F490575

General Info

Members Datasets Scaffolds Average Seq Length
1132 962 367 627

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221599|2644002258
Length 708
Sequence TSTIAAAATETPAKGFKSRVLARDFLFFHVIRSFAALKRYTKRKFAAKVLAGWGRRLNSNVTKKRRMQIRGKAPKTGIAYRRTGIVLVVAAAAAFSPAMVGNAYAFKLFGINFFGKDEPAADQVPDPVRYDVTLTTDAVDPDLKEALENSSRLVSDKAQPVSGDLGVVVKARDDRDRLIAALYEKARYGGVVTITVDGKNIDNLPPNPTFDRAKPIAVAVNVAAGPIFRVGEVQFGGDAANRNPADYDLAPGAQAGSLVVIKAGDKLVEEMKEEGRPLAKLTKREVIADHRTDTVDVVLSVESGPIAPIGTVGVTGSKSVRPDFIQSYSRLDKGDRYSPEALKKAGDRLRALGVFSSVTIHEAEGLAGDGSLPMTIEVSEGKQRYFGVGAQYSTIDGFGVNGYWGHRNLFGGAEGLRIEGAVGRLGEASGVSDLDYSAGITFTKPGIFVPEATLTASILAKTENPDAYNAKLVTASLGIAYELNDRDTITGSGEVSWEKDDDAFGNNTYLTFALPFQFDRDARDNKFDPTEGYRAMAKVTPSCESYSGTFFSAFEGSISGYYGLGAEDRIVLAGKVAAGFLVGADDLENIPATRRFFAGGGGSVRGYGYQEISPYNAANEETGGASYMTASFETRVKITDTIGIVPFIDVGTVSADVAPDFSDFRAGAGIGIRYATPFGPLRLDFAVPLNKYEGGTNYGIYAGIGQSF

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
11 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
12 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
13 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
14 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
15 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
16 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
17 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
18 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
19 2512875024 Mesorhizobium loti R88b Isolate Nodule
20 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
21 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
22 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
23 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
24 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
25 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
26 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
27 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
28 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
29 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
30 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
31 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
32 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
33 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
34 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
35 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
36 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
37 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
38 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
39 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
40 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
41 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
42 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
43 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
44 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
45 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
46 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
47 2516143018 Ensifer sp. BR816 Isolate Nodule
48 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
49 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
50 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
51 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
52 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
53 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
54 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
55 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
56 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
57 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
58 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
59 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
60 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
61 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
62 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
63 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
64 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
65 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
66 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
67 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
68 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
69 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
70 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
71 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
72 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
73 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
74 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
75 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
76 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
77 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
78 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
79 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
80 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
81 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
82 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
83 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
84 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
85 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
86 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
87 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
88 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
89 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
90 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
91 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
92 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
93 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
94 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
95 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
96 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
97 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
98 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
99 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
100 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
101 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
102 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
103 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
104 2643221557 Ensifer sp. Root558 Isolate Unclassified
105 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
106 2643221582 Rhizobium sp. Root651 Isolate Unclassified
107 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
108 2643221599 Rhizobium sp. Root708 Isolate Unclassified
109 2643221607 Rhizobium sp. Root73 Isolate Unclassified
110 2643221610 Ensifer sp. Root74 Isolate Unclassified
111 2643221618 Ensifer sp. Root231 Isolate Unclassified
112 2643221626 Ensifer sp. Root31 Isolate Unclassified
113 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
114 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
115 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
116 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
117 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
118 2643221655 Ensifer sp. Root1252 Isolate Unclassified
119 2643221668 Ensifer sp. Root423 Isolate Unclassified
120 2643221675 Ensifer sp. Root1298 Isolate Unclassified
121 2643221680 Ensifer sp. Root1312 Isolate Unclassified
122 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
123 2643221688 Rhizobium sp. Root482 Isolate Unclassified
124 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
125 2643221693 Rhizobium sp. Root491 Isolate Unclassified
126 2643221698 Ensifer sp. Root142 Isolate Unclassified
127 2643221712 Ensifer sp. Root258 Isolate Unclassified
128 2643221718 Rhizobium sp. Root268 Isolate Unclassified
129 2643221723 Ensifer sp. Root278 Isolate Unclassified
130 2643221726 Ensifer sp. Root954 Isolate Unclassified
131 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
132 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
133 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
134 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
135 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
136 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
137 2718217882 Rhizobium sp. N741 Isolate Nodule
138 2718217927 Rhizobium sp. N324 Isolate Nodule
139 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
140 2718218009 Rhizobium sp. N561 Isolate Nodule
141 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
142 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
143 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
144 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
145 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
146 2718218363 Rhizobium sp. N113 Isolate Nodule
147 2718218365 Rhizobium sp. N731 Isolate Nodule
148 2718218366 Rhizobium sp. N621 Isolate Nodule
149 2718218423 Rhizobium sp. N941 Isolate Nodule
150 2721755514 Rhizobium sp. N6212 Isolate Nodule
151 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
152 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
153 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
154 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
155 2721755809 Rhizobium sp. N541 Isolate Nodule
156 2721755810 Rhizobium sp. N871 Isolate Nodule
157 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
158 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
159 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
160 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
161 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
162 2728369365 Rhizobium sp. N1341 Isolate Nodule
163 2728369397 Rhizobium sp. N1314 Isolate Nodule
164 2738541293 Rhizobium sp. GV031 Isolate Unclassified
165 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
166 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
167 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
168 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
169 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
170 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
171 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
172 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
173 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
174 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
175 2791355256 Rhizobium sp. M10 Isolate Nodule
176 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
177 2791355260 Rhizobium sp. L9 Isolate Nodule
178 2791355261 Rhizobium sp. J15 Isolate Nodule
179 2791355262 Rhizobium sp. M1 Isolate Nodule
180 2791355263 Rhizobium chutanense C5 Isolate Nodule
181 2791355264 Rhizobium sp. S9 Isolate Nodule
182 2791355265 Rhizobium sp. H4 Isolate Nodule
183 2791355266 Rhizobium sp. L43 Isolate Nodule
184 2791355267 Rhizobium sp. L18 Isolate Nodule
185 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
186 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
187 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
188 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
189 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
190 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
191 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
192 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
193 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
194 2802429633 Rhizobium anhuiense J3 Isolate Nodule
195 2802429634 Rhizobium anhuiense S10 Isolate Nodule
196 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
197 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
198 2802429637 Rhizobium anhuiense C15 Isolate Nodule
199 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
200 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
201 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
202 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
203 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
204 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
205 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
206 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
207 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
208 2838048938 Rhizobium pisi 27/80 Isolate Nodule
209 2838061910 Rhizobium phaseoli L15 Isolate Nodule
210 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
211 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
212 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
213 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
214 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
215 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
216 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
217 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
218 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
219 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
220 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
221 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
222 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
223 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
224 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
225 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
226 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
227 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
228 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
229 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
230 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
231 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
232 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
233 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
234 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
235 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
236 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
237 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
238 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
239 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
240 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
241 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
242 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
243 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
244 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
245 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
246 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
247 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
248 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
249 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
250 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
251 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
252 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
253 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
254 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
255 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
256 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
257 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
258 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
259 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
260 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
261 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
262 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
263 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
264 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
265 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
266 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
267 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
268 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
269 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
270 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
271 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
272 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
273 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
274 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
275 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
276 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
277 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
278 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
279 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
280 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
281 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
282 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
283 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
284 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
285 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
286 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
287 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
288 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
289 2844163670 Ensifer sp. 1H6 Isolate Unclassified
290 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
291 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
292 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
293 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
294 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
295 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
296 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
297 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
298 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
299 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
300 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
301 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
302 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
303 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
304 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
305 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
306 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
307 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
308 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
309 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
310 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
311 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
312 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
313 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
314 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
315 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
316 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
317 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
318 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
319 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
320 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
321 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
322 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
323 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
324 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
325 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
326 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
327 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
328 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
329 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
330 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
331 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
332 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
333 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
334 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
335 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
336 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
337 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
338 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
339 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
340 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
341 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
342 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
343 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
344 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
345 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
346 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
347 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
348 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
349 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
350 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
351 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
352 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
353 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
354 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
355 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
356 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
357 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
358 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
359 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
360 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
361 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
362 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
363 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
364 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
365 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
366 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
367 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
368 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
369 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
370 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
371 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
372 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
373 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
374 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
375 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
376 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
377 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
378 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
379 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
380 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
381 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
382 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
383 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
384 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
385 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
386 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
387 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
388 2909042592 Labrys sp. LIt4 Isolate Nodule
389 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
390 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
391 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
392 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
393 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
394 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
395 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
396 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
397 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
398 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
399 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
400 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
401 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
402 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
403 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
404 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
405 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
406 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
407 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
408 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
409 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
410 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
411 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
412 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
413 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
414 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
415 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
416 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
417 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
418 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
419 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
420 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
421 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
422 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
423 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
424 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
425 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
426 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
427 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
428 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
429 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
430 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
431 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
432 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
433 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
434 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
435 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
436 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
437 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
438 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
439 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
440 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
441 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
442 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
443 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
444 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
445 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
446 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
447 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
448 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
449 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
450 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
451 2933599457 Rhizobium phaseoli M3 Isolate Nodule
452 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
453 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
454 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
455 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
456 2936381700 Rhizobium chutanense C16 Isolate Unclassified
457 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
458 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
459 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
460 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
461 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
462 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
463 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
464 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
465 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
466 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
467 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
468 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
469 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
470 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
471 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
472 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
473 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
474 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
475 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
476 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
477 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
478 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
479 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
480 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
481 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
482 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
483 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
484 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
485 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
486 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
487 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
488 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
489 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
490 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
491 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
492 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
493 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
494 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
495 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
496 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
497 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
498 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
499 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
500 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
501 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
502 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
503 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
504 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
505 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
506 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
507 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
508 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
509 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
510 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
511 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
512 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
513 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
514 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
515 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
516 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
517 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
518 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
519 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
520 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
521 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
522 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
523 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
524 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
525 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
526 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
527 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
528 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
529 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
530 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
531 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
532 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
533 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
534 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
535 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
536 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
537 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
538 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
539 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
540 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
541 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
542 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
543 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
544 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
545 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
546 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
547 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
548 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
549 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
550 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
551 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
552 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
553 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
554 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
555 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
556 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
557 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
558 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
559 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
560 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
561 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
562 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
563 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
564 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
565 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
566 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
567 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
568 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
569 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
570 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
571 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
572 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
573 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
574 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
575 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
576 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
577 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
578 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
579 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
580 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
581 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
582 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
583 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
584 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
585 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
586 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
587 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
588 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
589 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
590 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
591 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
592 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
593 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
594 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
595 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
596 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
597 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
598 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
599 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
600 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
601 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
602 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
603 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
604 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
605 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
606 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
607 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
608 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
609 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
610 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
611 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
612 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
613 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
614 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
615 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
616 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
617 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
618 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
619 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
620 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
621 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
622 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
623 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
624 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
625 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
626 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
627 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
628 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
629 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
630 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
631 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
632 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
633 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
634 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
635 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
636 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
637 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
638 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
639 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
640 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
641 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
642 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
643 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
644 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
645 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
646 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
647 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
648 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
649 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
650 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
651 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
652 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
653 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
654 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
655 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
656 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
657 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
658 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
659 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
660 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
661 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
662 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
663 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
664 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
665 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
666 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
667 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
668 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
669 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
670 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
671 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
672 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
673 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
674 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
675 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
676 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
677 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
678 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
679 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
680 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
681 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
682 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
683 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
684 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
685 2996887358 Rhizobium sp. R711 Isolate Nodule
686 2996893221 Rhizobium sp. R635 Isolate Nodule
687 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
688 3004167301 Mesorhizobium loti 582 Isolate Unclassified
689 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
690 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
691 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
692 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
693 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
694 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
695 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
696 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
697 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
698 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
699 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
700 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
701 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
702 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
703 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
704 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
705 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
706 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
707 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
708 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
709 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
710 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
711 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
712 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
713 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
714 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
715 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
716 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
717 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
718 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
719 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
720 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
721 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
722 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
723 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
724 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
725 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
726 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
727 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
728 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
729 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
730 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
731 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
732 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
733 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
734 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
735 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
736 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
737 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
738 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
739 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
740 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
741 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
742 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
743 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
744 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
745 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
746 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
747 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
748 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
749 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
750 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
751 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
752 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
753 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
754 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
755 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
756 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
757 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
758 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
759 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
760 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
761 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
762 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
763 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
764 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
765 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
766 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
767 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
768 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
769 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
770 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
771 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
772 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
773 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
774 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
775 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
776 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
777 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
778 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
779 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
780 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
781 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
782 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
783 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
784 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
785 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
786 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
787 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
788 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
789 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
790 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
791 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
792 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
793 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
794 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
795 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
796 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
797 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
798 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
799 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
800 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
801 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
802 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
803 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
804 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
805 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
806 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
807 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
808 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
809 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
810 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
811 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
812 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
813 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
814 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
815 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
816 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
817 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
818 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
819 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
820 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
821 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
822 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
823 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
824 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
825 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
826 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
827 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
828 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
829 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
830 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
831 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
832 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
833 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
834 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
835 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
836 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
837 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
838 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
839 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
840 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
841 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
842 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
843 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
844 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
845 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
846 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
847 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
848 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
849 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
850 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
851 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
852 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
853 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
854 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
855 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
856 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
857 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
858 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
859 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
860 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
861 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
862 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
863 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
864 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
865 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
866 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
867 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
868 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
869 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
870 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
871 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
872 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
873 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
874 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
875 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
876 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
877 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
878 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
879 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
880 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
881 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
882 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
883 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
884 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
885 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
886 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
887 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
888 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
889 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
890 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
891 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
892 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
893 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
894 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
895 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
896 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
897 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
898 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
899 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
900 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
901 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
902 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
903 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
904 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
905 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
906 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
907 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
908 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
909 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
910 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
911 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
912 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
913 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
914 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
915 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
916 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
917 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
918 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
919 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
920 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
921 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
922 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
923 8005258706 Rhizobium sp. R693 Isolate Nodule
924 8005275841 Rhizobium sp. N4311 Isolate Nodule
925 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
926 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
927 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
928 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
929 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
930 8005321885 Rhizobium sp. R72 Isolate Nodule
931 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
932 8005382845 Rhizobium sp. R634 Isolate Nodule
933 8005395548 Rhizobium sp. R339 Isolate Nodule
934 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
935 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
936 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
937 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
938 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
939 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
940 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
941 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
942 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
943 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
944 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
945 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
946 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
947 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
948 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
949 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
950 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
951 8018176218 Rhizobium sp. N122 Isolate Nodule
952 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
953 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
954 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
955 8024501048 Rhizobium sp. H4 Isolate Nodule
956 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
957 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
958 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
959 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
960 8056382006 Rhizobium croatiense 13T Isolate Nodule
961 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
962 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 32.33
Metatranscriptomes 0
Isolates 67.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 13.52
Nodule 55.65
Rhizoplane 1.06
Rhizosphere 15.9
Stem 0
Stem Tuber 0
Unclassified 13.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000066 3300001979 Bacteria 34178
2 JGI25155J39150_1000010 3300002704 Bacteria 207717
3 JGI25156J39149_1000033 3300002705 Bacteria 114688
4 JGI25162J39368_1000410 3300002737 Bacteria 34999
5 JGI25162J39368_1000750 3300002737 Bacteria 22052
6 JGI25154J39366_1000058 3300002738 Bacteria 107363
7 JGI25158J39367_1000028 3300002739 Bacteria 33872
8 JGI25157J39369_1000009 3300002741 Bacteria 207868
9 JGI25157J39369_1002473 3300002741 Bacteria 4543
10 JGI25152J39213_1000862 3300002773 Bacteria 14971
11 JGI25152J39213_1001208 3300002773 Bacteria 11846
12 JGI25152J39213_1001987 3300002773 Bacteria 8076
13 JGI25152J39213_1002229 3300002773 Bacteria 7540
14 JGI25150J39212_1000181 3300002774 Bacteria 35419
15 JGI25150J39212_1002835 3300002774 Bacteria 4193
16 JGI25159J45721_1000050 3300002987 Bacteria 57206
17 JGI25159J45721_1001206 3300002987 Bacteria 10999
18 JGI25159J45721_1002742 3300002987 Bacteria 6530
19 JGI25151J46595_10000081 3300003187 Bacteria 131317
20 JGI25151J46595_10002317 3300003187 Bacteria 11618
21 JGI25151J46595_10007312 3300003187 Bacteria 5432
22 JGI25165J46597_1000015 3300003214 Bacteria 380891
23 JGI25165J46597_1000509 3300003214 Bacteria 37163
24 JGI25165J46597_1000514 3300003214 Bacteria 36799
25 JGI25165J46597_1000881 3300003214 Bacteria 21176
26 JGI25153J46596_10002624 3300003215 Bacteria 10282
27 JGI25153J46596_10003307 3300003215 Bacteria 9060
28 rootL2_10055500 3300003322 Bacteria 4638
29 rootL2_10209693 3300003322 Bacteria 3596
30 rootH1_10020131 3300003316 Bacteria 2359
31 rootH1_10020131 3300003323 Bacteria 6510
32 rootH1_10043274 3300003323 Bacteria 3318
33 JGI25160J50197_1000097 3300003354 Bacteria 87619
34 JGI25160J50197_1000214 3300003354 Bacteria 47126
35 JGI25160J50197_1005273 3300003354 Bacteria 5407
36 JGI25160J50197_1016347 3300003354 Bacteria 2394
37 JGI25161J50226_1000155 3300003374 Bacteria 47660
38 JGI25161J50226_1000158 3300003374 Bacteria 47126
39 JGI25161J50226_1000705 3300003374 Bacteria 13104
40 JGI25161J50226_1003484 3300003374 Bacteria 3583
41 Ga0055526_1001632 3300003771 Bacteria 15747
42 Ga0055526_1004058 3300003771 Bacteria 8988
43 Ga0055526_1015804 3300003771 Bacteria 3003
44 Ga0055524_1004722 3300003775 Bacteria 6242
45 Ga0055524_1006596 3300003775 Bacteria 5020
46 Ga0055536_1002046 3300003781 Bacteria 11540
47 Ga0055528_1001269 3300003790 Bacteria 15941
48 Ga0055528_1001563 3300003790 Bacteria 13736
49 Ga0055528_1002456 3300003790 Bacteria 9920
50 Ga0055528_1004877 3300003790 Bacteria 6354
51 Ga0055540_1000481 3300003792 Bacteria 30719
52 Ga0055540_1006447 3300003792 Bacteria 4657
53 Ga0055531_10002498 3300003794 Bacteria 12249
54 Ga0058692_1012274 3300003856 Bacteria 2036
55 Ga0055543_1000099 3300004625 Bacteria 74883
56 Ga0055543_1000454 3300004625 Bacteria 24576
57 Ga0055543_1000543 3300004625 Bacteria 21152
58 Ga0055543_1000751 3300004625 Bacteria 16253
59 Ga0065165_1000427 3300005262 Bacteria 66083
60 Ga0065165_1000575 3300005262 Bacteria 54383
61 Ga0065165_1004583 3300005262 Bacteria 8428
62 Ga0070668_100059208 3300005347 Bacteria 2964
63 Ga0070669_100051764 3300005353 Bacteria 3003
64 Ga0070674_100061468 3300005356 Bacteria 2621
65 Ga0068853_100055808 3300005539 Bacteria 3405
66 Ga0070665_100016971 3300005548 Bacteria 7299
67 Ga0070665_100020368 3300005548 Bacteria 6661
68 Ga0070665_100035216 3300005548 Bacteria 5034
69 Ga0068855_100069939 3300005563 Bacteria 4084
70 Ga0068856_100025555 3300005614 Bacteria 5759
71 Ga0081455_10043625 3300005937 Bacteria 3920
72 Ga0075365_10005010 3300006038 Bacteria 7096
73 Ga0075365_10016851 3300006038 Bacteria 4457
74 Ga0075364_10073195 3300006051 Bacteria 2258
75 Ga0075362_10004817 3300006177 Bacteria 4872
76 Ga0075367_10005023 3300006178 Bacteria 6523
77 Ga0075367_10012869 3300006178 Bacteria 4480
78 Ga0075369_10002003 3300006186 Bacteria 7171
79 Ga0075366_10017995 3300006195 Bacteria 4077
80 Ga0099826_10018843 3300006948 Bacteria 5197
81 Ga0105251_10018923 3300009011 Bacteria 3649
82 Ga0105240_10000013 3300009093 Bacteria 483458
83 Ga0105243_10008956 3300009148 Bacteria 7650
84 Ga0105248_10019530 3300009177 Bacteria 7499
85 Ga0105237_10018090 3300009545 Bacteria 7299
86 Ga0105237_10115551 3300009545 Bacteria 2677
87 Ga0105238_10018737 3300009551 Bacteria 7049
88 Ga0105238_10155193 3300009551 Bacteria 2264
89 Ga0123341_1000020 3300009765 Bacteria 79523
90 Ga0123342_1009750 3300009766 Bacteria 11308
91 Ga0105239_10009509 3300010375 Bacteria 10946
92 Ga0105239_10095486 3300010375 Bacteria 3284
93 Ga0105246_10027052 3300011119 Bacteria 3754
94 Ga0157373_10006515 3300013100 Bacteria 8712
95 Ga0157371_10000195 3300013102 Bacteria 89727
96 Ga0157370_10000209 3300013104 Bacteria 74351
97 Ga0157370_10001395 3300013104 Bacteria 29952
98 Ga0157370_10016747 3300013104 Bacteria 7416
99 Ga0157369_10042259 3300013105 Bacteria 4973
100 Ga0171463_1004 3300013249 Bacteria 437207
101 Ga0182008_10017975 3300014497 Bacteria 3663
102 Ga0157376_10111389 3300014969 Bacteria 2410
103 Ga0182007_10001441 3300015262 Bacteria 12758
104 Ga0183363_1024 3300015690 Bacteria 54122
105 Ga0214542_1020324 3300021321 Bacteria 4908
106 Ga0214543_1000053 3300021327 Bacteria 141797
107 Ga0228711_1003012 3300022739 Bacteria 26140
108 Ga0228710_1003154 3300022740 Bacteria 26273
109 Ga0209435_100009 3300025206 Bacteria 476614
110 Ga0209436_100296 3300025208 Bacteria 23018
111 Ga0209436_100651 3300025208 Bacteria 14802
112 Ga0209437_100057 3300025233 Bacteria 362922
113 Ga0209437_100107 3300025233 Bacteria 218656
114 Ga0207425_1000034 3300025245 Bacteria 227886
115 Ga0207425_1001482 3300025245 Bacteria 9773
116 Ga0207425_1003822 3300025245 Bacteria 4693
117 Ga0207425_1007273 3300025245 Bacteria 2942
118 Ga0209646_1000018 3300025246 Bacteria 476716
119 Ga0209026_1000025 3300025250 Bacteria 352548
120 Ga0209026_1000068 3300025250 Bacteria 207601
121 Ga0209677_100812 3300025253 Bacteria 15612
122 Ga0209148_1000181 3300025254 Bacteria 124691
123 Ga0209759_1000007 3300025256 Bacteria 476614
124 Ga0209759_1000226 3300025256 Bacteria 84383
125 Ga0209129_1000094 3300025258 Bacteria 172051
126 Ga0209129_1000118 3300025258 Bacteria 139972
127 Ga0209129_1000935 3300025258 Bacteria 17616
128 Ga0209129_1000970 3300025258 Bacteria 17236
129 Ga0209129_1001019 3300025258 Bacteria 16693
130 Ga0209129_1001141 3300025258 Bacteria 15355
131 Ga0209233_1000010 3300025261 Bacteria 1194329
132 Ga0209233_1000072 3300025261 Bacteria 363074
133 Ga0209233_1000134 3300025261 Bacteria 202535
134 Ga0209233_1000440 3300025261 Bacteria 28932
135 Ga0209455_1000127 3300025272 Bacteria 162518
136 Ga0209673_1000052 3300025273 Bacteria 279795
137 Ga0209673_1000158 3300025273 Bacteria 143067
138 Ga0209673_1000459 3300025273 Bacteria 68727
139 Ga0209673_1000997 3300025273 Bacteria 34532
140 Ga0209673_1005682 3300025273 Bacteria 6227
141 Ga0209673_1006522 3300025273 Bacteria 5610
142 Ga0209673_1006920 3300025273 Bacteria 5364
143 Ga0209130_1000009 3300025284 Bacteria 498952
144 Ga0209130_1000027 3300025284 Bacteria 327700
145 Ga0209130_1000132 3300025284 Bacteria 119765
146 Ga0209676_1001367 3300025292 Bacteria 23952
147 Ga0209676_1007477 3300025292 Bacteria 5115
148 Ga0209676_1016652 3300025292 Bacteria 2641
149 Ga0209025_1000184 3300025294 Bacteria 155611
150 Ga0209025_1000617 3300025294 Bacteria 63860
151 Ga0209025_1000706 3300025294 Bacteria 56897
152 Ga0209025_1000765 3300025294 Bacteria 53466
153 Ga0209025_1002441 3300025294 Bacteria 19681
154 Ga0209025_1006022 3300025294 Bacteria 9612
155 Ga0209025_1041347 3300025294 Bacteria 1976
156 Ga0209564_1000111 3300025295 Bacteria 212210
157 Ga0209564_1000675 3300025295 Bacteria 50429
158 Ga0209564_1000864 3300025295 Bacteria 40349
159 Ga0209564_1001140 3300025295 Bacteria 31141
160 Ga0209564_1002998 3300025295 Bacteria 12122
161 Ga0209564_1003182 3300025295 Bacteria 11529
162 Ga0209758_1000159 3300025297 Bacteria 155588
163 Ga0209758_1000323 3300025297 Bacteria 92123
164 Ga0209758_1000948 3300025297 Bacteria 39099
165 Ga0209758_1001909 3300025297 Bacteria 22693
166 Ga0209758_1002600 3300025297 Bacteria 18055
167 Ga0209758_1008165 3300025297 Bacteria 6874
168 Ga0209758_1013232 3300025297 Bacteria 4526
169 Ga0209758_1015226 3300025297 Bacteria 4005
170 Ga0209050_1006084 3300025298 Bacteria 7294
171 Ga0209256_1000132 3300025299 Bacteria 160806
172 Ga0209256_1001314 3300025299 Bacteria 26601
173 Ga0209256_1002722 3300025299 Bacteria 13703
174 Ga0209256_1003287 3300025299 Bacteria 11529
175 Ga0209256_1007490 3300025299 Bacteria 5363
176 Ga0209256_1008913 3300025299 Bacteria 4522
177 Ga0207426_1000041 3300025302 Bacteria 433536
178 Ga0207426_1000072 3300025302 Bacteria 327700
179 Ga0207426_1000246 3300025302 Bacteria 119765
180 Ga0207426_1000761 3300025302 Bacteria 35881
181 Ga0207426_1002224 3300025302 Bacteria 12982
182 Ga0209051_1000863 3300025303 Bacteria 30781
183 Ga0209051_1001273 3300025303 Bacteria 22500
184 Ga0209051_1001804 3300025303 Bacteria 16976
185 Ga0209051_1003684 3300025303 Bacteria 9902
186 Ga0209051_1013633 3300025303 Bacteria 3853
187 Ga0209257_1004072 3300025304 Bacteria 11726
188 Ga0209257_1005315 3300025304 Bacteria 9137
189 Ga0207713_1025524 3300025735 Bacteria 2726
190 Ga0207647_10002170 3300025904 Bacteria 14975
191 Ga0207695_10000044 3300025913 Bacteria 440819
192 Ga0207671_10000226 3300025914 Bacteria 84886
193 Ga0207671_10018871 3300025914 Bacteria 5285
194 Ga0207657_10010761 3300025919 Bacteria 9107
195 Ga0207681_10050830 3300025923 Bacteria 2806
196 Ga0207644_10043161 3300025931 Bacteria 3199
197 Ga0207711_10084304 3300025941 Bacteria 2781
198 Ga0207667_10120728 3300025949 Bacteria 2701
199 Ga0207702_10026584 3300026078 Bacteria 4804
200 Ga0209281_1000596 3300027111 Bacteria 41157
201 Ga0209371_1000037 3300027312 Bacteria 367074
202 Ga0209371_1001945 3300027312 Bacteria 12553
203 Ga0209371_1001958 3300027312 Bacteria 12473
204 Ga0209371_1003326 3300027312 Bacteria 7908
205 Ga0209282_1000267 3300027666 Bacteria 26143
206 Ga0268266_10002491 3300028379 Bacteria 19661
207 Ga0268266_10024394 3300028379 Bacteria 5144
208 Ga0307515_10002407 3300028794 Bacteria 40813
209 Ga0307515_10062307 3300028794 Bacteria 5270
210 Ga0268256_1000039 3300030500 Bacteria 354969
211 Ga0268256_1000890 3300030500 Bacteria 20629
212 Ga0268256_1002013 3300030500 Bacteria 11008
213 Ga0307408_100013679 3300031548 Bacteria 5390
214 Ga0307408_100049810 3300031548 Bacteria 3010
215 Ga0307406_10009164 3300031901 Bacteria 5545
216 Ga0307412_10003953 3300031911 Bacteria 8260
217 Ga0315914_1000965 3300031967 Bacteria 40741
218 Ga0315913_1000276 3300033430 Bacteria 40740
219 Ga0315915_1000499 3300033464 Bacteria 40728
220 Ga0395899_0000442 3300037312 Bacteria 47552
221 Ga0395900_0000643 3300037418 Bacteria 46926
222 Ga0395900_0042129 3300037418 Bacteria 4703
223 Ga0395898_0000914 3300037466 Bacteria 47305
224 Ga0395905_0000621 3300037471 Bacteria 47593
225 Ga0395905_0033508 3300037471 Bacteria 4824
226 Ga0395901_0000466 3300038443 Bacteria 47044
227 Ga0439465_0003615 3300041413 Bacteria 5046
228 Ga0451787_180184 3300041441 Bacteria 2904
229 Ga0451845_0903617 3300041501 Bacteria 2229
230 Ga0439449_0006783 3300042007 Bacteria 4369
231 Ga0466963_0006039 3300044694 Bacteria 7133
232 Ga0466970_0010332 3300044765 Bacteria 4737
233 Ga0451576_0058509 3300045051 Bacteria 4027
234 Ga0495638_0000919 3300046460 Bacteria 30016
235 Ga0495638_0022430 3300046460 Bacteria 4145
236 Ga0495605_0000575 3300046474 Bacteria 29803
237 Ga0495585_0002386 3300046492 Bacteria 13469
238 Ga0495585_0014123 3300046492 Bacteria 4661
239 Ga0495607_0027437 3300046501 Bacteria 3521
240 Ga0495583_0002840 3300046506 Bacteria 14124
241 Ga0495606_0010042 3300046507 Bacteria 7912
242 Ga0495606_0028844 3300046507 Bacteria 3907
243 Ga0495610_0000915 3300046512 Bacteria 27419
244 Ga0495610_0039209 3300046512 Bacteria 2398
245 Ga0495620_0018254 3300046515 Bacteria 3476
246 Ga0495620_0025854 3300046515 Bacteria 2769
247 Ga0495620_0031886 3300046515 Bacteria 2408
248 Ga0495620_0033238 3300046515 Bacteria 2343
249 Ga0495631_0000375 3300046518 Bacteria 30704
250 Ga0495632_0001194 3300046519 Bacteria 22047
251 Ga0495632_0017308 3300046519 Bacteria 3983
252 Ga0495632_0027699 3300046519 Bacteria 2965
253 Ga0495643_0008867 3300046522 Bacteria 6329
254 Ga0495643_0010212 3300046522 Bacteria 5785
255 Ga0495654_0029239 3300046530 Bacteria 2811
256 Ga0495654_0041492 3300046530 Bacteria 2288
257 Ga0495597_0009583 3300046542 Bacteria 4775
258 Ga0495633_0002726 3300046558 Bacteria 12249
259 Ga0495611_0005558 3300046648 Bacteria 5380
260 Ga0495625_0002177 3300046660 Bacteria 21760
261 Ga0495625_0031544 3300046660 Bacteria 3940
262 Ga0495625_0078825 3300046660 Bacteria 2299
263 Ga0495635_0028091 3300046663 Bacteria 3911
264 Ga0495657_0030256 3300046675 Bacteria 3794
265 Ga0495670_0017308 3300046691 Bacteria 3546
266 Ga0495671_0007496 3300046692 Bacteria 6212
267 Ga0495660_0029291 3300046810 Bacteria 3107
268 Ga0495604_0032216 3300047317 Bacteria 4156
269 Ga0495672_0014381 3300047320 Bacteria 5422
270 Ga0495681_0007021 3300047470 Bacteria 7277
271 Ga0495681_0021025 3300047470 Bacteria 3524
272 Ga0495686_0000922 3300047472 Bacteria 36620
273 Ga0495686_0012626 3300047472 Bacteria 5903
274 Ga0496100_0021802 3300048903 Bacteria 3865
275 Ga0496102_0009858 3300048905 Bacteria 8211
276 Ga0496103_0007716 3300048906 Bacteria 6397
277 Ga0496106_0000752 3300048909 Bacteria 23351
278 Ga0496107_0058644 3300048910 Bacteria 2784
279 Ga0496113_0105513 3300048916 Bacteria 2188
280 Ga0496116_0003841 3300048919 Bacteria 14664
281 Ga0496116_0004572 3300048919 Bacteria 13124
282 Ga0496116_0007357 3300048919 Bacteria 9783
283 Ga0496116_0009105 3300048919 Bacteria 8509
284 Ga0496117_0000031 3300048920 Bacteria 381048
285 Ga0496117_0001675 3300048920 Bacteria 30978
286 Ga0496117_0003875 3300048920 Bacteria 17001
287 Ga0496117_0008419 3300048920 Bacteria 9800
288 Ga0496117_0036045 3300048920 Bacteria 3706
289 Ga0496118_0002290 3300048921 Bacteria 26056
290 Ga0496118_0002502 3300048921 Bacteria 24644
291 Ga0496118_0006726 3300048921 Bacteria 12529
292 Ga0496119_0005779 3300048922 Bacteria 11711
293 Ga0496119_0040536 3300048922 Bacteria 2977
294 Ga0496120_0001242 3300048923 Bacteria 32187
295 Ga0496120_0004148 3300048923 Bacteria 12462
296 Ga0496121_0010548 3300048924 Bacteria 10395
297 Ga0496121_0010655 3300048924 Bacteria 10321
298 Ga0496121_0012306 3300048924 Bacteria 9357
299 Ga0496121_0019900 3300048924 Bacteria 6680
300 Ga0496121_0089286 3300048924 Bacteria 2413
301 Ga0496122_0000023 3300048925 Bacteria 381035
302 Ga0496122_0001589 3300048925 Bacteria 35626
303 Ga0496122_0003156 3300048925 Bacteria 22048
304 Ga0496122_0008392 3300048925 Bacteria 11160
305 Ga0496122_0008875 3300048925 Bacteria 10721
306 Ga0496122_0095855 3300048925 Bacteria 2003
307 Ga0496123_0000027 3300048926 Bacteria 306773
308 Ga0496123_0000907 3300048926 Bacteria 46644
309 Ga0496123_0009572 3300048926 Bacteria 8706
310 Ga0496123_0024480 3300048926 Bacteria 4587
311 Ga0496123_0077003 3300048926 Bacteria 2050
312 Ga0496124_0001790 3300048927 Bacteria 29882
313 Ga0496124_0009983 3300048927 Bacteria 9695
314 Ga0496124_0012979 3300048927 Bacteria 8167
315 Ga0496124_0017328 3300048927 Bacteria 6792
316 Ga0496124_0022645 3300048927 Bacteria 5752
317 Ga0496125_0006012 3300048928 Bacteria 13278
318 Ga0496125_0011085 3300048928 Bacteria 9043
319 Ga0496125_0018676 3300048928 Bacteria 6576
320 Ga0496126_0009368 3300048929 Bacteria 10407
321 Ga0496126_0026444 3300048929 Bacteria 5565
322 Ga0495678_021691 3300049459 Bacteria 2823
323 Ga0495678_022114 3300049459 Bacteria 2787
324 Ga0501031_0000010 3300049568 Bacteria 146435
325 Ga0501032_0000023 3300049569 Bacteria 146435
326 Ga0501033_0000308 3300049570 Bacteria 46219
327 Ga0501033_0012519 3300049570 Bacteria 6472
328 Ga0501034_0000116 3300049571 Bacteria 146442
329 Ga0501036_0000015 3300049572 Bacteria 146442
330 Ga0501037_0000023 3300049573 Bacteria 146542
331 Ga0501038_0000025 3300049574 Bacteria 146542
332 Ga0501039_0000037 3300049575 Bacteria 122286
333 Ga0501040_0015279 3300049576 Bacteria 5075
334 Ga0501043_0000449 3300049579 Bacteria 36900
335 Ga0501047_0001418 3300049581 Bacteria 23519
336 Ga0501048_0008445 3300049582 Bacteria 7789
337 Ga0501068_0005219 3300049584 Bacteria 7087
338 Ga0501070_0092693 3300049586 Bacteria 2500
339 Ga0501073_0038904 3300049589 Bacteria 3372
340 Ga0501080_0013827 3300049742 Bacteria 7431
341 Ga0501080_0084552 3300049742 Bacteria 2948
342 Ga0501035_0000074 3300049822 Bacteria 122269
343 Ga0501035_0042415 3300049822 Bacteria 4103
344 Ga0501044_0000069 3300049823 Bacteria 125974
345 Ga0501044_0019326 3300049823 Bacteria 7289
346 nmdc:mga03683_4166_c1 3300050489 Bacteria 4761
347 nmdc:mga00v17_439_c1 3300050491 Bacteria 23341
348 nmdc:mga0yw44_10480_c1 3300050492 Bacteria 4739
349 nmdc:mga0yw44_15201_c1 3300050492 Bacteria 3792
350 nmdc:mga0yw44_9046_c1 3300050492 Bacteria 5008
351 nmdc:mga0sz30_630_c1 3300050516 Bacteria 13067
352 nmdc:mga0sz30_6535_c1 3300050516 Bacteria 4332
353 Ga0500578_0013246 3300053086 Bacteria 5315
354 Ga0500560_002143 3300053107 Bacteria 3690
355 Ga0500594_0001072 3300053118 Bacteria 5859
356 Ga0500618_004840 3300053125 Bacteria 4207
357 Ga0500658_0003797 3300053134 Bacteria 5687
358 Ga0500561_0000846 3300053137 Bacteria 4903
359 Ga0500568_0002293 3300053139 Bacteria 11389
360 Ga0500568_0002590 3300053139 Bacteria 10518
361 Ga0500577_0015354 3300053142 Bacteria 2390
362 Ga0500590_001068 3300053148 Bacteria 10750
363 Ga0500616_0001463 3300053153 Bacteria 22545
364 Ga0500616_0008294 3300053153 Bacteria 6471
365 Ga0500620_000187 3300053155 Bacteria 12757
366 Ga0500624_000456 3300053157 Bacteria 12246
367 Ga0500611_000671 3300053727 Bacteria 3488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2958122699 2958126770 464
2 iso_pu_bacteria 2885350715 2885353578 498
3 iso_pu_bacteria 2657244999 2657682574 511
4 iso_pu_bacteria 2903513507 2903518636 514
5 iso_pu_bacteria 3004195979 3004203587 515
6 iso_pu_bacteria 2958144490 2958150891 519
7 iso_pu_bacteria 2924718760 2924719373 522
8 iso_pu_bacteria 2977915119 2977920343 523
9 iso_pu_bacteria 2871435913 2871441813 526
10 iso_pu_bacteria 2881861095 2881866431 526
11 iso_pu_bacteria 2871466892 2871470688 531
12 iso_pu_bacteria 2508501122 2509109417 548
13 iso_pu_bacteria 2509276019 2509378273 548
14 iso_pu_bacteria 2558860100 2558867243 548
15 3300021321 Ga0214542_1020324 Ga0214542_10203242 552
16 3300021327 Ga0214543_1000053 Ga0214543_100005325 552
17 3300048929 Ga0496126_0009368 Ga0496126_0009368_2605_4530 553
18 3300025295 Ga0209564_1000864 Ga0209564_100086410 554
19 3300046506 Ga0495583_0002840 Ga0495583_0002840_2953_4821 556
20 3300014969 Ga0157376_10111389 Ga0157376_101113892 557
21 3300050492 nmdc:mga0yw44_15201_c1 nmdc:mga0yw44_15201_c1_1473_3401 557
22 3300025206 Ga0209435_100009 Ga0209435_100009370 560
23 3300025246 Ga0209646_1000018 Ga0209646_1000018370 560
24 3300025250 Ga0209026_1000068 Ga0209026_1000068112 560
25 3300025256 Ga0209759_1000007 Ga0209759_1000007370 560
26 3300028794 Ga0307515_10002407 Ga0307515_100024075 560
27 3300002704 JGI25155J39150_1000010 JGI25155J39150_1000010113 561
28 3300002705 JGI25156J39149_1000033 JGI25156J39149_100003371 561
29 3300002738 JGI25154J39366_1000058 JGI25154J39366_100005845 561
30 3300002741 JGI25157J39369_1000009 JGI25157J39369_1000009112 561
31 3300025297 Ga0209758_1013232 Ga0209758_10132322 563
32 3300053107 Ga0500560_002143 Ga0500560_002143_1017_2942 563
33 3300053157 Ga0500624_000456 Ga0500624_000456_9410_11335 563
34 3300003322 rootL2_10209693 rootL2_102096932 564
35 3300003775 Ga0055524_1006596 Ga0055524_10065964 564
36 3300003790 Ga0055528_1001269 Ga0055528_10012697 564
37 3300025273 Ga0209673_1000158 Ga0209673_100015834 564
38 3300025294 Ga0209025_1041347 Ga0209025_10413471 564
39 3300025299 Ga0209256_1001314 Ga0209256_100131427 564
40 3300045051 Ga0451576_0058509 Ga0451576_0058509_403_2307 564
41 3300048920 Ga0496117_0036045 Ga0496117_0036045_1867_3696 564
42 3300003323 rootH1_10020131 rootH1_100201313 565
43 3300002773 JGI25152J39213_1000862 JGI25152J39213_10008629 566
44 3300002774 JGI25150J39212_1000181 JGI25150J39212_100018110 566
45 3300003215 JGI25153J46596_10002624 JGI25153J46596_100026243 566
46 3300025245 Ga0207425_1000034 Ga0207425_1000034214 566
47 3300025258 Ga0209129_1000094 Ga0209129_1000094159 566
48 3300025273 Ga0209673_1006522 Ga0209673_10065223 566
49 3300025294 Ga0209025_1000184 Ga0209025_100018411 566
50 3300025297 Ga0209758_1000159 Ga0209758_100015911 566
51 3300031911 Ga0307412_10003953 Ga0307412_100039534 566
52 3300048916 Ga0496113_0105513 Ga0496113_0105513_159_2024 566
53 3300048919 Ga0496116_0003841 Ga0496116_0003841_12782_14647 566
54 3300048919 Ga0496116_0009105 Ga0496116_0009105_6627_8492 566
55 3300048920 Ga0496117_0008419 Ga0496117_0008419_7043_8908 566
56 3300048924 Ga0496121_0010548 Ga0496121_0010548_7634_9499 566
57 3300048924 Ga0496121_0012306 Ga0496121_0012306_6596_8461 566
58 3300048925 Ga0496122_0003156 Ga0496122_0003156_14023_15888 566
59 3300048925 Ga0496122_0095855 Ga0496122_0095855_86_1951 566
60 3300048926 Ga0496123_0009572 Ga0496123_0009572_6734_8599 566
61 3300048926 Ga0496123_0077003 Ga0496123_0077003_119_1984 566
62 3300048927 Ga0496124_0009983 Ga0496124_0009983_7723_9588 566
63 3300048927 Ga0496124_0012979 Ga0496124_0012979_140_2005 566
64 3300048928 Ga0496125_0006012 Ga0496125_0006012_4450_6315 566
65 3300048929 Ga0496126_0026444 Ga0496126_0026444_1875_3740 566
66 3300046492 Ga0495585_0014123 Ga0495585_0014123_2682_4610 567
67 3300046515 Ga0495620_0033238 Ga0495620_0033238_116_2044 567
68 3300046660 Ga0495625_0078825 Ga0495625_0078825_234_2162 567
69 3300003187 JGI25151J46595_10000081 JGI25151J46595_1000008110 568
70 3300031901 Ga0307406_10009164 Ga0307406_100091643 568
71 3300048919 Ga0496116_0004572 Ga0496116_0004572_3334_5262 568
72 3300048920 Ga0496117_0003875 Ga0496117_0003875_7999_9927 568
73 3300048925 Ga0496122_0008875 Ga0496122_0008875_7817_9745 568
74 3300048927 Ga0496124_0001790 Ga0496124_0001790_20010_21938 568
75 iso_pu_bacteria 2537561587 2537874560 568
76 iso_pu_bacteria 2838675328 2838678761 568
77 iso_pu_bacteria 2838714209 2838718150 568
78 iso_pu_bacteria 2838719591 2838723058 568
79 iso_pu_bacteria 2838724970 2838728217 568
80 iso_pu_bacteria 2841846520 2841850615 568
81 iso_pu_bacteria 2841859092 2841863133 568
82 iso_pu_bacteria 2842124991 2842128875 568
83 iso_pu_bacteria 2842130223 2842133653 568
84 iso_pu_bacteria 2842152218 2842155435 568
85 iso_pu_bacteria 2842170452 2842174608 568
86 iso_pu_bacteria 2842175837 2842179267 568
87 iso_pu_bacteria 2842187318 2842190574 568
88 iso_pu_bacteria 2842211629 2842215102 568
89 iso_pu_bacteria 2842224351 2842227823 568
90 iso_pu_bacteria 2842515876 2842520129 568
91 iso_pu_bacteria 2899792073 2899795232 568
92 iso_pu_bacteria 2919114240 2919118592 568
93 iso_pu_bacteria 2926754445 2926755122 568
94 iso_pu_bacteria 637000159 637074642 568
95 3300003354 JGI25160J50197_1000214 JGI25160J50197_10002146 570
96 3300003374 JGI25161J50226_1000158 JGI25161J50226_100015841 570
97 3300005262 Ga0065165_1000575 Ga0065165_100057548 570
98 3300005548 Ga0070665_100016971 Ga0070665_1000169712 570
99 3300025284 Ga0209130_1000132 Ga0209130_1000132117 570
100 3300025302 Ga0207426_1000246 Ga0207426_1000246117 570
101 3300046663 Ga0495635_0028091 Ga0495635_0028091_896_2824 570
102 3300046675 Ga0495657_0030256 Ga0495657_0030256_1014_2942 570
103 3300047317 Ga0495604_0032216 Ga0495604_0032216_533_2461 570
104 3300047472 Ga0495686_0000922 Ga0495686_0000922_15581_17509 570
105 3300048924 Ga0496121_0019900 Ga0496121_0019900_4713_6641 570
106 3300053148 Ga0500590_001068 Ga0500590_001068_5505_7433 570
107 3300002987 JGI25159J45721_1002742 JGI25159J45721_10027422 571
108 3300003322 rootL2_10055500 rootL2_100555003 571
109 3300004625 Ga0055543_1000099 Ga0055543_10000996 571
110 3300025299 Ga0209256_1000132 Ga0209256_1000132118 571
111 iso_pu_bacteria 2510917026 2511171208 571
112 iso_pu_bacteria 2513237144 2513914772 571
113 iso_pu_bacteria 2513237146 2513929082 571
114 iso_pu_bacteria 2585427633 2585997673 571
115 iso_pu_bacteria 2599185170 2599420259 571
116 iso_pu_bacteria 2919171160 2919175897 571
117 3300009545 Ga0105237_10115551 Ga0105237_101155512 572
118 3300010375 Ga0105239_10095486 Ga0105239_100954862 572
119 3300050516 nmdc:mga0sz30_6535_c1 nmdc:mga0sz30_6535_c1_1388_3397 572
120 iso_pu_bacteria 2534681796 2535518908 572
121 iso_pu_bacteria 2585427594 2585844689 572
122 iso_pu_bacteria 2838035591 2838040466 572
123 iso_pu_bacteria 2909042592 2909043391 572
124 iso_pu_bacteria 3005409236 3005409525 572
125 iso_pu_bacteria 3005445848 3005449541 572
126 3300046519 Ga0495632_0001194 Ga0495632_0001194_9914_11842 573
127 iso_pu_bacteria 2509276021 2509389539 573
128 iso_pu_bacteria 2509276033 2509446047 573
129 iso_pu_bacteria 2510065019 2510135110 573
130 iso_pu_bacteria 2510461076 2510896534 573
131 iso_pu_bacteria 2510917022 2511132031 573
132 iso_pu_bacteria 2513237084 2513571479 573
133 iso_pu_bacteria 2513237085 2513580677 573
134 iso_pu_bacteria 2513237093 2513630320 573
135 iso_pu_bacteria 2513237103 2513713070 573
136 iso_pu_bacteria 2513237162 2514023890 573
137 iso_pu_bacteria 2515075009 2515114263 573
138 iso_pu_bacteria 2515154113 2515639149 573
139 iso_pu_bacteria 2515154114 2515646427 573
140 iso_pu_bacteria 2515154116 2515662042 573
141 iso_pu_bacteria 2515154134 2515741426 573
142 iso_pu_bacteria 2516653077 2517037880 573
143 iso_pu_bacteria 2516653085 2517078146 573
144 iso_pu_bacteria 2517093000 2517096915 573
145 iso_pu_bacteria 2517287029 2517408668 573
146 iso_pu_bacteria 2524023209 2524458349 573
147 iso_pu_bacteria 2551306090 2551719968 573
148 iso_pu_bacteria 2582581299 2585233804 573
149 iso_pu_bacteria 2582581304 2585257471 573
150 iso_pu_bacteria 2582581307 2585271543 573
151 iso_pu_bacteria 2585427526 2585526208 573
152 iso_pu_bacteria 2585427528 2585540639 573
153 iso_pu_bacteria 2585427531 2585563217 573
154 iso_pu_bacteria 2585427593 2585838908 573
155 iso_pu_bacteria 2585427608 2585902733 573
156 iso_pu_bacteria 2585427609 2585907435 573
157 iso_pu_bacteria 2585428125 2587982571 573
158 iso_pu_bacteria 2615840624 2616296428 573
159 iso_pu_bacteria 2643221634 2644195236 573
160 iso_pu_bacteria 2718217882 2719182848 573
161 iso_pu_bacteria 2718217927 2719387542 573
162 iso_pu_bacteria 2718217997 2719667187 573
163 iso_pu_bacteria 2718218009 2719733565 573
164 iso_pu_bacteria 2718218199 2720493607 573
165 iso_pu_bacteria 2718218232 2720615063 573
166 iso_pu_bacteria 2718218233 2720621856 573
167 iso_pu_bacteria 2718218235 2720633206 573
168 iso_pu_bacteria 2718218269 2720776903 573
169 iso_pu_bacteria 2718218363 2721148960 573
170 iso_pu_bacteria 2718218365 2721160358 573
171 iso_pu_bacteria 2718218366 2721165773 573
172 iso_pu_bacteria 2718218423 2721401176 573
173 iso_pu_bacteria 2721755514 2722841943 573
174 iso_pu_bacteria 2721755556 2723028503 573
175 iso_pu_bacteria 2721755684 2723562107 573
176 iso_pu_bacteria 2721755685 2723568809 573
177 iso_pu_bacteria 2721755809 2724039990 573
178 iso_pu_bacteria 2721755810 2724046321 573
179 iso_pu_bacteria 2721755819 2724091510 573
180 iso_pu_bacteria 2721755822 2724106074 573
181 iso_pu_bacteria 2721755823 2724111879 573
182 iso_pu_bacteria 2724679232 2725947365 573
183 iso_pu_bacteria 2728369352 2730109439 573
184 iso_pu_bacteria 2728369365 2730166083 573
185 iso_pu_bacteria 2728369397 2730299990 573
186 iso_pu_bacteria 2738541333 2739037127 573
187 iso_pu_bacteria 2751185821 2753459102 573
188 iso_pu_bacteria 2765235942 2766062638 573
189 iso_pu_bacteria 2791355256 2793295748 573
190 iso_pu_bacteria 2791355259 2793313523 573
191 iso_pu_bacteria 2791355260 2793320597 573
192 iso_pu_bacteria 2791355261 2793331031 573
193 iso_pu_bacteria 2791355262 2793332115 573
194 iso_pu_bacteria 2791355263 2793338683 573
195 iso_pu_bacteria 2791355264 2793346485 573
196 iso_pu_bacteria 2791355265 2793353991 573
197 iso_pu_bacteria 2791355266 2793359514 573
198 iso_pu_bacteria 2791355267 2793365772 573
199 iso_pu_bacteria 2802429606 2805937043 573
200 iso_pu_bacteria 2802429633 2806047218 573
201 iso_pu_bacteria 2802429634 2806054082 573
202 iso_pu_bacteria 2802429635 2806060334 573
203 iso_pu_bacteria 2802429636 2806068954 573
204 iso_pu_bacteria 2802429637 2806077103 573
205 iso_pu_bacteria 2842298080 2842300395 573
206 iso_pu_bacteria 2842357229 2842361088 573
207 iso_pu_bacteria 2842482326 2842488009 573
208 iso_pu_bacteria 2842509118 2842511827 573
209 iso_pu_bacteria 2852387548 2852391570 573
210 iso_pu_bacteria 8057575449 8057581485 573
211 iso_pu_bacteria 2510917028 2511184825 574
212 iso_pu_bacteria 2510917030 2511198181 574
213 iso_pu_bacteria 2513237088 2513598096 574
214 iso_pu_bacteria 2513237138 2513868396 574
215 iso_pu_bacteria 2529292951 2530647465 574
216 iso_pu_bacteria 2582581294 2585201848 574
217 iso_pu_bacteria 2582581298 2585223809 574
218 iso_pu_bacteria 2582581867 2585399641 574
219 iso_pu_bacteria 2585427529 2585549032 574
220 iso_pu_bacteria 2585427590 2585820728 574
221 iso_pu_bacteria 2615840698 2616557700 574
222 iso_pu_bacteria 2617270742 2617384952 574
223 iso_pu_bacteria 2643221643 2644240606 574
224 iso_pu_bacteria 2667528174 2671113593 574
225 iso_pu_bacteria 2738541293 2738803919 574
226 iso_pu_bacteria 2775507266 2778173640 574
227 iso_pu_bacteria 2802429605 2805926094 574
228 iso_pu_bacteria 2818991448 2819611129 574
229 iso_pu_bacteria 2838016132 2838018457 574
230 iso_pu_bacteria 2838022645 2838024136 574
231 iso_pu_bacteria 2838029111 2838030817 574
232 iso_pu_bacteria 2838042994 2838048349 574
233 iso_pu_bacteria 2838048938 2838053693 574
234 iso_pu_bacteria 2838061910 2838062449 574
235 iso_pu_bacteria 2838068647 2838072000 574
236 iso_pu_bacteria 2838668709 2838672937 574
237 iso_pu_bacteria 2838680041 2838684013 574
238 iso_pu_bacteria 2838686498 2838690112 574
239 iso_pu_bacteria 2838694306 2838698542 574
240 iso_pu_bacteria 2838701080 2838705585 574
241 iso_pu_bacteria 2838707686 2838711657 574
242 iso_pu_bacteria 2838729681 2838731887 574
243 iso_pu_bacteria 2838742623 2838744783 574
244 iso_pu_bacteria 2841851746 2841857910 574
245 iso_pu_bacteria 2841864319 2841867891 574
246 iso_pu_bacteria 2842077413 2842081458 574
247 iso_pu_bacteria 2842110456 2842116290 574
248 iso_pu_bacteria 2842118031 2842121765 574
249 iso_pu_bacteria 2842146304 2842149915 574
250 iso_pu_bacteria 2842156927 2842161010 574
251 iso_pu_bacteria 2842163707 2842166528 574
252 iso_pu_bacteria 2842180545 2842184626 574
253 iso_pu_bacteria 2842192696 2842195006 574
254 iso_pu_bacteria 2842198810 2842201730 574
255 iso_pu_bacteria 2842205361 2842207287 574
256 iso_pu_bacteria 2842217011 2842223414 574
257 iso_pu_bacteria 2842229732 2842232209 574
258 iso_pu_bacteria 2842237096 2842240780 574
259 iso_pu_bacteria 2842243621 2842246624 574
260 iso_pu_bacteria 2842250916 2842255265 574
261 iso_pu_bacteria 2842257432 2842261274 574
262 iso_pu_bacteria 2842264693 2842269035 574
263 iso_pu_bacteria 2842271015 2842274132 574
264 iso_pu_bacteria 2842278818 2842281002 574
265 iso_pu_bacteria 2842285085 2842288385 574
266 iso_pu_bacteria 2842291075 2842295115 574
267 iso_pu_bacteria 2842304105 2842306009 574
268 iso_pu_bacteria 2842311132 2842311287 574
269 iso_pu_bacteria 2842317721 2842320988 574
270 iso_pu_bacteria 2842341865 2842346713 574
271 iso_pu_bacteria 2842363717 2842366395 574
272 iso_pu_bacteria 2842370503 2842374867 574
273 iso_pu_bacteria 2842377471 2842381514 574
274 iso_pu_bacteria 2842384541 2842388584 574
275 iso_pu_bacteria 2842395702 2842396080 574
276 iso_pu_bacteria 2842402390 2842406269 574
277 iso_pu_bacteria 2842409023 2842412854 574
278 iso_pu_bacteria 2842415677 2842419267 574
279 iso_pu_bacteria 2842422224 2842425632 574
280 iso_pu_bacteria 2842428310 2842433272 574
281 iso_pu_bacteria 2842434925 2842439698 574
282 iso_pu_bacteria 2842441272 2842446223 574
283 iso_pu_bacteria 2842447887 2842448904 574
284 iso_pu_bacteria 2842462802 2842467418 574
285 iso_pu_bacteria 2842469257 2842474087 574
286 iso_pu_bacteria 2842475841 2842477549 574
287 iso_pu_bacteria 2842489311 2842491040 574
288 iso_pu_bacteria 2842495871 2842498378 574
289 iso_pu_bacteria 2842502639 2842504578 574
290 iso_pu_bacteria 2844454524 2844457190 574
291 iso_pu_bacteria 2857516855 2857521131 574
292 iso_pu_bacteria 2919100787 2919105269 574
293 iso_pu_bacteria 2919408235 2919410950 574
294 iso_pu_bacteria 2923556063 2923559601 574
295 iso_pu_bacteria 2933570622 2933572513 574
296 iso_pu_bacteria 2933586486 2933592507 574
297 iso_pu_bacteria 2933599457 2933603146 574
298 iso_pu_bacteria 2935894831 2935897809 574
299 iso_pu_bacteria 2935901341 2935903800 574
300 iso_pu_bacteria 2936367885 2936369748 574
301 iso_pu_bacteria 2936375103 2936378937 574
302 iso_pu_bacteria 2936381700 2936385846 574
303 iso_pu_bacteria 2996887358 2996890130 574
304 iso_pu_bacteria 2996893221 2996895163 574
305 iso_pu_bacteria 3005416602 3005421748 574
306 iso_pu_bacteria 8005258706 8005262314 574
307 iso_pu_bacteria 8005275841 8005282295 574
308 iso_pu_bacteria 8005282627 8005286873 574
309 iso_pu_bacteria 8005289223 8005294957 574
310 iso_pu_bacteria 8005301065 8005305843 574
311 iso_pu_bacteria 8005307578 8005313533 574
312 iso_pu_bacteria 8005314921 8005319552 574
313 iso_pu_bacteria 8005321885 8005324657 574
314 iso_pu_bacteria 8005376324 8005381707 574
315 iso_pu_bacteria 8005382845 8005387893 574
316 iso_pu_bacteria 8005395548 8005400931 574
317 iso_pu_bacteria 8005430974 8005433709 574
318 iso_pu_bacteria 8005460587 8005464955 574
319 iso_pu_bacteria 8005484373 8005490181 574
320 iso_pu_bacteria 8005497431 8005497549 574
321 iso_pu_bacteria 8005556819 8005560996 574
322 iso_pu_bacteria 8005563573 8005565621 574
323 iso_pu_bacteria 8005570704 8005571102 574
324 iso_pu_bacteria 8005619151 8005623282 574
325 iso_pu_bacteria 8005626139 8005631138 574
326 iso_pu_bacteria 8005645114 8005646839 574
327 iso_pu_bacteria 8005668836 8005668954 574
328 iso_pu_bacteria 8005682033 8005687579 574
329 iso_pu_bacteria 8005688590 8005694459 574
330 iso_pu_bacteria 8005695170 8005695597 574
331 iso_pu_bacteria 8018127388 8018128792 574
332 iso_pu_bacteria 8018163183 8018165268 574
333 iso_pu_bacteria 8018176218 8018177024 574
334 iso_pu_bacteria 8023680758 8023686371 574
335 iso_pu_bacteria 8024479707 8024484228 574
336 iso_pu_bacteria 8024501048 8024502449 574
337 iso_pu_bacteria 8046767195 8046768154 574
338 iso_pu_bacteria 8056375014 8056378477 574
339 iso_pu_bacteria 8056382006 8056383929 574
340 iso_pu_bacteria 8057874678 8057879118 574
341 3300002737 JGI25162J39368_1000410 JGI25162J39368_10004104 575
342 3300002741 JGI25157J39369_1002473 JGI25157J39369_10024732 575
343 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015221 575
344 3300003214 JGI25165J46597_1000881 JGI25165J46597_10008819 575
345 3300003323 rootH1_10043274 rootH1_100432741 575
346 3300003856 Ga0058692_1012274 Ga0058692_10122741 575
347 3300005356 Ga0070674_100061468 Ga0070674_1000614682 575
348 3300005539 Ga0068853_100055808 Ga0068853_1000558082 575
349 3300005548 Ga0070665_100035216 Ga0070665_1000352162 575
350 3300005563 Ga0068855_100069939 Ga0068855_1000699395 575
351 3300005937 Ga0081455_10043625 Ga0081455_100436252 575
352 3300006038 Ga0075365_10005010 Ga0075365_100050102 575
353 3300006051 Ga0075364_10073195 Ga0075364_100731952 575
354 3300009093 Ga0105240_10000013 Ga0105240_10000013100 575
355 3300009545 Ga0105237_10018090 Ga0105237_100180902 575
356 3300009551 Ga0105238_10018737 Ga0105238_100187372 575
357 3300009551 Ga0105238_10155193 Ga0105238_101551931 575
358 3300010375 Ga0105239_10009509 Ga0105239_100095092 575
359 3300013104 Ga0157370_10000209 Ga0157370_1000020950 575
360 3300014497 Ga0182008_10017975 Ga0182008_100179752 575
361 3300015262 Ga0182007_10001441 Ga0182007_100014416 575
362 3300025233 Ga0209437_100107 Ga0209437_10010760 575
363 3300025250 Ga0209026_1000025 Ga0209026_100002592 575
364 3300025253 Ga0209677_100812 Ga0209677_1008124 575
365 3300025254 Ga0209148_1000181 Ga0209148_100018152 575
366 3300025256 Ga0209759_1000226 Ga0209759_10002269 575
367 3300025261 Ga0209233_1000010 Ga0209233_1000010319 575
368 3300025261 Ga0209233_1000072 Ga0209233_1000072109 575
369 3300025261 Ga0209233_1000440 Ga0209233_100044014 575
370 3300025272 Ga0209455_1000127 Ga0209455_100012752 575
371 3300025292 Ga0209676_1007477 Ga0209676_10074772 575
372 3300025297 Ga0209758_1000323 Ga0209758_100032338 575
373 3300025298 Ga0209050_1006084 Ga0209050_10060842 575
374 3300025303 Ga0209051_1001273 Ga0209051_10012736 575
375 3300025304 Ga0209257_1004072 Ga0209257_10040724 575
376 3300025904 Ga0207647_10002170 Ga0207647_100021706 575
377 3300025913 Ga0207695_10000044 Ga0207695_1000004457 575
378 3300025914 Ga0207671_10000226 Ga0207671_1000022678 575
379 3300025914 Ga0207671_10018871 Ga0207671_100188712 575
380 3300025919 Ga0207657_10010761 Ga0207657_100107612 575
381 3300025949 Ga0207667_10120728 Ga0207667_101207282 575
382 3300027312 Ga0209371_1003326 Ga0209371_10033262 575
383 3300028379 Ga0268266_10024394 Ga0268266_100243943 575
384 3300030500 Ga0268256_1000890 Ga0268256_10008902 575
385 3300037312 Ga0395899_0000442 Ga0395899_0000442_17272_19203 575
386 3300037418 Ga0395900_0000643 Ga0395900_0000643_16646_18577 575
387 3300037418 Ga0395900_0042129 Ga0395900_0042129_1269_3197 575
388 3300037466 Ga0395898_0000914 Ga0395898_0000914_17025_18956 575
389 3300037471 Ga0395905_0000621 Ga0395905_0000621_16576_18507 575
390 3300037471 Ga0395905_0033508 Ga0395905_0033508_1183_3111 575
391 3300038443 Ga0395901_0000466 Ga0395901_0000466_16764_18695 575
392 3300041413 Ga0439465_0003615 Ga0439465_0003615_215_2077 575
393 3300044694 Ga0466963_0006039 Ga0466963_0006039_3178_5103 575
394 3300044765 Ga0466970_0010332 Ga0466970_0010332_1804_3729 575
395 3300046512 Ga0495610_0039209 Ga0495610_0039209_45_1973 575
396 3300048903 Ga0496100_0021802 Ga0496100_0021802_857_2782 575
397 3300048905 Ga0496102_0009858 Ga0496102_0009858_3652_5577 575
398 3300048906 Ga0496103_0007716 Ga0496103_0007716_3386_5311 575
399 3300048910 Ga0496107_0058644 Ga0496107_0058644_307_2232 575
400 3300048920 Ga0496117_0001675 Ga0496117_0001675_9468_11393 575
401 3300048921 Ga0496118_0002290 Ga0496118_0002290_11162_13087 575
402 3300048922 Ga0496119_0005779 Ga0496119_0005779_6767_8692 575
403 3300048922 Ga0496119_0040536 Ga0496119_0040536_983_2911 575
404 3300048923 Ga0496120_0001242 Ga0496120_0001242_3590_5518 575
405 3300048924 Ga0496121_0010655 Ga0496121_0010655_165_2090 575
406 3300048927 Ga0496124_0022645 Ga0496124_0022645_1832_3757 575
407 3300048928 Ga0496125_0018676 Ga0496125_0018676_3675_5600 575
408 3300049568 Ga0501031_0000010 Ga0501031_0000010_29155_31083 575
409 3300049569 Ga0501032_0000023 Ga0501032_0000023_115353_117281 575
410 3300049570 Ga0501033_0000308 Ga0501033_0000308_14164_16092 575
411 3300049570 Ga0501033_0012519 Ga0501033_0012519_3726_5609 575
412 3300049571 Ga0501034_0000116 Ga0501034_0000116_29162_31090 575
413 3300049572 Ga0501036_0000015 Ga0501036_0000015_29162_31090 575
414 3300049573 Ga0501037_0000023 Ga0501037_0000023_29262_31190 575
415 3300049574 Ga0501038_0000025 Ga0501038_0000025_29262_31190 575
416 3300049575 Ga0501039_0000037 Ga0501039_0000037_29162_31090 575
417 3300049576 Ga0501040_0015279 Ga0501040_0015279_3053_4951 575
418 3300049579 Ga0501043_0000449 Ga0501043_0000449_25558_27486 575
419 3300049581 Ga0501047_0001418 Ga0501047_0001418_8711_10639 575
420 3300049582 Ga0501048_0008445 Ga0501048_0008445_2643_4526 575
421 3300049584 Ga0501068_0005219 Ga0501068_0005219_1855_3738 575
422 3300049586 Ga0501070_0092693 Ga0501070_0092693_355_2283 575
423 3300049589 Ga0501073_0038904 Ga0501073_0038904_973_2856 575
424 3300049742 Ga0501080_0013827 Ga0501080_0013827_1947_3830 575
425 3300049822 Ga0501035_0000074 Ga0501035_0000074_29143_31071 575
426 3300049822 Ga0501035_0042415 Ga0501035_0042415_933_2816 575
427 3300049823 Ga0501044_0000069 Ga0501044_0000069_94885_96813 575
428 3300049823 Ga0501044_0019326 Ga0501044_0019326_933_2816 575
429 3300053155 Ga0500620_000187 Ga0500620_000187_549_2477 575
430 3300053727 Ga0500611_000671 Ga0500611_000671_1034_2962 575
431 iso_pu_bacteria 2503198000 2503201488 575
432 iso_pu_bacteria 2508501123 2509113094 575
433 iso_pu_bacteria 2508501127 2509143932 575
434 iso_pu_bacteria 2509276022 2509396268 575
435 iso_pu_bacteria 2512875016 2512931542 575
436 iso_pu_bacteria 2512875024 2512959374 575
437 iso_pu_bacteria 2513237090 2513611333 575
438 iso_pu_bacteria 2513237164 2514033569 575
439 iso_pu_bacteria 2513237305 2514419705 575
440 iso_pu_bacteria 2588253730 2588517380 575
441 iso_pu_bacteria 2597489875 2597813268 575
442 iso_pu_bacteria 2599185301 2599936790 575
443 iso_pu_bacteria 2643221550 2643771139 575
444 iso_pu_bacteria 2643221564 2643839991 575
445 iso_pu_bacteria 2643221595 2643984353 575
446 iso_pu_bacteria 2643221627 2644153210 575
447 iso_pu_bacteria 2643221637 2644209350 575
448 iso_pu_bacteria 2643221718 2644652878 575
449 iso_pu_bacteria 2687453392 2688598402 575
450 iso_pu_bacteria 2693429783 2694631035 575
451 iso_pu_bacteria 2693429784 2694636467 575
452 iso_pu_bacteria 2721755686 2723575338 575
453 iso_pu_bacteria 2756170246 2756675516 575
454 iso_pu_bacteria 2791355123 2792752748 575
455 iso_pu_bacteria 2841734538 2841739159 575
456 iso_pu_bacteria 2844002411 2844007474 575
457 iso_pu_bacteria 2844009547 2844013657 575
458 iso_pu_bacteria 2847670302 2847675575 575
459 iso_pu_bacteria 2847686936 2847692216 575
460 iso_pu_bacteria 2856314179 2856319461 575
461 iso_pu_bacteria 2856320880 2856327523 575
462 iso_pu_bacteria 2856328259 2856334521 575
463 iso_pu_bacteria 2856334872 2856340357 575
464 iso_pu_bacteria 2856342000 2856343886 575
465 iso_pu_bacteria 2856364286 2856369418 575
466 iso_pu_bacteria 2857349434 2857351190 575
467 iso_pu_bacteria 2857367948 2857370300 575
468 iso_pu_bacteria 2869162929 2869168235 575
469 iso_pu_bacteria 2869234852 2869238912 575
470 iso_pu_bacteria 2869249662 2869253945 575
471 iso_pu_bacteria 2869256925 2869260791 575
472 iso_pu_bacteria 2869264136 2869269419 575
473 iso_pu_bacteria 2869271264 2869271829 575
474 iso_pu_bacteria 2869278585 2869280412 575
475 iso_pu_bacteria 2869285874 2869286509 575
476 iso_pu_bacteria 2871429161 2871434662 575
477 iso_pu_bacteria 2871444079 2871448223 575
478 iso_pu_bacteria 2871451962 2871459218 575
479 iso_pu_bacteria 2871459585 2871463871 575
480 iso_pu_bacteria 2871481445 2871484046 575
481 iso_pu_bacteria 2871488783 2871494583 575
482 iso_pu_bacteria 2871495908 2871501437 575
483 iso_pu_bacteria 2874102143 2874109180 575
484 iso_pu_bacteria 2874109183 2874112278 575
485 iso_pu_bacteria 2874131515 2874136515 575
486 iso_pu_bacteria 2874139085 2874144176 575
487 iso_pu_bacteria 2874146452 2874149867 575
488 iso_pu_bacteria 2874155637 2874158125 575
489 iso_pu_bacteria 2874162495 2874164468 575
490 iso_pu_bacteria 2876363079 2876368524 575
491 iso_pu_bacteria 2876369609 2876376775 575
492 iso_pu_bacteria 2876386047 2876387017 575
493 iso_pu_bacteria 2876392853 2876398400 575
494 iso_pu_bacteria 2876399893 2876403685 575
495 iso_pu_bacteria 2876406927 2876412871 575
496 iso_pu_bacteria 2876413966 2876416329 575
497 iso_pu_bacteria 2876420981 2876424990 575
498 iso_pu_bacteria 2878035449 2878040695 575
499 iso_pu_bacteria 2878738818 2878745171 575
500 iso_pu_bacteria 2878745973 2878751795 575
501 iso_pu_bacteria 2878753008 2878758835 575
502 iso_pu_bacteria 2878760144 2878765417 575
503 iso_pu_bacteria 2878767105 2878773125 575
504 iso_pu_bacteria 2878774303 2878776004 575
505 iso_pu_bacteria 2878781027 2878786830 575
506 iso_pu_bacteria 2881147464 2881151290 575
507 iso_pu_bacteria 2881155292 2881161763 575
508 iso_pu_bacteria 2881161766 2881167490 575
509 iso_pu_bacteria 2881845957 2881846845 575
510 iso_pu_bacteria 2881853255 2881855138 575
511 iso_pu_bacteria 2882632389 2882636232 575
512 iso_pu_bacteria 2882912400 2882916064 575
513 iso_pu_bacteria 2885305155 2885309389 575
514 iso_pu_bacteria 2885312484 2885318024 575
515 iso_pu_bacteria 2885318864 2885322571 575
516 iso_pu_bacteria 2885326080 2885327670 575
517 iso_pu_bacteria 2885334103 2885339849 575
518 iso_pu_bacteria 2888337043 2888339382 575
519 iso_pu_bacteria 2888343758 2888346758 575
520 iso_pu_bacteria 2888350351 2888355719 575
521 iso_pu_bacteria 2889010040 2889010656 575
522 iso_pu_bacteria 2889016732 2889017645 575
523 iso_pu_bacteria 2903448605 2903451270 575
524 iso_pu_bacteria 2903492973 2903503926 575
525 iso_pu_bacteria 2903492973 2903504741 575
526 iso_pu_bacteria 2903521522 2903527523 575
527 iso_pu_bacteria 2903528002 2903533977 575
528 iso_pu_bacteria 2903540706 2903546248 575
529 iso_pu_bacteria 2904659560 2904664955 575
530 iso_pu_bacteria 2906308376 2906314193 575
531 iso_pu_bacteria 2906321335 2906327359 575
532 iso_pu_bacteria 2906328253 2906330049 575
533 iso_pu_bacteria 2906363423 2906363729 575
534 iso_pu_bacteria 2906370794 2906375020 575
535 iso_pu_bacteria 2906386501 2906388251 575
536 iso_pu_bacteria 2906401398 2906403794 575
537 iso_pu_bacteria 2906408224 2906408860 575
538 iso_pu_bacteria 2906414383 2906420181 575
539 iso_pu_bacteria 2922130491 2922137203 575
540 iso_pu_bacteria 2922151315 2922154025 575
541 iso_pu_bacteria 2922158528 2922161171 575
542 iso_pu_bacteria 2922172374 2922176178 575
543 iso_pu_bacteria 2924726620 2924733246 575
544 iso_pu_bacteria 2924733363 2924735899 575
545 iso_pu_bacteria 2924741084 2924742584 575
546 iso_pu_bacteria 2924748358 2924750298 575
547 iso_pu_bacteria 2924754689 2924757343 575
548 iso_pu_bacteria 2924762789 2924764296 575
549 iso_pu_bacteria 2924776078 2924783308 575
550 iso_pu_bacteria 2924784321 2924789037 575
551 iso_pu_bacteria 2937813078 2937815697 575
552 iso_pu_bacteria 2937822353 2937824410 575
553 iso_pu_bacteria 2937836603 2937839346 575
554 iso_pu_bacteria 2937848649 2937851865 575
555 iso_pu_bacteria 2937861824 2937867939 575
556 iso_pu_bacteria 2937877337 2937882165 575
557 iso_pu_bacteria 2937891427 2937893460 575
558 iso_pu_bacteria 2937972304 2937978626 575
559 iso_pu_bacteria 2937980651 2937986016 575
560 iso_pu_bacteria 2937994558 2938000106 575
561 iso_pu_bacteria 2938014810 2938019741 575
562 iso_pu_bacteria 2958034702 2958036282 575
563 iso_pu_bacteria 2958041894 2958045646 575
564 iso_pu_bacteria 2958064165 2958064414 575
565 iso_pu_bacteria 2958071322 2958072083 575
566 iso_pu_bacteria 2958084443 2958089287 575
567 iso_pu_bacteria 2958092219 2958093033 575
568 iso_pu_bacteria 2958100919 2958102082 575
569 iso_pu_bacteria 2958115193 2958118418 575
570 iso_pu_bacteria 2958130278 2958130912 575
571 iso_pu_bacteria 2958137437 2958142341 575
572 iso_pu_bacteria 2958158011 2958160174 575
573 iso_pu_bacteria 2958165035 2958170570 575
574 iso_pu_bacteria 2958172287 2958177052 575
575 iso_pu_bacteria 2958179912 2958184833 575
576 iso_pu_bacteria 2961077736 2961083000 575
577 iso_pu_bacteria 2961114664 2961119954 575
578 iso_pu_bacteria 2961136820 2961143660 575
579 iso_pu_bacteria 2961163497 2961169025 575
580 iso_pu_bacteria 2961170736 2961176087 575
581 iso_pu_bacteria 2961183825 2961184316 575
582 iso_pu_bacteria 2963644680 2963647669 575
583 iso_pu_bacteria 2965018300 2965024312 575
584 iso_pu_bacteria 2965025482 2965031798 575
585 iso_pu_bacteria 2965032056 2965037838 575
586 iso_pu_bacteria 2965040258 2965044694 575
587 iso_pu_bacteria 2965047637 2965052876 575
588 iso_pu_bacteria 2965062239 2965066868 575
589 iso_pu_bacteria 2965089291 2965093814 575
590 iso_pu_bacteria 2965102966 2965103914 575
591 iso_pu_bacteria 2965110997 2965116651 575
592 iso_pu_bacteria 2965119406 2965123710 575
593 iso_pu_bacteria 2967996073 2968001974 575
594 iso_pu_bacteria 2968003550 2968009002 575
595 iso_pu_bacteria 2968016561 2968018493 575
596 iso_pu_bacteria 2968083720 2968090300 575
597 iso_pu_bacteria 2968091066 2968096326 575
598 iso_pu_bacteria 2968097103 2968098825 575
599 iso_pu_bacteria 2968110612 2968116311 575
600 iso_pu_bacteria 2968117919 2968120592 575
601 iso_pu_bacteria 2968128360 2968129146 575
602 iso_pu_bacteria 2968138860 2968145571 575
603 iso_pu_bacteria 2968171901 2968177419 575
604 iso_pu_bacteria 2970469710 2970471334 575
605 iso_pu_bacteria 2970489779 2970492927 575
606 iso_pu_bacteria 2970503327 2970508753 575
607 iso_pu_bacteria 2970510686 2970515549 575
608 iso_pu_bacteria 2970524798 2970525162 575
609 iso_pu_bacteria 2970524798 2970528540 575
610 iso_pu_bacteria 2970547951 2970548962 575
611 iso_pu_bacteria 2970554993 2970560265 575
612 iso_pu_bacteria 2970593180 2970595009 575
613 iso_pu_bacteria 2970619444 2970622163 575
614 iso_pu_bacteria 2970627176 2970628090 575
615 iso_pu_bacteria 2977821940 2977827375 575
616 iso_pu_bacteria 2977828996 2977834989 575
617 iso_pu_bacteria 2977843712 2977845933 575
618 iso_pu_bacteria 2977851361 2977858072 575
619 iso_pu_bacteria 2977858184 2977860521 575
620 iso_pu_bacteria 2977864932 2977867124 575
621 iso_pu_bacteria 2977872689 2977875775 575
622 iso_pu_bacteria 2977907340 2977912213 575
623 iso_pu_bacteria 2977922695 2977924177 575
624 iso_pu_bacteria 2977935797 2977936059 575
625 iso_pu_bacteria 2977942078 2977942711 575
626 iso_pu_bacteria 2977950692 2977954886 575
627 iso_pu_bacteria 2977957713 2977961486 575
628 iso_pu_bacteria 2977971508 2977974271 575
629 iso_pu_bacteria 2977986579 2977989880 575
630 iso_pu_bacteria 2979710463 2979713622 575
631 iso_pu_bacteria 2979764755 2979767720 575
632 iso_pu_bacteria 2979772303 2979778942 575
633 iso_pu_bacteria 2979779861 2979785535 575
634 iso_pu_bacteria 2979793036 2979797801 575
635 iso_pu_bacteria 2979808191 2979811599 575
636 iso_pu_bacteria 2987636660 2987638374 575
637 iso_pu_bacteria 2987645492 2987649898 575
638 iso_pu_bacteria 2987652177 2987653502 575
639 iso_pu_bacteria 2987659509 2987665056 575
640 iso_pu_bacteria 2987666974 2987667983 575
641 iso_pu_bacteria 2987673487 2987677126 575
642 iso_pu_bacteria 2996341866 2996342521 575
643 iso_pu_bacteria 2996348954 2996350126 575
644 iso_pu_bacteria 2996386984 2996392368 575
645 iso_pu_bacteria 3000135777 3000140704 575
646 iso_pu_bacteria 3004167301 3004168849 575
647 iso_pu_bacteria 3004188549 3004194113 575
648 iso_pu_bacteria 3004203850 3004205382 575
649 iso_pu_bacteria 3004211236 3004215911 575
650 iso_pu_bacteria 3004218560 3004221923 575
651 iso_pu_bacteria 3004232784 3004236334 575
652 iso_pu_bacteria 3004268573 3004274896 575
653 iso_pu_bacteria 3004275668 3004276825 575
654 iso_pu_bacteria 3004289098 3004295785 575
655 iso_pu_bacteria 3004334049 3004334404 575
656 iso_pu_bacteria 649633066 649872929 575
657 iso_pu_bacteria 8004300914 8004305013 575
658 iso_pu_bacteria 8004312739 8004316336 575
659 iso_pu_bacteria 8004361976 8004366636 575
660 iso_pu_bacteria 8004374579 8004380356 575
661 iso_pu_bacteria 8004387939 8004393683 575
662 iso_pu_bacteria 8004445564 8004447037 575
663 iso_pu_bacteria 8004633249 8004639553 575
664 iso_pu_bacteria 8004640170 8004640864 575
665 iso_pu_bacteria 8004695233 8004700132 575
666 iso_pu_bacteria 8004703790 8004709320 575
667 iso_pu_bacteria 8004714634 8004720451 575
668 iso_pu_bacteria 8004727605 8004731901 575
669 iso_pu_bacteria 8055617313 8055620736 575
670 iso_pu_bacteria 8055617313 8055623962 575
671 3300003187 JGI25151J46595_10007312 JGI25151J46595_100073124 576
672 3300025258 Ga0209129_1000118 Ga0209129_1000118133 576
673 3300025294 Ga0209025_1000617 Ga0209025_100061716 576
674 3300027312 Ga0209371_1000037 Ga0209371_100003760 576
675 3300030500 Ga0268256_1000039 Ga0268256_1000039249 576
676 3300031548 Ga0307408_100013679 Ga0307408_1000136791 576
677 3300031548 Ga0307408_100049810 Ga0307408_1000498103 576
678 3300046660 Ga0495625_0031544 Ga0495625_0031544_1988_3898 576
679 3300048924 Ga0496121_0089286 Ga0496121_0089286_483_2348 576
680 iso_pu_bacteria 2513237159 2513998622 576
681 iso_pu_bacteria 2582581283 2585166856 576
682 iso_pu_bacteria 2582581306 2585266789 576
683 iso_pu_bacteria 2582581865 2585387830 576
684 iso_pu_bacteria 2582581866 2585395927 576
685 iso_pu_bacteria 2643221607 2644051908 576
686 iso_pu_bacteria 2643221636 2644201536 576
687 iso_pu_bacteria 2643221686 2644484360 576
688 iso_pu_bacteria 2643221688 2644492379 576
689 iso_pu_bacteria 2643221689 2644499911 576
690 iso_pu_bacteria 2791355082 2792582073 576
691 iso_pu_bacteria 2818991461 2819687118 576
692 iso_pu_bacteria 2838661181 2838667881 576
693 iso_pu_bacteria 2842521101 2842524346 576
694 iso_pu_bacteria 2854896431 2854897021 576
695 iso_pu_bacteria 8049293176 8049296101 576
696 3300002987 JGI25159J45721_1000050 JGI25159J45721_100005012 577
697 3300003354 JGI25160J50197_1000097 JGI25160J50197_100009737 577
698 3300003374 JGI25161J50226_1000705 JGI25161J50226_10007052 577
699 3300003781 Ga0055536_1002046 Ga0055536_10020462 577
700 3300003794 Ga0055531_10002498 Ga0055531_100024986 577
701 3300004625 Ga0055543_1000454 Ga0055543_10004548 577
702 3300005262 Ga0065165_1000427 Ga0065165_100042721 577
703 3300005548 Ga0070665_100020368 Ga0070665_1000203682 577
704 3300006038 Ga0075365_10016851 Ga0075365_100168512 577
705 3300006177 Ga0075362_10004817 Ga0075362_100048173 577
706 3300006178 Ga0075367_10012869 Ga0075367_100128692 577
707 3300006195 Ga0075366_10017995 Ga0075366_100179953 577
708 3300006948 Ga0099826_10018843 Ga0099826_100188432 577
709 3300009148 Ga0105243_10008956 Ga0105243_100089562 577
710 3300011119 Ga0105246_10027052 Ga0105246_100270522 577
711 3300013100 Ga0157373_10006515 Ga0157373_100065153 577
712 3300013102 Ga0157371_10000195 Ga0157371_1000019565 577
713 3300013104 Ga0157370_10001395 Ga0157370_1000139519 577
714 3300013104 Ga0157370_10016747 Ga0157370_100167473 577
715 3300013105 Ga0157369_10042259 Ga0157369_100422592 577
716 3300013249 Ga0171463_1004 Ga0171463_100439 577
717 3300015690 Ga0183363_1024 Ga0183363_102439 577
718 3300022739 Ga0228711_1003012 Ga0228711_100301216 577
719 3300022740 Ga0228710_1003154 Ga0228710_100315416 577
720 3300025208 Ga0209436_100651 Ga0209436_1006512 577
721 3300025245 Ga0207425_1003822 Ga0207425_10038222 577
722 3300025258 Ga0209129_1001141 Ga0209129_10011418 577
723 3300025273 Ga0209673_1000052 Ga0209673_10000523 577
724 3300025273 Ga0209673_1000459 Ga0209673_100045964 577
725 3300025273 Ga0209673_1000997 Ga0209673_100099727 577
726 3300025284 Ga0209130_1000027 Ga0209130_100002736 577
727 3300025292 Ga0209676_1001367 Ga0209676_10013675 577
728 3300025294 Ga0209025_1000706 Ga0209025_100070641 577
729 3300025294 Ga0209025_1000765 Ga0209025_100076534 577
730 3300025294 Ga0209025_1002441 Ga0209025_10024413 577
731 3300025295 Ga0209564_1000111 Ga0209564_100011138 577
732 3300025295 Ga0209564_1002998 Ga0209564_10029986 577
733 3300025295 Ga0209564_1003182 Ga0209564_10031826 577
734 3300025297 Ga0209758_1000948 Ga0209758_10009483 577
735 3300025297 Ga0209758_1008165 Ga0209758_10081652 577
736 3300025299 Ga0209256_1002722 Ga0209256_10027224 577
737 3300025299 Ga0209256_1003287 Ga0209256_10032876 577
738 3300025302 Ga0207426_1000072 Ga0207426_1000072279 577
739 3300025302 Ga0207426_1000761 Ga0207426_10007613 577
740 3300025303 Ga0209051_1000863 Ga0209051_100086323 577
741 3300025303 Ga0209051_1001804 Ga0209051_100180410 577
742 3300025303 Ga0209051_1003684 Ga0209051_10036845 577
743 3300025304 Ga0209257_1005315 Ga0209257_10053152 577
744 3300027111 Ga0209281_1000596 Ga0209281_100059628 577
745 3300027312 Ga0209371_1001945 Ga0209371_100194513 577
746 3300027312 Ga0209371_1001958 Ga0209371_10019581 577
747 3300027666 Ga0209282_1000267 Ga0209282_10002678 577
748 3300028379 Ga0268266_10002491 Ga0268266_1000249114 577
749 3300028794 Ga0307515_10062307 Ga0307515_100623072 577
750 3300030500 Ga0268256_1002013 Ga0268256_10020131 577
751 3300031967 Ga0315914_1000965 Ga0315914_100096527 577
752 3300033430 Ga0315913_1000276 Ga0315913_10002768 577
753 3300033464 Ga0315915_1000499 Ga0315915_10004998 577
754 3300042007 Ga0439449_0006783 Ga0439449_0006783_1675_3588 577
755 3300046501 Ga0495607_0027437 Ga0495607_0027437_926_2797 577
756 3300046692 Ga0495671_0007496 Ga0495671_0007496_796_2721 577
757 3300047470 Ga0495681_0007021 Ga0495681_0007021_4285_6210 577
758 3300048920 Ga0496117_0000031 Ga0496117_0000031_75176_77101 577
759 3300048921 Ga0496118_0002502 Ga0496118_0002502_9467_11392 577
760 3300048923 Ga0496120_0004148 Ga0496120_0004148_9624_11549 577
761 3300048925 Ga0496122_0000023 Ga0496122_0000023_75176_77101 577
762 3300048925 Ga0496122_0001589 Ga0496122_0001589_28901_30826 577
763 3300048926 Ga0496123_0000027 Ga0496123_0000027_303935_305860 577
764 3300048926 Ga0496123_0000907 Ga0496123_0000907_4801_6726 577
765 3300048927 Ga0496124_0017328 Ga0496124_0017328_1160_3085 577
766 3300050491 nmdc:mga00v17_439_c1 nmdc:mga00v17_439_c1_20454_22379 577
767 3300050492 nmdc:mga0yw44_9046_c1 nmdc:mga0yw44_9046_c1_891_2816 577
768 3300050516 nmdc:mga0sz30_630_c1 nmdc:mga0sz30_630_c1_5348_7273 577
769 3300053137 Ga0500561_0000846 Ga0500561_0000846_1657_3582 577
770 iso_pu_bacteria 2510065057 2510306908 577
771 iso_pu_bacteria 2511231052 2511503146 577
772 iso_pu_bacteria 2512047086 2512534427 577
773 iso_pu_bacteria 2512875026 2512973770 577
774 iso_pu_bacteria 2513237086 2513587062 577
775 iso_pu_bacteria 2513237089 2513606748 577
776 iso_pu_bacteria 2513237091 2513616897 577
777 iso_pu_bacteria 2513237140 2513886300 577
778 iso_pu_bacteria 2513237143 2513903431 577
779 iso_pu_bacteria 2513237156 2513987462 577
780 iso_pu_bacteria 2513237160 2514008359 577
781 iso_pu_bacteria 2515154107 2515610889 577
782 iso_pu_bacteria 2516143018 2516205453 577
783 iso_pu_bacteria 2516653046 2516894574 577
784 iso_pu_bacteria 2517487022 2517571228 577
785 iso_pu_bacteria 2551306084 2551681287 577
786 iso_pu_bacteria 2551306085 2551688839 577
787 iso_pu_bacteria 2551306086 2551693708 577
788 iso_pu_bacteria 2554235003 2554248778 577
789 iso_pu_bacteria 2558860242 2559295866 577
790 iso_pu_bacteria 2585427634 2586002261 577
791 iso_pu_bacteria 2599185210 2599603343 577
792 iso_pu_bacteria 2599185352 2600193536 577
793 iso_pu_bacteria 2600254933 2600373328 577
794 iso_pu_bacteria 2643221557 2643808228 577
795 iso_pu_bacteria 2643221582 2643921391 577
796 iso_pu_bacteria 2643221610 2644068583 577
797 iso_pu_bacteria 2643221618 2644109986 577
798 iso_pu_bacteria 2643221626 2644150262 577
799 iso_pu_bacteria 2643221655 2644312866 577
800 iso_pu_bacteria 2643221668 2644379662 577
801 iso_pu_bacteria 2643221675 2644419652 577
802 iso_pu_bacteria 2643221680 2644453009 577
803 iso_pu_bacteria 2643221693 2644521444 577
804 iso_pu_bacteria 2643221698 2644546060 577
805 iso_pu_bacteria 2643221712 2644618596 577
806 iso_pu_bacteria 2643221723 2644677253 577
807 iso_pu_bacteria 2643221726 2644688962 577
808 iso_pu_bacteria 2690316117 2692320147 577
809 iso_pu_bacteria 2791355091 2792622068 577
810 iso_pu_bacteria 2791355092 2792628675 577
811 iso_pu_bacteria 2791355094 2792641393 577
812 iso_pu_bacteria 2802428858 2802721558 577
813 iso_pu_bacteria 2802428859 2802728430 577
814 iso_pu_bacteria 2802428860 2802734443 577
815 iso_pu_bacteria 2802428861 2802741082 577
816 iso_pu_bacteria 2802428862 2802747184 577
817 iso_pu_bacteria 2802428863 2802753906 577
818 iso_pu_bacteria 2802429268 2804753536 577
819 iso_pu_bacteria 2808606387 2808988310 577
820 iso_pu_bacteria 2844163670 2844164179 577
821 iso_pu_bacteria 2847417321 2847420665 577
822 iso_pu_bacteria 2848992105 2848995496 577
823 iso_pu_bacteria 2850079185 2850082477 577
824 iso_pu_bacteria 2855825444 2855827193 577
825 iso_pu_bacteria 2855839649 2855842587 577
826 iso_pu_bacteria 2855872281 2855878024 577
827 iso_pu_bacteria 2858800743 2858803398 577
828 iso_pu_bacteria 2899845264 2899848256 577
829 iso_pu_bacteria 2913295892 2913300011 577
830 iso_pu_bacteria 2915980308 2915984948 577
831 iso_pu_bacteria 2915986958 2915988268 577
832 iso_pu_bacteria 2915993759 2915996947 577
833 iso_pu_bacteria 2916000859 2916004052 577
834 iso_pu_bacteria 2916007675 2916012303 577
835 iso_pu_bacteria 2916014648 2916020936 577
836 iso_pu_bacteria 2916021584 2916026987 577
837 iso_pu_bacteria 2916028427 2916033601 577
838 iso_pu_bacteria 2916035215 2916039546 577
839 iso_pu_bacteria 2916041962 2916045497 577
840 iso_pu_bacteria 2916048683 2916051166 577
841 iso_pu_bacteria 2916055098 2916057523 577
842 iso_pu_bacteria 2916061851 2916066841 577
843 iso_pu_bacteria 2916076590 2916082376 577
844 iso_pu_bacteria 2920822456 2920825771 577
845 iso_pu_bacteria 2921201388 2921208325 577
846 iso_pu_bacteria 2921208531 2921212430 577
847 iso_pu_bacteria 2921237296 2921241075 577
848 iso_pu_bacteria 2921244191 2921249570 577
849 iso_pu_bacteria 2921250672 2921255619 577
850 iso_pu_bacteria 2921257292 2921262144 577
851 iso_pu_bacteria 2921263974 2921270611 577
852 iso_pu_bacteria 2921289301 2921295507 577
853 iso_pu_bacteria 2921296804 2921297115 577
854 iso_pu_bacteria 2924144063 2924150126 577
855 iso_pu_bacteria 2924150972 2924154129 577
856 iso_pu_bacteria 2924158325 2924160248 577
857 iso_pu_bacteria 2924165586 2924169309 577
858 iso_pu_bacteria 2924172951 2924175908 577
859 iso_pu_bacteria 2924179722 2924181655 577
860 iso_pu_bacteria 2924186466 2924192226 577
861 iso_pu_bacteria 2924193448 2924195303 577
862 iso_pu_bacteria 2924200457 2924205991 577
863 iso_pu_bacteria 2924207177 2924209420 577
864 iso_pu_bacteria 2924214083 2924217622 577
865 iso_pu_bacteria 2924221636 2924223323 577
866 iso_pu_bacteria 2924228884 2924233115 577
867 iso_pu_bacteria 2926760298 2926762282 577
868 iso_pu_bacteria 2933006813 2933010715 577
869 iso_pu_bacteria 2933011516 2933015610 577
870 iso_pu_bacteria 2936996657 2936997633 577
871 iso_pu_bacteria 2937002841 2937008668 577
872 iso_pu_bacteria 2937009748 2937013405 577
873 iso_pu_bacteria 2937016420 2937020271 577
874 iso_pu_bacteria 2937023124 2937024693 577
875 iso_pu_bacteria 2937029754 2937034295 577
876 iso_pu_bacteria 2937036028 2937040947 577
877 iso_pu_bacteria 2937042894 2937044158 577
878 iso_pu_bacteria 2937049772 2937054371 577
879 iso_pu_bacteria 2937056579 2937061505 577
880 iso_pu_bacteria 2937063883 2937067910 577
881 iso_pu_bacteria 2937071275 2937075615 577
882 iso_pu_bacteria 2937078374 2937083093 577
883 iso_pu_bacteria 2937084907 2937085948 577
884 iso_pu_bacteria 2937091812 2937093985 577
885 iso_pu_bacteria 2937098957 2937103284 577
886 iso_pu_bacteria 2937106411 2937111616 577
887 iso_pu_bacteria 2937119839 2937121807 577
888 iso_pu_bacteria 2937126314 2937127902 577
889 iso_pu_bacteria 2941499720 2941501177 577
890 iso_pu_bacteria 2957375807 2957380401 577
891 iso_pu_bacteria 2957382221 2957383788 577
892 iso_pu_bacteria 2957388812 2957391544 577
893 iso_pu_bacteria 2957395598 2957398182 577
894 iso_pu_bacteria 2957402308 2957404009 577
895 iso_pu_bacteria 2957408893 2957409919 577
896 iso_pu_bacteria 2957415311 2957417929 577
897 iso_pu_bacteria 2957422303 2957424583 577
898 iso_pu_bacteria 2957430029 2957431550 577
899 iso_pu_bacteria 2957437181 2957443220 577
900 iso_pu_bacteria 2957443900 2957447545 577
901 iso_pu_bacteria 2957450854 2957455447 577
902 iso_pu_bacteria 2957457609 2957458712 577
903 iso_pu_bacteria 2957464669 2957469882 577
904 iso_pu_bacteria 2957478035 2957480070 577
905 iso_pu_bacteria 2957484790 2957491381 577
906 iso_pu_bacteria 2957491536 2957493665 577
907 iso_pu_bacteria 2957498199 2957502144 577
908 iso_pu_bacteria 2957505466 2957512061 577
909 iso_pu_bacteria 2960584000 2960586801 577
910 iso_pu_bacteria 2960591022 2960595799 577
911 iso_pu_bacteria 2960597568 2960599324 577
912 iso_pu_bacteria 2960603979 2960608020 577
913 iso_pu_bacteria 2960610863 2960612105 577
914 iso_pu_bacteria 2960617483 2960618241 577
915 iso_pu_bacteria 2960624210 2960627404 577
916 iso_pu_bacteria 2960631154 2960634832 577
917 iso_pu_bacteria 2960637947 2960643296 577
918 iso_pu_bacteria 2960645483 2960649560 577
919 iso_pu_bacteria 2960652885 2960655467 577
920 iso_pu_bacteria 2960660292 2960663521 577
921 iso_pu_bacteria 2960667422 2960671832 577
922 iso_pu_bacteria 2960674078 2960678974 577
923 iso_pu_bacteria 2960680706 2960685503 577
924 iso_pu_bacteria 2960687367 2960693747 577
925 iso_pu_bacteria 2960693952 2960699998 577
926 iso_pu_bacteria 2964607997 2964610009 577
927 iso_pu_bacteria 2964615318 2964621098 577
928 iso_pu_bacteria 2964621998 2964628806 577
929 iso_pu_bacteria 2964628898 2964630524 577
930 iso_pu_bacteria 2964636051 2964641962 577
931 iso_pu_bacteria 2964643177 2964645318 577
932 iso_pu_bacteria 2964649959 2964656545 577
933 iso_pu_bacteria 2964656573 2964657211 577
934 iso_pu_bacteria 2964663802 2964667938 577
935 iso_pu_bacteria 2964670856 2964671842 577
936 iso_pu_bacteria 2964678106 2964678327 577
937 iso_pu_bacteria 2964685014 2964690831 577
938 iso_pu_bacteria 2964691889 2964695317 577
939 iso_pu_bacteria 2964698721 2964702566 577
940 iso_pu_bacteria 2964705432 2964709329 577
941 iso_pu_bacteria 2964719344 2964722187 577
942 iso_pu_bacteria 2967664464 2967668943 577
943 iso_pu_bacteria 2967671571 2967673561 577
944 iso_pu_bacteria 2967678726 2967682732 577
945 iso_pu_bacteria 2967686174 2967691070 577
946 iso_pu_bacteria 2967693043 2967695553 577
947 iso_pu_bacteria 2967699805 2967701634 577
948 iso_pu_bacteria 2967706974 2967713863 577
949 iso_pu_bacteria 2967714385 2967718222 577
950 iso_pu_bacteria 2967721400 2967725344 577
951 iso_pu_bacteria 2967728569 2967733446 577
952 iso_pu_bacteria 2967735183 2967736733 577
953 iso_pu_bacteria 2967742019 2967746663 577
954 iso_pu_bacteria 2967748971 2967749951 577
955 iso_pu_bacteria 2967755722 2967757972 577
956 iso_pu_bacteria 2967762386 2967763828 577
957 iso_pu_bacteria 2967769361 2967774884 577
958 iso_pu_bacteria 2967775926 2967778466 577
959 iso_pu_bacteria 2970019648 2970023425 577
960 iso_pu_bacteria 2970026789 2970032311 577
961 iso_pu_bacteria 2970033650 2970038320 577
962 iso_pu_bacteria 2970040964 2970045897 577
963 iso_pu_bacteria 2970047711 2970054349 577
964 iso_pu_bacteria 2970054988 2970059898 577
965 iso_pu_bacteria 2970061556 2970064874 577
966 iso_pu_bacteria 2970068827 2970073123 577
967 iso_pu_bacteria 2970076120 2970079716 577
968 iso_pu_bacteria 2970082768 2970086448 577
969 iso_pu_bacteria 2970088815 2970091292 577
970 iso_pu_bacteria 2970095765 2970099486 577
971 iso_pu_bacteria 2970102677 2970106800 577
972 iso_pu_bacteria 2970109326 2970111508 577
973 iso_pu_bacteria 2970116247 2970120918 577
974 iso_pu_bacteria 2970122695 2970127490 577
975 iso_pu_bacteria 2970129317 2970131962 577
976 iso_pu_bacteria 2970136068 2970141652 577
977 iso_pu_bacteria 2970143518 2970148278 577
978 iso_pu_bacteria 2970149975 2970154991 577
979 iso_pu_bacteria 2970156795 2970158327 577
980 iso_pu_bacteria 2970164137 2970167972 577
981 iso_pu_bacteria 2970170962 2970176776 577
982 iso_pu_bacteria 2970177841 2970180154 577
983 iso_pu_bacteria 2970184632 2970185760 577
984 iso_pu_bacteria 2970191845 2970198145 577
985 iso_pu_bacteria 2977516862 2977520262 577
986 iso_pu_bacteria 2977523885 2977524588 577
987 iso_pu_bacteria 2977530762 2977535943 577
988 iso_pu_bacteria 2977537788 2977541502 577
989 iso_pu_bacteria 2977544691 2977551022 577
990 iso_pu_bacteria 2977551784 2977553375 577
991 iso_pu_bacteria 2977558990 2977565255 577
992 iso_pu_bacteria 2977565890 2977571534 577
993 iso_pu_bacteria 2977572785 2977576473 577
994 iso_pu_bacteria 2977579622 2977585413 577
995 iso_pu_bacteria 2979089926 2979092448 577
996 iso_pu_bacteria 2979095461 2979100161 577
997 iso_pu_bacteria 2979100975 2979104419 577
998 iso_pu_bacteria 2984509177 2984513785 577
999 iso_pu_bacteria 2984518228 2984522637 577
1000 iso_pu_bacteria 2984537506 2984541943 577
1001 iso_pu_bacteria 2984601300 2984601373 577
1002 iso_pu_bacteria 643692032 643827266 577
1003 iso_pu_bacteria 648276728 648737027 577
1004 iso_pu_bacteria 650716007 650741080 577
1005 iso_pu_bacteria 8003570095 8003573862 577
1006 iso_pu_bacteria 8003992118 8003995169 577
1007 iso_pu_bacteria 8003999396 8004002887 577
1008 3300001979 JGI24740J21852_10000066 JGI24740J21852_100000669 578
1009 3300002737 JGI25162J39368_1000750 JGI25162J39368_100075011 578
1010 3300002739 JGI25158J39367_1000028 JGI25158J39367_10000282 578
1011 3300002773 JGI25152J39213_1001208 JGI25152J39213_10012086 578
1012 3300002773 JGI25152J39213_1001987 JGI25152J39213_10019873 578
1013 3300002773 JGI25152J39213_1002229 JGI25152J39213_10022292 578
1014 3300002774 JGI25150J39212_1002835 JGI25150J39212_10028353 578
1015 3300002987 JGI25159J45721_1001206 JGI25159J45721_10012066 578
1016 3300003187 JGI25151J46595_10002317 JGI25151J46595_100023174 578
1017 3300003214 JGI25165J46597_1000509 JGI25165J46597_100050911 578
1018 3300003214 JGI25165J46597_1000514 JGI25165J46597_100051430 578
1019 3300003215 JGI25153J46596_10003307 JGI25153J46596_100033073 578
1020 3300003354 JGI25160J50197_1005273 JGI25160J50197_10052732 578
1021 3300003354 JGI25160J50197_1016347 JGI25160J50197_10163471 578
1022 3300003374 JGI25161J50226_1000155 JGI25161J50226_100015511 578
1023 3300003374 JGI25161J50226_1003484 JGI25161J50226_10034842 578
1024 3300003771 Ga0055526_1001632 Ga0055526_100163218 578
1025 3300003771 Ga0055526_1004058 Ga0055526_10040582 578
1026 3300003771 Ga0055526_1015804 Ga0055526_10158042 578
1027 3300003775 Ga0055524_1004722 Ga0055524_10047223 578
1028 3300003790 Ga0055528_1001563 Ga0055528_10015635 578
1029 3300003790 Ga0055528_1002456 Ga0055528_10024561 578
1030 3300003790 Ga0055528_1004877 Ga0055528_10048772 578
1031 3300003792 Ga0055540_1000481 Ga0055540_100048122 578
1032 3300003792 Ga0055540_1006447 Ga0055540_10064475 578
1033 3300004625 Ga0055543_1000543 Ga0055543_10005438 578
1034 3300004625 Ga0055543_1000751 Ga0055543_10007513 578
1035 3300005262 Ga0065165_1004583 Ga0065165_10045832 578
1036 3300005347 Ga0070668_100059208 Ga0070668_1000592082 578
1037 3300005353 Ga0070669_100051764 Ga0070669_1000517642 578
1038 3300005614 Ga0068856_100025555 Ga0068856_1000255552 578
1039 3300006178 Ga0075367_10005023 Ga0075367_100050232 578
1040 3300006186 Ga0075369_10002003 Ga0075369_100020035 578
1041 3300009011 Ga0105251_10018923 Ga0105251_100189232 578
1042 3300009177 Ga0105248_10019530 Ga0105248_100195304 578
1043 3300009765 Ga0123341_1000020 Ga0123341_100002075 578
1044 3300009766 Ga0123342_1009750 Ga0123342_10097504 578
1045 3300025208 Ga0209436_100296 Ga0209436_10029615 578
1046 3300025233 Ga0209437_100057 Ga0209437_10005796 578
1047 3300025245 Ga0207425_1001482 Ga0207425_10014823 578
1048 3300025245 Ga0207425_1007273 Ga0207425_10072731 578
1049 3300025258 Ga0209129_1000935 Ga0209129_10009354 578
1050 3300025258 Ga0209129_1000970 Ga0209129_10009705 578
1051 3300025258 Ga0209129_1001019 Ga0209129_10010193 578
1052 3300025261 Ga0209233_1000134 Ga0209233_100013496 578
1053 3300025273 Ga0209673_1005682 Ga0209673_10056824 578
1054 3300025273 Ga0209673_1006920 Ga0209673_10069204 578
1055 3300025284 Ga0209130_1000009 Ga0209130_1000009381 578
1056 3300025292 Ga0209676_1016652 Ga0209676_10166522 578
1057 3300025294 Ga0209025_1006022 Ga0209025_10060223 578
1058 3300025295 Ga0209564_1000675 Ga0209564_100067540 578
1059 3300025295 Ga0209564_1001140 Ga0209564_100114012 578
1060 3300025297 Ga0209758_1001909 Ga0209758_100190911 578
1061 3300025297 Ga0209758_1002600 Ga0209758_10026008 578
1062 3300025297 Ga0209758_1015226 Ga0209758_10152262 578
1063 3300025299 Ga0209256_1007490 Ga0209256_10074904 578
1064 3300025299 Ga0209256_1008913 Ga0209256_10089134 578
1065 3300025302 Ga0207426_1000041 Ga0207426_1000041319 578
1066 3300025302 Ga0207426_1002224 Ga0207426_10022243 578
1067 3300025303 Ga0209051_1013633 Ga0209051_10136332 578
1068 3300025735 Ga0207713_1025524 Ga0207713_10255242 578
1069 3300025923 Ga0207681_10050830 Ga0207681_100508302 578
1070 3300025931 Ga0207644_10043161 Ga0207644_100431613 578
1071 3300025941 Ga0207711_10084304 Ga0207711_100843042 578
1072 3300026078 Ga0207702_10026584 Ga0207702_100265842 578
1073 3300041441 Ga0451787_180184 Ga0451787_180184_939_2810 578
1074 3300041501 Ga0451845_0903617 Ga0451845_0903617_273_2144 578
1075 3300046460 Ga0495638_0000919 Ga0495638_0000919_9027_10898 578
1076 3300046460 Ga0495638_0022430 Ga0495638_0022430_703_2574 578
1077 3300046474 Ga0495605_0000575 Ga0495605_0000575_23523_25394 578
1078 3300046492 Ga0495585_0002386 Ga0495585_0002386_1881_3752 578
1079 3300046507 Ga0495606_0010042 Ga0495606_0010042_4783_6654 578
1080 3300046507 Ga0495606_0028844 Ga0495606_0028844_664_2589 578
1081 3300046512 Ga0495610_0000915 Ga0495610_0000915_9076_11004 578
1082 3300046515 Ga0495620_0018254 Ga0495620_0018254_1003_2931 578
1083 3300046515 Ga0495620_0025854 Ga0495620_0025854_122_1993 578
1084 3300046515 Ga0495620_0031886 Ga0495620_0031886_379_2250 578
1085 3300046518 Ga0495631_0000375 Ga0495631_0000375_5006_6877 578
1086 3300046519 Ga0495632_0017308 Ga0495632_0017308_1363_3234 578
1087 3300046519 Ga0495632_0027699 Ga0495632_0027699_905_2833 578
1088 3300046522 Ga0495643_0008867 Ga0495643_0008867_4153_6081 578
1089 3300046522 Ga0495643_0010212 Ga0495643_0010212_2733_4604 578
1090 3300046530 Ga0495654_0029239 Ga0495654_0029239_569_2440 578
1091 3300046530 Ga0495654_0041492 Ga0495654_0041492_163_2034 578
1092 3300046542 Ga0495597_0009583 Ga0495597_0009583_1191_3062 578
1093 3300046558 Ga0495633_0002726 Ga0495633_0002726_945_2816 578
1094 3300046648 Ga0495611_0005558 Ga0495611_0005558_2681_4552 578
1095 3300046660 Ga0495625_0002177 Ga0495625_0002177_6314_8185 578
1096 3300046691 Ga0495670_0017308 Ga0495670_0017308_162_2033 578
1097 3300046810 Ga0495660_0029291 Ga0495660_0029291_296_2167 578
1098 3300047320 Ga0495672_0014381 Ga0495672_0014381_1536_3407 578
1099 3300047470 Ga0495681_0021025 Ga0495681_0021025_1169_3040 578
1100 3300047472 Ga0495686_0012626 Ga0495686_0012626_2569_4497 578
1101 3300048909 Ga0496106_0000752 Ga0496106_0000752_1239_3110 578
1102 3300048919 Ga0496116_0007357 Ga0496116_0007357_2873_4744 578
1103 3300048921 Ga0496118_0006726 Ga0496118_0006726_1274_3169 578
1104 3300048925 Ga0496122_0008392 Ga0496122_0008392_1245_3116 578
1105 3300048926 Ga0496123_0024480 Ga0496123_0024480_1354_3225 578
1106 3300048928 Ga0496125_0011085 Ga0496125_0011085_6383_8257 578
1107 3300049459 Ga0495678_021691 Ga0495678_021691_379_2250 578
1108 3300049459 Ga0495678_022114 Ga0495678_022114_375_2246 578
1109 3300049742 Ga0501080_0084552 Ga0501080_0084552_188_2059 578
1110 3300050489 nmdc:mga03683_4166_c1 nmdc:mga03683_4166_c1_1890_3761 578
1111 3300050492 nmdc:mga0yw44_10480_c1 nmdc:mga0yw44_10480_c1_2408_4279 578
1112 3300053086 Ga0500578_0013246 Ga0500578_0013246_2034_3905 578
1113 3300053118 Ga0500594_0001072 Ga0500594_0001072_3359_5230 578
1114 3300053125 Ga0500618_004840 Ga0500618_004840_1348_3276 578
1115 3300053134 Ga0500658_0003797 Ga0500658_0003797_2780_4651 578
1116 3300053139 Ga0500568_0002293 Ga0500568_0002293_8423_10294 578
1117 3300053139 Ga0500568_0002590 Ga0500568_0002590_3639_5510 578
1118 3300053142 Ga0500577_0015354 Ga0500577_0015354_113_1984 578
1119 3300053153 Ga0500616_0001463 Ga0500616_0001463_1749_3620 578
1120 3300053153 Ga0500616_0008294 Ga0500616_0008294_3073_4944 578
1121 iso_pu_bacteria 2582581308 2585280608 578
1122 iso_pu_bacteria 2582581315 2585327981 578
1123 iso_pu_bacteria 2582581316 2585334273 578
1124 iso_pu_bacteria 2585427527 2585531543 578
1125 iso_pu_bacteria 2585427530 2585551511 578
1126 iso_pu_bacteria 2615840626 2616306848 578
1127 iso_pu_bacteria 2643221599 2644002258 578
1128 iso_pu_bacteria 2818991453 2819638941 578
1129 iso_pu_bacteria 3005452660 3005455720 578
1130 iso_pu_bacteria 639633055 639650264 578
1131 iso_pu_bacteria 8005542996 8005546558 578
1132 iso_pu_bacteria 8024486573 8024490737 578

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01103

Omp85

Omp85 superfamily domain

408

708

0.93

PF07244

POTRA

Surface antigen variable number repeat

307

381

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q6b-assembly1.cif.gz_A the high-resolution and new form crystal structure of bama potra4-5 from e.coli 0.7914 142 294
6izs-assembly1.cif.gz_A crystal structure of haemophilus influenzae bama potra4 0.7818 142 220
3q6b-assembly1.cif.gz_A the high-resolution and new form crystal structure of bama potra4-5 from e.coli 0.7783 142 294
4xga-assembly1.cif.gz_B crystal structure of bamb and bama p3-5 complex from e.coli 0.7715 143 296
4n75-assembly2.cif.gz_B structural basis of bama-mediate outer membrane protein biogenesis 0.7604 298 575
ID Description Score Start End Superfamily
4bzaA03 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8825 222 297 3.10.20.310
2x8xX01 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8782 221 295 3.10.20.310
af_I1MDA6_263_342_3.10.20.310 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8755 225 296 3.10.20.310
4k3bA05 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.869 221 296 3.10.20.310
5aywA05 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8615 221 296 3.10.20.310
ID Description Score Start End GO Terms
AF-A0A2V8RAJ8-F1-model_v4 POTRA domain-containing protein 0.8957 221 296 GO:0019867
AF-A0A077AS02-F1-model_v4 Bacterial surface antigen (D15) domain-containing protein 0.8879 298 578 GO:0019867
AF-A0A7V8AAM9-F1-model_v4 Outer membrane protein 0.8832 374 578 GO:0019867
AF-A0A660MDN6-F1-model_v4 Outer membrane protein assembly factor 0.8741 369 575 GO:0009279
AF-A0A660SNA5-F1-model_v4 Bacterial surface antigen (D15) domain-containing protein 0.8696 484 578 GO:0019867

Feature Viewer

pLDDT pTM Quality
80.28 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map