264_10844520 | |||
| 2103 | Ga0268264_10925075 | |||
| 2104 | Ga0268264_11044295 | |||
| 2105 | Ga0268264_11817961 | |||
| 2106 | Ga0265762_1078418 | |||
| 2107 | Ga0265760_10039341 | |||
| 2108 | Ga0265314_10003122 | |||
| 2109 | Ga0307416_100229966 | |||
| 2110 | Ga0373934_0000376 | |||
| 2111 | Ga0373934_0047781 | |||
| 2112 | Ga0373934_0105131 | |||
| 2113 | Ga0373940_0111804 | |||
| 2114 | Ga0373949_0047917 | |||
| 2115 | Ga0373932_0100219 | |||
| 2116 | Ga0373941_0430996 | |||
| 2117 | Ga0373953_0008851 | |||
| 2118 | Ga0373953_0037484 | |||
| 2119 | Ga0373953_0092149 | |||
| 2120 | Ga0373953_0287218 | |||
| 2121 | Ga0373954_0000350 | |||
| 2122 | Ga0373954_0000935 | |||
| 2123 | Ga0373954_0001398 | |||
| 2124 | Ga0373954_0006742 | |||
| 2125 | Ga0373954_0352894 | |||
| 2126 | Ga0373956_0162962 | |||
| 2127 | Ga0373956_0180697 | |||
| 2128 | Ga0373956_0635659 | |||
| 2129 | Ga0373957_0001881 | |||
| 2130 | Ga0373960_0115180 | |||
| 2131 | Ga0373955_0043575 | |||
| 2132 | Ga0373961_0011244 | |||
| 2133 | Ga0373961_0387892 | |||
| 2134 | Ga0373931_0509328 | |||
| 2135 | Ga0373931_0686574 | |||
| 2136 | Ga0373935_0091475 | |||
| 2137 | Ga0373927_0105607 | |||
| 2138 | Ga0373927_0464574 | |||
| 2139 | Ga0373933_0014824 | |||
| 2140 | Ga0373933_0015115 | |||
| 2141 | Ga0373933_0234548 | |||
| 2142 | Ga0373933_0497722 | |||
| 2143 | Ga0373933_0594695 | |||
| 2144 | Ga0373933_0894118 | |||
| 2145 | Ga0373947_0646041 | |||
| 2146 | Ga0373937_0002174 | |||
| 2147 | Ga0373937_0005074 | |||
| 2148 | Ga0373937_0005118 | |||
| 2149 | Ga0373937_0007547 | |||
| 2150 | Ga0373937_0011117 | |||
| 2151 | Ga0373937_0031595 | |||
| 2152 | Ga0373937_0244870 | |||
| 2153 | Ga0373937_0354287 | |||
| 2154 | Ga0373937_0572310 | |||
| 2155 | Ga0373937_1134027 | |||
| 2156 | Ga0373925_0086373 | |||
| 2157 | Ga0373925_0110419 | |||
| 2158 | Ga0373925_0394537 | |||
| 2159 | Ga0373925_0574429 | |||
| 2160 | Ga0373925_1048003 | |||
| 2161 | Ga0436364_1138878 | |||
| 2162 | Ga0436363_0546662 | |||
| 2163 | Ga0436363_0635755 | |||
| 2164 | Ga0436362_0188994 | |||
| 2165 | Ga0439464_0069982 | |||
| 2166 | Ga0451577_0773381 | |||
| 2167 | Ga0453683_0851988 | |||
| 2168 | Ga0451576_0031110 | |||
| 2169 | Ga0451576_0086745 | |||
| 2170 | Ga0451576_0107691 | |||
| 2171 | Ga0451576_0712302 | |||
| 2172 | Ga0451576_0801062 | |||
| 2173 | Ga0495592_0122741 | |||
| 2174 | Ga0495641_0356437 | |||
| 2175 | Ga0495651_0385634 | |||
| 2176 | Ga0495651_0548110 | |||
| 2177 | Ga0495580_0033712 | |||
| 2178 | Ga0495580_0043694 | |||
| 2179 | Ga0495580_0646323 | |||
| 2180 | Ga0495582_0201285 | |||
| 2181 | Ga0495608_0145613 | |||
| 2182 | Ga0495628_0955427 | |||
| 2183 | Ga0495630_0547161 | |||
| 2184 | Ga0495630_1500837 | |||
| 2185 | Ga0495644_0215317 | |||
| 2186 | Ga0495642_0355345 | |||
| 2187 | Ga0495652_0006912 | |||
| 2188 | Ga0495665_0097187 | |||
| 2189 | Ga0495665_0184212 | |||
| 2190 | Ga0495640_0479591 | |||
| 2191 | Ga0495586_0161832 | |||
| 2192 | Ga0495586_0214424 | |||
| 2193 | Ga0495587_0142205 | |||
| 2194 | Ga0495587_0298598 | |||
| 2195 | Ga0495587_0507361 | |||
| 2196 | Ga0495598_0032282 | |||
| 2197 | Ga0495597_0199490 | |||
| 2198 | Ga0495645_0021213 | |||
| 2199 | Ga0495667_0038465 | |||
| 2200 | Ga0495656_0108088 | |||
| 2201 | Ga0495656_0326512 | |||
| 2202 | Ga0495634_0123994 | |||
| 2203 | Ga0495634_0249624 | |||
| 2204 | Ga0495659_0037097 | |||
| 2205 | Ga0495588_0162062 | |||
| 2206 | Ga0495599_0001991 | |||
| 2207 | Ga0495623_0186866 | |||
| 2208 | Ga0495658_0020114 | |||
| 2209 | Ga0495613_0027552 | |||
| 2210 | Ga0495613_0296911 | |||
| 2211 | Ga0495600_0298326 | |||
| 2212 | Ga0495604_0112088 | |||
| 2213 | Ga0495636_0017086 | |||
| 2214 | Ga0495674_0579368 | |||
| 2215 | Ga0495680_0126597 | |||
| 2216 | Ga0495680_0193981 | |||
| 2217 | Ga0495680_0207404 | |||
| 2218 | Ga0495680_0518060 | |||
| 2219 | Ga0495675_0038181 | |||
| 2220 | Ga0495675_0503833 | |||
| 2221 | Ga0495684_0006087 | |||
| 2222 | Ga0495684_0017963 | |||
| 2223 | Ga0495684_0020127 | |||
| 2224 | Ga0495684_0211261 | |||
| 2225 | Ga0495602_0453031 | |||
| 2226 | Ga0496100_0017245 | |||
| 2227 | Ga0496101_0006359 | |||
| 2228 | Ga0496102_0109248 | |||
| 2229 | Ga0496104_0139245 | |||
| 2230 | Ga0496104_0342995 | |||
| 2231 | Ga0496104_0727354 | |||
| 2232 | Ga0496106_0035342 | |||
| 2233 | Ga0496106_1043358 | |||
| 2234 | Ga0496106_1469377 | |||
| 2235 | Ga0496112_0223205 | |||
| 2236 | Ga0496112_1371074 | |||
| 2237 | Ga0496114_0002532 | |||
| 2238 | Ga0496114_0539275 | |||
| 2239 | Ga0496115_0387577 | |||
| 2240 | Ga0501033_0625600 | |||
| 2241 | Ga0501036_0016212 | |||
| 2242 | Ga0501038_0736700 | |||
| 2243 | Ga0501039_0289807 | |||
| 2244 | Ga0501040_0044231 | |||
| 2245 | Ga0501041_0016496 | |||
| 2246 | Ga0501041_0200472 | |||
| 2247 | Ga0501042_0410391 | |||
| 2248 | Ga0501046_0016197 | |||
| 2249 | Ga0501068_0353240 | |||
| 2250 | Ga0501072_1024170 | |||
| 2251 | Ga0501075_0549821 | |||
| 2252 | Ga0501076_0014376 | |||
| 2253 | Ga0501079_0003042 | |||
| 2254 | Ga0501081_0154815 | |||
| 2255 | Ga0501045_0761787 | |||
| 2256 | nmdc:mga05p37_245414_c1 | |||
| 2257 | nmdc:mga05p37_36011_c1 | |||
| 2258 | nmdc:mga05p37_3678_c1 | |||
| 2259 | nmdc:mga05p37_4305_c1 | |||
| 2260 | nmdc:mga05p37_54320_c1 | |||
| 2261 | nmdc:mga05p37_69413_c1 | |||
| 2262 | nmdc:mga05p37_777690_c1 | |||
| 2263 | nmdc:mga09592_107377_c1 | |||
| 2264 | nmdc:mga09592_119986_c1 | |||
| 2265 | nmdc:mga09592_15185_c1 | |||
| 2266 | nmdc:mga0qj67_1031_c1 | |||
| 2267 | nmdc:mga0qj67_889323_c1 | |||
| 2268 | nmdc:mga06r32_92505_c1 | |||
| 2269 | nmdc:mga06r32_9715_c1 | |||
| 2270 | nmdc:mga08y16_109136_c1 | |||
| 2271 | nmdc:mga08y16_1160642_c1 | |||
| 2272 | nmdc:mga08y16_12324_c1 | |||
| 2273 | nmdc:mga08y16_31440_c1 | |||
| 2274 | nmdc:mga08y16_561780_c1 | |||
| 2275 | nmdc:mga08y16_784347_c1 | |||
| 2276 | nmdc:mga0n895_1034525_c1 | |||
| 2277 | nmdc:mga0n895_1118260_c1 | |||
| 2278 | nmdc:mga0n895_5526_c1 | |||
| 2279 | nmdc:mga0n895_590198_c1 | |||
| 2280 | nmdc:mga0n895_61306_c1 | |||
| 2281 | nmdc:mga0n895_69297_c1 | |||
| 2282 | nmdc:mga0n895_7683_c1 | |||
| 2283 | nmdc:mga0n895_963186_c1 | |||
| 2284 | nmdc:mga0rr50_181033_c1 | |||
| 2285 | nmdc:mga0rr50_243166_c1 | |||
| 2286 | nmdc:mga0rr50_361212_c1 | |||
| 2287 | nmdc:mga0rr50_63211_c1 | |||
| 2288 | nmdc:mga0rr50_79805_c1 | |||
| 2289 | nmdc:mga08x19_1166421_c1 | |||
| 2290 | nmdc:mga08x19_69351_c1 | |||
| 2291 | nmdc:mga0a205_131939_c1 | |||
| 2292 | nmdc:mga0a205_1627_c1 | |||
| 2293 | nmdc:mga0a205_190191_c1 | |||
| 2294 | nmdc:mga0a205_537800_c1 | |||
| 2295 | nmdc:mga0a205_58889_c1 | |||
| 2296 | nmdc:mga0a205_806302_c1 | |||
| 2297 | Ga0495601_0127376 | |||
| 2298 | Ga0495595_0750858 | |||
| 2299 | Ga0495619_0170709 | |||
| 2300 | Ga0501084_0006540 | |||
| 2301 | Ga0501082_0017413 | |||
| 2302 | Ga0530510_0062594 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4fxd-assembly1.cif.gz_A | crystal structure of yeast dna polymerase alpha bound to dna/rna | 0.7833 | 39 | 72 |
| 4fxd-assembly2.cif.gz_B | crystal structure of yeast dna polymerase alpha bound to dna/rna | 0.7811 | 39 | 72 |
| 8foc-assembly1.cif.gz_1 | cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i | 0.7656 | 38 | 72 |
| 8foe-assembly1.cif.gz_1 | cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex bound to a template dna | 0.7613 | 38 | 72 |
| 4fvm-assembly1.cif.gz_A | crystal structure of yeast dna polymerase alpha | 0.7613 | 38 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8275 | 37 | 97 | 2.40.50.140 |
| af_Q9TZG4_240_302_2.60.40.1180 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.788 | 39 | 72 | 2.60.40.1180 |
| af_P87307_123_212_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7733 | 36 | 119 | 2.40.50.140 |
| 3rlfA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7731 | 37 | 98 | 2.40.50.140 |
| af_Q95Y97_40_169_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7633 | 35 | 118 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383CUF3-F1-model_v4 | OB domain-containing protein | 0.9709 | 32 | 125 |
|
| AF-A0A2W4Q999-F1-model_v4 | DUF5666 domain-containing protein | 0.9608 | 31 | 123 |
|
| AF-A0A2V8LU00-F1-model_v4 | OB domain-containing protein | 0.9604 | 37 | 122 |
|
| AF-A0A521RFX0-F1-model_v4 | Uncharacterized protein | 0.9471 | 31 | 128 |
|
| AF-A0A381VHI2-F1-model_v4 | Uncharacterized protein | 0.9469 | 35 | 132 |
|