F490111

General Info

Members Datasets Scaffolds Average Seq Length
1103 286 590 243

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0000487|Ga0496116_0000487_13512_14372
Length 286
Sequence VRRAGVRAAAHYKALLIQNNCIKIHSMALCHAFRFWLAYENDIMKKWIIAAALAAVTVNAYAAEKIRFAVSATYPPFESLDHDNQIVGFDIDLAKALCAKIKAECTFTNNAFDSLIPSLKFRRYDAVISGMDITAERSKQVDFSQPYYANSAIVIARKGEFSDFSQLKGKRIGVENGTTHQKYLTEKHPDVVAVAYDSYQNAILDLKNGRLNGVFGDSAVVSQWLKANEDLTTVGEHVTDAGYFGNGLGIAVRKGNSDLLNEFNTALAALKADGSWQQINQKWFPE

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
7 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
8 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
9 2547132181 Kosakonia sacchari SP1 Isolate Stem
10 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
11 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
12 2561511199 Enterobacter sp. R4-368 Isolate Nodule
13 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
14 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
15 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
16 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
17 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
18 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
19 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
20 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
21 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
22 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
23 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
24 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
25 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
26 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
27 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
28 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
29 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
30 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
31 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
32 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
33 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
34 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
35 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
36 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
37 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
38 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
39 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
40 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
41 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
42 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
43 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
44 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
45 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
46 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
47 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
48 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
49 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
50 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
51 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
52 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
53 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
54 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
55 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
56 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
57 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
58 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
59 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
60 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
61 2636415599 Klebsiella variicola DX120E Isolate Unclassified
62 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
63 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
64 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
65 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
66 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
67 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
68 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
69 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
70 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
71 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
72 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
73 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
74 2751185917 Enterobacter sp. HK169 Isolate Unclassified
75 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
76 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
77 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
78 2775507074 Klebsiella sp. D5A Isolate Unclassified
79 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
80 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
81 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
82 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
83 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
84 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
85 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
86 2821118458 Enterobacter asburiae 609 Isolate Unclassified
87 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
88 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
89 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
90 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
91 2847085930 Erwinia persicina B64 Isolate Bulb
92 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
93 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
94 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
95 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
96 2865014394 Pantoea sp. R-71966 Isolate Unclassified
97 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
98 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
99 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
100 2876601092 Pantoea endophytica 596 Isolate Unclassified
101 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
102 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
103 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
104 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
105 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
106 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
107 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
108 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
109 2904504865 Serratia marcescens 1822 Isolate Unclassified
110 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
111 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
112 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
113 2919150387 Rahnella aceris 1817 Isolate Unclassified
114 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
115 2927143783 Rahnella sp. 2050 Isolate Unclassified
116 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
117 2932406140 Serratia sp. 2723 Isolate Rhizosphere
118 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
119 2937539931 Pantoea sp. LS15 Isolate Unclassified
120 2937967321 Serratia sp. YC16 Isolate Unclassified
121 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
122 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
123 2939577877 Serratia sp. 509 Isolate Rhizosphere
124 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
125 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
126 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
127 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
128 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
129 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
130 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
131 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
132 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
133 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
134 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
135 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
136 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
137 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
138 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
139 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
140 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
141 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
142 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
143 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
144 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
145 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
146 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
147 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
148 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
149 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
150 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
151 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
152 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
153 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
154 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
155 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
156 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
157 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
158 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
159 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
160 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
161 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
162 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
163 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
164 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
165 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
168 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
169 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
172 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
173 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
174 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
175 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
176 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
177 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
178 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
179 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
182 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
189 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
190 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
206 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
209 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
212 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
213 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
214 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
215 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
216 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
217 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
218 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
219 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
220 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
221 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
222 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
243 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
244 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 640753048 Serratia proteamaculans 568 Isolate Endosphere
273 8004592986 Serratia sp. S119 Isolate Unclassified
274 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
275 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
276 8018221730 Enterobacter sp. CM29 Isolate Unclassified
277 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
278 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
279 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
280 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
281 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
282 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
283 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
284 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
285 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
286 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.08
Metatranscriptomes 0
Isolates 28.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.91
Bulb 0.18
Endosphere 5.44
Nodule 3.35
Rhizoplane 14.42
Rhizosphere 48.32
Stem 0.18
Stem Tuber 0.45
Unclassified 26.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C6732 2010549000 Bacteria 1720
2 SwRhRL2b_contig_1581014 2162886007 Bacteria 2905
3 SwRhRL2b_contig_2251415 2162886007 Bacteria 2671
4 SwRhRL2b_contig_3058281 2162886007 Bacteria 2321
5 SwRhRL2b_contig_3247475 2162886007 Bacteria 1224
6 SwRhRL2b_contig_3785416 2162886007 Bacteria 1361
7 SwRhRL2b_contig_3813720 2162886007 Bacteria 2117
8 SwRhRL2b_contig_985395 2162886007 Bacteria 1227
9 JGI24739J22299_10001393 3300001989 Bacteria 9091
10 JGI25162J39368_1000002 3300002737 Bacteria 663004
11 JGI25162J39368_1007911 3300002737 Bacteria 1586
12 JGI25163J39215_1000003 3300002771 Bacteria 149140
13 JGI25164J39214_1000041 3300002772 Bacteria 127466
14 JGI25152J39213_1000230 3300002773 Bacteria 37507
15 Ga0055538_1000003 3300003751 Bacteria 663004
16 Ga0055539_1000003 3300003752 Bacteria 663004
17 Ga0055533_1000005 3300003756 Bacteria 663004
18 Ga0055525_1000005 3300003759 Bacteria 663004
19 Ga0055541_1000003 3300003841 Bacteria 663004
20 Ga0058692_1000268 3300003856 Bacteria 28070
21 Ga0058692_1000327 3300003856 Bacteria 23576
22 Ga0058692_1000512 3300003856 Bacteria 17158
23 Ga0058692_1001001 3300003856 Bacteria 11095
24 Ga0058692_1001788 3300003856 Bacteria 7603
25 Ga0058692_1001793 3300003856 Bacteria 7592
26 Ga0058692_1001993 3300003856 Bacteria 7096
27 Ga0058692_1005580 3300003856 Bacteria 3569
28 Ga0058692_1006446 3300003856 Bacteria 3220
29 Ga0058692_1033834 3300003856 Bacteria 943
30 Ga0058692_1035373 3300003856 Bacteria 911
31 Ga0058692_1036181 3300003856 Bacteria 895
32 Ga0058692_1041447 3300003856 Bacteria 806
33 Ga0065704_10000102 3300005289 Bacteria 48764
34 Ga0065704_10000328 3300005289 Bacteria 50960
35 Ga0065704_10001805 3300005289 Bacteria 6497
36 Ga0065704_10001833 3300005289 Bacteria 7718
37 Ga0065704_10085231 3300005289 Bacteria 3244
38 Ga0065704_10098410 3300005289 Bacteria 2354
39 Ga0065704_10105214 3300005289 Bacteria 2118
40 Ga0065704_10126168 3300005289 Bacteria 1693
41 Ga0070668_100015549 3300005347 Bacteria 5689
42 Ga0070659_100013918 3300005366 Bacteria 6003
43 Ga0070659_100217972 3300005366 Bacteria 1574
44 Ga0070665_100000110 3300005548 Bacteria 154174
45 Ga0070665_100011851 3300005548 Bacteria 8808
46 Ga0068857_100000479 3300005577 Bacteria 28508
47 Ga0075364_10000400 3300006051 Bacteria 21708
48 Ga0075364_10048284 3300006051 Bacteria 2773
49 Ga0075364_10053668 3300006051 Bacteria 2635
50 Ga0075364_10065374 3300006051 Bacteria 2387
51 Ga0075364_10092683 3300006051 Bacteria 2005
52 Ga0075364_10140557 3300006051 Bacteria 1624
53 Ga0075366_10004092 3300006195 Bacteria 7801
54 Ga0079104_1000080 3300006946 Bacteria 140677
55 Ga0079104_1000089 3300006946 Bacteria 134252
56 Ga0079104_1000121 3300006946 Bacteria 111689
57 Ga0079104_1000345 3300006946 Bacteria 55686
58 Ga0079104_1001450 3300006946 Bacteria 15851
59 Ga0079104_1001825 3300006946 Bacteria 13105
60 Ga0079104_1008439 3300006946 Bacteria 3603
61 Ga0079104_1015031 3300006946 Bacteria 2310
62 Ga0079104_1016914 3300006946 Bacteria 2113
63 Ga0079104_1019071 3300006946 Bacteria 1926
64 Ga0105251_10000280 3300009011 Bacteria 51407
65 Ga0105251_10000349 3300009011 Bacteria 45894
66 Ga0105251_10000431 3300009011 Bacteria 40642
67 Ga0105251_10000801 3300009011 Bacteria 28447
68 Ga0105251_10001221 3300009011 Bacteria 22244
69 Ga0105251_10002143 3300009011 Bacteria 15866
70 Ga0105251_10002544 3300009011 Bacteria 14172
71 Ga0105251_10002780 3300009011 Bacteria 13301
72 Ga0105251_10003006 3300009011 Bacteria 12583
73 Ga0105251_10004116 3300009011 Bacteria 10155
74 Ga0105251_10005723 3300009011 Bacteria 8064
75 Ga0105251_10011846 3300009011 Bacteria 4958
76 Ga0105251_10012693 3300009011 Bacteria 4752
77 Ga0105251_10030129 3300009011 Bacteria 2727
78 Ga0105251_10040104 3300009011 Bacteria 2284
79 Ga0105251_10045149 3300009011 Bacteria 2125
80 Ga0105251_10055541 3300009011 Bacteria 1877
81 Ga0105251_10058605 3300009011 Bacteria 1818
82 Ga0105251_10129492 3300009011 Bacteria 1144
83 Ga0105251_10135865 3300009011 Bacteria 1113
84 Ga0105251_10196575 3300009011 Bacteria 909
85 Ga0105244_10000167 3300009036 Bacteria 67462
86 Ga0105244_10000235 3300009036 Bacteria 57271
87 Ga0105244_10000239 3300009036 Bacteria 56244
88 Ga0105244_10000485 3300009036 Bacteria 35910
89 Ga0105244_10001569 3300009036 Bacteria 18156
90 Ga0105244_10002311 3300009036 Bacteria 14490
91 Ga0105244_10004232 3300009036 Bacteria 9969
92 Ga0105244_10005667 3300009036 Bacteria 8246
93 Ga0105244_10006115 3300009036 Bacteria 7856
94 Ga0105244_10015990 3300009036 Bacteria 4289
95 Ga0105244_10016362 3300009036 Bacteria 4226
96 Ga0105244_10016854 3300009036 Bacteria 4149
97 Ga0105244_10017522 3300009036 Bacteria 4045
98 Ga0105244_10027379 3300009036 Bacteria 3072
99 Ga0105244_10027881 3300009036 Bacteria 3037
100 Ga0105244_10040517 3300009036 Bacteria 2418
101 Ga0105244_10042926 3300009036 Bacteria 2335
102 Ga0105244_10045212 3300009036 Bacteria 2266
103 Ga0105244_10096979 3300009036 Bacteria 1445
104 Ga0105244_10114208 3300009036 Bacteria 1311
105 Ga0105244_10166074 3300009036 Bacteria 1052
106 Ga0105244_10168318 3300009036 Bacteria 1044
107 Ga0105244_10191869 3300009036 Bacteria 966
108 Ga0105250_10000026 3300009092 Bacteria 213233
109 Ga0105250_10000057 3300009092 Bacteria 112440
110 Ga0105250_10000204 3300009092 Bacteria 50025
111 Ga0105250_10000439 3300009092 Bacteria 30129
112 Ga0105250_10000973 3300009092 Bacteria 16718
113 Ga0105250_10001480 3300009092 Bacteria 12702
114 Ga0105250_10003582 3300009092 Bacteria 7315
115 Ga0105250_10016403 3300009092 Bacteria 3019
116 Ga0105250_10023028 3300009092 Bacteria 2510
117 Ga0105250_10051274 3300009092 Bacteria 1656
118 Ga0105247_10000025 3300009101 Bacteria 208459
119 Ga0105247_10247269 3300009101 Bacteria 1218
120 Ga0105243_10004349 3300009148 Bacteria 11218
121 Ga0105243_10009796 3300009148 Bacteria 7292
122 Ga0105243_10107798 3300009148 Bacteria 2324
123 Ga0105241_10000005 3300009174 Bacteria 384203
124 Ga0105237_10365740 3300009545 Bacteria 1447
125 Ga0105237_10536812 3300009545 Bacteria 1176
126 Ga0105246_10008148 3300011119 Bacteria 6433
127 Ga0105246_10046428 3300011119 Bacteria 2963
128 Ga0157373_10000286 3300013100 Bacteria 40489
129 Ga0157373_10007099 3300013100 Bacteria 8352
130 Ga0157373_10007282 3300013100 Bacteria 8246
131 Ga0157373_10014354 3300013100 Bacteria 5805
132 Ga0157373_10156271 3300013100 Bacteria 1604
133 Ga0157373_10418810 3300013100 Bacteria 961
134 Ga0157371_10000006 3300013102 Bacteria 404774
135 Ga0157371_10000353 3300013102 Bacteria 58606
136 Ga0157371_10001970 3300013102 Bacteria 20343
137 Ga0157371_10002148 3300013102 Bacteria 19223
138 Ga0157371_10021688 3300013102 Bacteria 4713
139 Ga0157371_10040327 3300013102 Bacteria 3335
140 Ga0157371_10048750 3300013102 Bacteria 3011
141 Ga0157371_10071063 3300013102 Bacteria 2464
142 Ga0157370_10006410 3300013104 Bacteria 12980
143 Ga0157370_10024391 3300013104 Bacteria 5990
144 Ga0157369_10002623 3300013105 Bacteria 21498
145 Ga0157369_10050809 3300013105 Bacteria 4488
146 Ga0157369_10179844 3300013105 Bacteria 2225
147 Ga0163162_10014980 3300013306 Bacteria 7574
148 Ga0163162_10130019 3300013306 Bacteria 2626
149 Ga0163162_10218082 3300013306 Bacteria 2038
150 Ga0163162_11057743 3300013306 Bacteria 919
151 Ga0157372_10024555 3300013307 Bacteria 6550
152 Ga0157372_10025637 3300013307 Bacteria 6413
153 Ga0157372_10033607 3300013307 Bacteria 5635
154 Ga0157372_10037403 3300013307 Bacteria 5354
155 Ga0157372_10116895 3300013307 Bacteria 3058
156 Ga0157372_10129060 3300013307 Bacteria 2908
157 Ga0157372_10130002 3300013307 Bacteria 2897
158 Ga0157372_10293747 3300013307 Bacteria 1890
159 Ga0182008_10012759 3300014497 Bacteria 4429
160 Ga0182008_10021452 3300014497 Bacteria 3316
161 Ga0182006_1000086 3300015261 Bacteria 115213
162 Ga0182006_1002872 3300015261 Bacteria 9155
163 Ga0182006_1083262 3300015261 Bacteria 1164
164 Ga0182007_10011146 3300015262 Bacteria 3509
165 Ga0183366_1001 3300015679 Bacteria 2743932
166 Ga0183370_1001 3300015680 Bacteria 2743932
167 Ga0183369_1001 3300015685 Bacteria 2743932
168 Ga0183368_1001 3300015687 Bacteria 2743932
169 Ga0163161_10000001 3300017792 Bacteria 2041488
170 Ga0163161_10054287 3300017792 Bacteria 2907
171 Ga0163161_10118235 3300017792 Bacteria 1989
172 Ga0213876_10000061 3300021384 Bacteria 130591
173 Ga0209760_100002 3300025207 Bacteria 274743
174 Ga0209760_101417 3300025207 Bacteria 2554
175 Ga0209784_100001 3300025224 Bacteria 3600592
176 Ga0209566_100001 3300025225 Bacteria 3600765
177 Ga0209674_100002 3300025226 Bacteria 3600592
178 Ga0209563_100002 3300025230 Bacteria 2045675
179 Ga0207427_100009 3300025231 Bacteria 663036
180 Ga0209437_100001 3300025233 Bacteria 2045675
181 Ga0209437_100035 3300025233 Bacteria 481110
182 Ga0207425_1018569 3300025245 Bacteria 1507
183 Ga0209677_100002 3300025253 Bacteria 2045675
184 Ga0209129_1000018 3300025258 Bacteria 469298
185 Ga0209233_1002972 3300025261 Bacteria 6041
186 Ga0209233_1006105 3300025261 Bacteria 3920
187 Ga0207656_10037636 3300025321 Bacteria 2037
188 Ga0207696_1000001 3300025711 Bacteria 2579611
189 Ga0207696_1000004 3300025711 Bacteria 671626
190 Ga0207696_1000049 3300025711 Bacteria 281296
191 Ga0207696_1000053 3300025711 Bacteria 268590
192 Ga0207696_1000059 3300025711 Bacteria 245763
193 Ga0207696_1000169 3300025711 Bacteria 103182
194 Ga0207696_1000538 3300025711 Bacteria 30727
195 Ga0207696_1000596 3300025711 Bacteria 27424
196 Ga0207696_1000838 3300025711 Bacteria 19509
197 Ga0207696_1001488 3300025711 Bacteria 12626
198 Ga0207696_1002420 3300025711 Bacteria 9158
199 Ga0207696_1013337 3300025711 Bacteria 2869
200 Ga0207696_1034275 3300025711 Bacteria 1517
201 Ga0207655_1000001 3300025728 Bacteria 1866413
202 Ga0207655_1000023 3300025728 Bacteria 467070
203 Ga0207655_1000060 3300025728 Bacteria 260572
204 Ga0207655_1000132 3300025728 Bacteria 146767
205 Ga0207655_1000155 3300025728 Bacteria 125949
206 Ga0207655_1000283 3300025728 Bacteria 77444
207 Ga0207655_1000344 3300025728 Bacteria 67472
208 Ga0207655_1000356 3300025728 Bacteria 65395
209 Ga0207655_1001066 3300025728 Bacteria 27282
210 Ga0207655_1002185 3300025728 Bacteria 16238
211 Ga0207655_1003536 3300025728 Bacteria 11578
212 Ga0207655_1004058 3300025728 Bacteria 10543
213 Ga0207655_1005896 3300025728 Bacteria 8214
214 Ga0207655_1006737 3300025728 Bacteria 7562
215 Ga0207655_1011519 3300025728 Bacteria 5257
216 Ga0207655_1011628 3300025728 Bacteria 5219
217 Ga0207655_1025319 3300025728 Bacteria 2883
218 Ga0207655_1027205 3300025728 Bacteria 2729
219 Ga0207655_1037615 3300025728 Bacteria 2128
220 Ga0207655_1045183 3300025728 Bacteria 1842
221 Ga0207655_1084094 3300025728 Bacteria 1139
222 Ga0207655_1088629 3300025728 Bacteria 1095
223 Ga0207655_1103622 3300025728 Bacteria 975
224 Ga0207655_1107716 3300025728 Bacteria 947
225 Ga0207713_1000001 3300025735 Bacteria 2295391
226 Ga0207713_1000006 3300025735 Bacteria 586163
227 Ga0207713_1000059 3300025735 Bacteria 214031
228 Ga0207713_1000092 3300025735 Bacteria 148309
229 Ga0207713_1000105 3300025735 Bacteria 138195
230 Ga0207713_1000111 3300025735 Bacteria 133625
231 Ga0207713_1000142 3300025735 Bacteria 107313
232 Ga0207713_1000210 3300025735 Bacteria 79111
233 Ga0207713_1002407 3300025735 Bacteria 13660
234 Ga0207713_1004665 3300025735 Bacteria 8840
235 Ga0207713_1005171 3300025735 Bacteria 8247
236 Ga0207713_1010861 3300025735 Bacteria 5005
237 Ga0207713_1017157 3300025735 Bacteria 3644
238 Ga0207713_1018817 3300025735 Bacteria 3403
239 Ga0207713_1024838 3300025735 Bacteria 2781
240 Ga0207713_1025710 3300025735 Bacteria 2711
241 Ga0207713_1027538 3300025735 Bacteria 2580
242 Ga0207713_1042716 3300025735 Bacteria 1879
243 Ga0207713_1050954 3300025735 Bacteria 1649
244 Ga0207713_1051561 3300025735 Bacteria 1635
245 Ga0207713_1060779 3300025735 Bacteria 1441
246 Ga0207713_1064268 3300025735 Bacteria 1382
247 Ga0207713_1094431 3300025735 Bacteria 1044
248 Ga0207713_1096044 3300025735 Bacteria 1032
249 Ga0207713_1113354 3300025735 Bacteria 919
250 Ga0207710_10000074 3300025900 Bacteria 147390
251 Ga0207654_10000007 3300025911 Bacteria 384211
252 Ga0207695_10271561 3300025913 Bacteria 1591
253 Ga0207695_10537184 3300025913 Bacteria 1051
254 Ga0207671_10221707 3300025914 Bacteria 1481
255 Ga0207690_10022408 3300025932 Bacteria 3930
256 Ga0207690_10092869 3300025932 Bacteria 2137
257 Ga0207709_10000782 3300025935 Bacteria 24878
258 Ga0207709_10272757 3300025935 Bacteria 1246
259 Ga0207709_10314401 3300025935 Bacteria 1170
260 Ga0207668_10071700 3300025972 Bacteria 2475
261 Ga0207668_10100567 3300025972 Bacteria 2147
262 Ga0207674_10004131 3300026116 Bacteria 17558
263 Ga0209281_1000001 3300027111 Bacteria 1933496
264 Ga0209281_1000027 3300027111 Bacteria 463409
265 Ga0209281_1000101 3300027111 Bacteria 222707
266 Ga0209281_1000148 3300027111 Bacteria 168332
267 Ga0209281_1000203 3300027111 Bacteria 134489
268 Ga0209281_1000204 3300027111 Bacteria 134173
269 Ga0209281_1000240 3300027111 Bacteria 110623
270 Ga0209281_1000406 3300027111 Bacteria 65607
271 Ga0209281_1000504 3300027111 Bacteria 51800
272 Ga0209281_1000861 3300027111 Bacteria 26562
273 Ga0209281_1002255 3300027111 Bacteria 8166
274 Ga0209281_1008687 3300027111 Bacteria 2444
275 Ga0209371_1000001 3300027312 Bacteria 2771503
276 Ga0209371_1000010 3300027312 Bacteria 922021
277 Ga0209371_1000047 3300027312 Bacteria 304732
278 Ga0209371_1000056 3300027312 Bacteria 242255
279 Ga0209371_1000097 3300027312 Bacteria 159855
280 Ga0209371_1000105 3300027312 Bacteria 147017
281 Ga0209371_1000215 3300027312 Bacteria 78569
282 Ga0209371_1000646 3300027312 Bacteria 30545
283 Ga0209371_1000669 3300027312 Bacteria 29878
284 Ga0209371_1000695 3300027312 Bacteria 28605
285 Ga0209371_1000951 3300027312 Bacteria 22536
286 Ga0209371_1000967 3300027312 Bacteria 22274
287 Ga0209371_1001006 3300027312 Bacteria 21607
288 Ga0209371_1001146 3300027312 Bacteria 19400
289 Ga0209371_1003729 3300027312 Bacteria 7140
290 Ga0209371_1005642 3300027312 Bacteria 4901
291 Ga0209371_1007936 3300027312 Bacteria 3605
292 Ga0209371_1007977 3300027312 Bacteria 3589
293 Ga0209371_1009157 3300027312 Bacteria 3181
294 Ga0209371_1015216 3300027312 Bacteria 2077
295 Ga0209371_1015324 3300027312 Bacteria 2065
296 Ga0209371_1017753 3300027312 Bacteria 1831
297 Ga0268266_10000100 3300028379 Bacteria 180900
298 Ga0268266_10096298 3300028379 Bacteria 2601
299 Ga0268266_10163387 3300028379 Bacteria 2016
300 Ga0268256_1000001 3300030500 Bacteria 2771065
301 Ga0268256_1000003 3300030500 Bacteria 1289401
302 Ga0268256_1000022 3300030500 Bacteria 531115
303 Ga0268256_1000073 3300030500 Bacteria 184170
304 Ga0268256_1000126 3300030500 Bacteria 109559
305 Ga0268256_1000172 3300030500 Bacteria 78620
306 Ga0268256_1000574 3300030500 Bacteria 29639
307 Ga0268256_1000577 3300030500 Bacteria 29473
308 Ga0268256_1000791 3300030500 Bacteria 22802
309 Ga0268256_1000867 3300030500 Bacteria 21093
310 Ga0268256_1001047 3300030500 Bacteria 18547
311 Ga0268256_1002897 3300030500 Bacteria 8235
312 Ga0268256_1003740 3300030500 Bacteria 6681
313 Ga0268256_1004291 3300030500 Bacteria 5971
314 Ga0268256_1005579 3300030500 Bacteria 4901
315 Ga0268256_1008004 3300030500 Bacteria 3677
316 Ga0268256_1016688 3300030500 Bacteria 2094
317 Ga0268256_1018583 3300030500 Bacteria 1924
318 Ga0268256_1019807 3300030500 Bacteria 1831
319 Ga0316183_1148904 3300030742 Bacteria 1160
320 Ga0436365_1910565 3300039437 Bacteria 475219
321 Ga0439438_000001 3300041405 Bacteria 1263568
322 Ga0439438_013337 3300041405 Bacteria 2483
323 Ga0439438_018280 3300041405 Bacteria 1999
324 Ga0439447_006406 3300041407 Bacteria 3825
325 Ga0439447_006415 3300041407 Bacteria 3822
326 Ga0439447_011461 3300041407 Bacteria 2585
327 Ga0439466_0000003 3300041411 Bacteria 486229
328 Ga0439432_006788 3300042006 Bacteria 4074
329 Ga0439432_008405 3300042006 Bacteria 3625
330 Ga0439432_008424 3300042006 Bacteria 3621
331 Ga0439452_000001 3300042010 Bacteria 1725439
332 Ga0439452_000003 3300042010 Bacteria 942815
333 Ga0439452_000008 3300042010 Bacteria 569877
334 Ga0439452_000030 3300042010 Bacteria 197288
335 Ga0439452_000237 3300042010 Bacteria 38114
336 Ga0439452_002293 3300042010 Bacteria 7150
337 Ga0439452_007806 3300042010 Bacteria 3250
338 Ga0439463_006343 3300042016 Bacteria 2934
339 Ga0450902_019205 3300042137 Bacteria 1124
340 Ga0450907_000788 3300042146 Bacteria 7916
341 Ga0439464_0004022 3300042439 Bacteria 3742
342 Ga0466981_0000005 3300044669 Bacteria 165643
343 Ga0495627_000018 3300046453 Bacteria 315125
344 Ga0495627_015211 3300046453 Bacteria 2661
345 Ga0495591_000014 3300046458 Bacteria 254281
346 Ga0495591_000160 3300046458 Bacteria 71250
347 Ga0495591_002208 3300046458 Bacteria 11109
348 Ga0495591_007224 3300046458 Bacteria 4753
349 Ga0495638_0005900 3300046460 Bacteria 9000
350 Ga0495650_0000018 3300046471 Bacteria 538888
351 Ga0495650_0000021 3300046471 Bacteria 531242
352 Ga0495650_0000032 3300046471 Bacteria 425389
353 Ga0495650_0018784 3300046471 Bacteria 3426
354 Ga0495650_0026948 3300046471 Bacteria 2663
355 Ga0495605_0024915 3300046474 Bacteria 3123
356 Ga0495584_0017962 3300046491 Bacteria 3596
357 Ga0495585_0062937 3300046492 Bacteria 2037
358 Ga0495606_0002072 3300046507 Bacteria 24500
359 Ga0495620_0023359 3300046515 Bacteria 2958
360 Ga0495644_0002443 3300046523 Bacteria 7417
361 Ga0495648_0001904 3300046524 Bacteria 19924
362 Ga0495648_0007155 3300046524 Bacteria 8968
363 Ga0495654_0000049 3300046530 Bacteria 147151
364 Ga0495654_0000052 3300046530 Bacteria 145382
365 Ga0495654_0000707 3300046530 Bacteria 26168
366 Ga0495654_0030293 3300046530 Bacteria 2754
367 Ga0495597_0013052 3300046542 Bacteria 3988
368 Ga0495625_0000891 3300046660 Bacteria 40287
369 Ga0495588_0015337 3300046674 Bacteria 3686
370 Ga0495671_0007030 3300046692 Bacteria 6450
371 Ga0495649_0001132 3300046694 Bacteria 20735
372 Ga0495649_0001135 3300046694 Bacteria 20732
373 Ga0495649_0057909 3300046694 Bacteria 2089
374 Ga0495649_0112665 3300046694 Bacteria 1442
375 Ga0495589_0000002 3300046794 Bacteria 758846
376 Ga0495589_0016291 3300046794 Bacteria 3821
377 Ga0495660_0000004 3300046810 Bacteria 1003183
378 Ga0495660_0000038 3300046810 Bacteria 188167
379 Ga0495660_0017998 3300046810 Bacteria 4065
380 Ga0495672_0000002 3300047320 Bacteria 740116
381 Ga0495672_0000012 3300047320 Bacteria 519975
382 Ga0495672_0000249 3300047320 Bacteria 75347
383 Ga0495676_0257647 3300047321 Bacteria 1188
384 Ga0495679_000369 3300047446 Bacteria 34862
385 Ga0495679_005750 3300047446 Bacteria 5461
386 Ga0495679_012262 3300047446 Bacteria 3269
387 Ga0495679_044205 3300047446 Bacteria 1365
388 Ga0495673_0000022 3300047469 Bacteria 544086
389 Ga0495673_0000095 3300047469 Bacteria 183429
390 Ga0495681_0106787 3300047470 Bacteria 1217
391 Ga0496100_0373596 3300048903 Bacteria 1081
392 Ga0496101_0000076 3300048904 Bacteria 111590
393 Ga0496102_0003536 3300048905 Bacteria 13243
394 Ga0496102_0040848 3300048905 Bacteria 4198
395 Ga0496103_0207517 3300048906 Bacteria 1260
396 Ga0496104_0001472 3300048907 Bacteria 20334
397 Ga0496104_0001542 3300048907 Bacteria 19895
398 Ga0496104_0469749 3300048907 Bacteria 1169
399 Ga0496105_0016667 3300048908 Bacteria 5869
400 Ga0496105_0100676 3300048908 Bacteria 2386
401 Ga0496105_0218048 3300048908 Bacteria 1553
402 Ga0496105_0456008 3300048908 Bacteria 1008
403 Ga0496116_0000023 3300048919 Bacteria 475792
404 Ga0496116_0000083 3300048919 Bacteria 220955
405 Ga0496116_0000298 3300048919 Bacteria 83671
406 Ga0496116_0000460 3300048919 Bacteria 56287
407 Ga0496116_0000487 3300048919 Bacteria 54571
408 Ga0496116_0007683 3300048919 Bacteria 9508
409 Ga0496116_0011721 3300048919 Bacteria 7223
410 Ga0496116_0022713 3300048919 Bacteria 4693
411 Ga0496116_0023969 3300048919 Bacteria 4526
412 Ga0496116_0040396 3300048919 Bacteria 3212
413 Ga0496116_0055430 3300048919 Bacteria 2604
414 Ga0496117_0000004 3300048920 Bacteria 877131
415 Ga0496117_0000131 3300048920 Bacteria 162788
416 Ga0496117_0001846 3300048920 Bacteria 28612
417 Ga0496117_0001904 3300048920 Bacteria 27998
418 Ga0496117_0004395 3300048920 Bacteria 15605
419 Ga0496117_0006883 3300048920 Bacteria 11284
420 Ga0496117_0011816 3300048920 Bacteria 7772
421 Ga0496117_0015283 3300048920 Bacteria 6554
422 Ga0496117_0028493 3300048920 Bacteria 4324
423 Ga0496117_0029098 3300048920 Bacteria 4265
424 Ga0496117_0034763 3300048920 Bacteria 3792
425 Ga0496117_0036534 3300048920 Bacteria 3674
426 Ga0496117_0046440 3300048920 Bacteria 3123
427 Ga0496117_0047723 3300048920 Bacteria 3067
428 Ga0496117_0053991 3300048920 Bacteria 2818
429 Ga0496117_0197487 3300048920 Bacteria 1140
430 Ga0496117_0254704 3300048920 Bacteria 955
431 Ga0496117_0320344 3300048920 Bacteria 812
432 Ga0496117_0343454 3300048920 Bacteria 774
433 Ga0496118_0000024 3300048921 Bacteria 385236
434 Ga0496118_0001997 3300048921 Bacteria 28918
435 Ga0496118_0002117 3300048921 Bacteria 27819
436 Ga0496118_0003269 3300048921 Bacteria 20643
437 Ga0496118_0004340 3300048921 Bacteria 16882
438 Ga0496118_0004726 3300048921 Bacteria 15937
439 Ga0496118_0013702 3300048921 Bacteria 7649
440 Ga0496118_0024772 3300048921 Bacteria 5168
441 Ga0496118_0033081 3300048921 Bacteria 4249
442 Ga0496118_0041457 3300048921 Bacteria 3644
443 Ga0496118_0059231 3300048921 Bacteria 2853
444 Ga0496118_0070448 3300048921 Bacteria 2524
445 Ga0496118_0075486 3300048921 Bacteria 2403
446 Ga0496118_0084913 3300048921 Bacteria 2207
447 Ga0496118_0127045 3300048921 Bacteria 1646
448 Ga0496118_0128540 3300048921 Bacteria 1632
449 Ga0496118_0135845 3300048921 Bacteria 1569
450 Ga0496118_0157116 3300048921 Bacteria 1412
451 Ga0496118_0268582 3300048921 Bacteria 957
452 Ga0496119_0000008 3300048922 Bacteria 446822
453 Ga0496119_0000056 3300048922 Bacteria 174042
454 Ga0496119_0000068 3300048922 Bacteria 158748
455 Ga0496119_0000599 3300048922 Bacteria 48766
456 Ga0496119_0001030 3300048922 Bacteria 35723
457 Ga0496119_0001264 3300048922 Bacteria 31441
458 Ga0496119_0004277 3300048922 Bacteria 14301
459 Ga0496119_0008836 3300048922 Bacteria 8761
460 Ga0496119_0021556 3300048922 Bacteria 4651
461 Ga0496119_0032923 3300048922 Bacteria 3448
462 Ga0496119_0038348 3300048922 Bacteria 3098
463 Ga0496119_0043137 3300048922 Bacteria 2853
464 Ga0496119_0046001 3300048922 Bacteria 2730
465 Ga0496119_0047518 3300048922 Bacteria 2669
466 Ga0496119_0053716 3300048922 Bacteria 2458
467 Ga0496119_0102671 3300048922 Bacteria 1602
468 Ga0496120_0000046 3300048923 Bacteria 190675
469 Ga0496120_0000063 3300048923 Bacteria 170325
470 Ga0496120_0000366 3300048923 Bacteria 73355
471 Ga0496120_0000680 3300048923 Bacteria 49946
472 Ga0496120_0000712 3300048923 Bacteria 48818
473 Ga0496120_0001102 3300048923 Bacteria 35262
474 Ga0496120_0001204 3300048923 Bacteria 32798
475 Ga0496120_0001303 3300048923 Bacteria 30997
476 Ga0496120_0002992 3300048923 Bacteria 16054
477 Ga0496120_0005112 3300048923 Bacteria 10607
478 Ga0496120_0008220 3300048923 Bacteria 7634
479 Ga0496120_0033015 3300048923 Bacteria 3113
480 Ga0496120_0038605 3300048923 Bacteria 2823
481 Ga0496120_0057375 3300048923 Bacteria 2191
482 Ga0496120_0136609 3300048923 Bacteria 1249
483 Ga0496121_0000047 3300048924 Bacteria 335768
484 Ga0496121_0001421 3300048924 Bacteria 40504
485 Ga0496121_0002086 3300048924 Bacteria 31541
486 Ga0496121_0002854 3300048924 Bacteria 25493
487 Ga0496121_0003230 3300048924 Bacteria 23440
488 Ga0496121_0005091 3300048924 Bacteria 17141
489 Ga0496121_0010784 3300048924 Bacteria 10243
490 Ga0496121_0018365 3300048924 Bacteria 7056
491 Ga0496121_0026603 3300048924 Bacteria 5443
492 Ga0496121_0103180 3300048924 Bacteria 2194
493 Ga0496121_0226723 3300048924 Bacteria 1311
494 Ga0496121_0310780 3300048924 Bacteria 1065
495 Ga0496122_0000099 3300048925 Bacteria 198412
496 Ga0496122_0000135 3300048925 Bacteria 170955
497 Ga0496122_0001448 3300048925 Bacteria 38341
498 Ga0496122_0002083 3300048925 Bacteria 29658
499 Ga0496122_0003773 3300048925 Bacteria 19531
500 Ga0496122_0004020 3300048925 Bacteria 18721
501 Ga0496122_0014431 3300048925 Bacteria 7641
502 Ga0496122_0017318 3300048925 Bacteria 6747
503 Ga0496122_0019055 3300048925 Bacteria 6293
504 Ga0496122_0019278 3300048925 Bacteria 6241
505 Ga0496122_0027114 3300048925 Bacteria 4910
506 Ga0496122_0031874 3300048925 Bacteria 4372
507 Ga0496122_0034629 3300048925 Bacteria 4128
508 Ga0496122_0037622 3300048925 Bacteria 3891
509 Ga0496122_0056764 3300048925 Bacteria 2915
510 Ga0496122_0063640 3300048925 Bacteria 2689
511 Ga0496122_0067705 3300048925 Bacteria 2569
512 Ga0496122_0164420 3300048925 Bacteria 1348
513 Ga0496122_0172290 3300048925 Bacteria 1302
514 Ga0496123_0000004 3300048926 Bacteria 777230
515 Ga0496123_0000005 3300048926 Bacteria 658131
516 Ga0496123_0000126 3300048926 Bacteria 155732
517 Ga0496123_0001188 3300048926 Bacteria 38341
518 Ga0496123_0003627 3300048926 Bacteria 17088
519 Ga0496123_0003811 3300048926 Bacteria 16471
520 Ga0496123_0008336 3300048926 Bacteria 9537
521 Ga0496123_0010428 3300048926 Bacteria 8214
522 Ga0496123_0012419 3300048926 Bacteria 7262
523 Ga0496123_0013435 3300048926 Bacteria 6875
524 Ga0496123_0024194 3300048926 Bacteria 4622
525 Ga0496123_0026496 3300048926 Bacteria 4340
526 Ga0496123_0101305 3300048926 Bacteria 1674
527 Ga0496123_0115035 3300048926 Bacteria 1527
528 Ga0496123_0128357 3300048926 Bacteria 1410
529 Ga0496123_0134116 3300048926 Bacteria 1366
530 Ga0496123_0134386 3300048926 Bacteria 1364
531 Ga0496124_0000017 3300048927 Bacteria 444389
532 Ga0496124_0000101 3300048927 Bacteria 180325
533 Ga0496124_0000140 3300048927 Bacteria 149743
534 Ga0496124_0000270 3300048927 Bacteria 99711
535 Ga0496124_0000451 3300048927 Bacteria 72191
536 Ga0496124_0002064 3300048927 Bacteria 27211
537 Ga0496124_0009975 3300048927 Bacteria 9702
538 Ga0496124_0018351 3300048927 Bacteria 6553
539 Ga0496124_0021397 3300048927 Bacteria 5960
540 Ga0496124_0024549 3300048927 Bacteria 5477
541 Ga0496124_0044827 3300048927 Bacteria 3793
542 Ga0496124_0062405 3300048927 Bacteria 3118
543 Ga0496124_0063595 3300048927 Bacteria 3082
544 Ga0496124_0077598 3300048927 Bacteria 2739
545 Ga0496124_0092985 3300048927 Bacteria 2455
546 Ga0496124_0099975 3300048927 Bacteria 2351
547 Ga0496124_0104589 3300048927 Bacteria 2289
548 Ga0496124_0220104 3300048927 Bacteria 1428
549 Ga0496124_0250529 3300048927 Bacteria 1310
550 Ga0496124_0253870 3300048927 Bacteria 1298
551 Ga0496124_0279268 3300048927 Bacteria 1218
552 Ga0496125_0000091 3300048928 Bacteria 212668
553 Ga0496125_0000131 3300048928 Bacteria 162607
554 Ga0496125_0008405 3300048928 Bacteria 10812
555 Ga0496125_0021179 3300048928 Bacteria 6074
556 Ga0496125_0021293 3300048928 Bacteria 6054
557 Ga0496125_0035342 3300048928 Bacteria 4385
558 Ga0496125_0048443 3300048928 Bacteria 3543
559 Ga0496125_0058582 3300048928 Bacteria 3110
560 Ga0496125_0198067 3300048928 Bacteria 1318
561 Ga0496125_0331720 3300048928 Bacteria 917
562 Ga0496126_0000300 3300048929 Bacteria 105128
563 Ga0496126_0009092 3300048929 Bacteria 10612
564 Ga0496126_0041396 3300048929 Bacteria 4263
565 Ga0496126_0044069 3300048929 Bacteria 4111
566 Ga0496126_0051604 3300048929 Bacteria 3743
567 Ga0496126_0053886 3300048929 Bacteria 3646
568 Ga0496126_0053989 3300048929 Bacteria 3642
569 Ga0496126_0066845 3300048929 Bacteria 3213
570 Ga0496126_0074676 3300048929 Bacteria 3010
571 Ga0496126_0164105 3300048929 Bacteria 1897
572 Ga0496126_0186933 3300048929 Bacteria 1756
573 Ga0496126_0205284 3300048929 Bacteria 1661
574 Ga0496126_0245338 3300048929 Bacteria 1494
575 Ga0496126_0353499 3300048929 Bacteria 1201
576 Ga0495678_000360 3300049459 Bacteria 46626
577 Ga0495682_0000015 3300049460 Bacteria 235048
578 Ga0501047_0563973 3300049581 Bacteria 962
579 Ga0501073_0398333 3300049589 Bacteria 951
580 Ga0501080_0113596 3300049742 Bacteria 2511
581 Ga0501083_0019362 3300049744 Bacteria 4742
582 nmdc:mga00v17_115318_c1 3300050491 Bacteria 1707
583 nmdc:mga00v17_133107_c1 3300050491 Bacteria 1590
584 nmdc:mga00v17_46659_c1 3300050491 Bacteria 2622
585 nmdc:mga00v17_47482_c1 3300050491 Bacteria 2601
586 nmdc:mga00v17_55251_c1 3300050491 Bacteria 2425
587 nmdc:mga00v17_5843_c1 3300050491 Bacteria 6497
588 nmdc:mga0k408_2863_c2 3300050493 Bacteria 2201
589 Ga0500621_000001 3300053126 Bacteria 1049698
590 Ga0501082_0094227 3300060353 Bacteria 2587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0563973 Ga0501047_0563973_168_947 222
2 3300049742 Ga0501080_0113596 Ga0501080_0113596_14_793 222
3 3300049744 Ga0501083_0019362 Ga0501083_0019362_1644_2423 222
4 3300060353 Ga0501082_0094227 Ga0501082_0094227_1631_2410 222
5 3300013100 Ga0157373_10000286 Ga0157373_100002861 229
6 iso_pu_bacteria 2599185169 2599412462 238
7 iso_pu_bacteria 2600255254 2601524897 238
8 iso_pu_bacteria 2600255255 2601530116 238
9 iso_pu_bacteria 2600255280 2601617281 238
10 iso_pu_bacteria 2600255281 2601622032 238
11 iso_pu_bacteria 2600255287 2601645576 238
12 iso_pu_bacteria 2600255288 2601650038 238
13 iso_pu_bacteria 2600255289 2601655327 238
14 iso_pu_bacteria 2600255290 2601660562 238
15 iso_pu_bacteria 2600255291 2601665716 238
16 iso_pu_bacteria 2600255298 2601698574 238
17 iso_pu_bacteria 2600255299 2601703724 238
18 iso_pu_bacteria 2600255300 2601707998 238
19 iso_pu_bacteria 2600255301 2601713027 238
20 iso_pu_bacteria 2600255302 2601718255 238
21 iso_pu_bacteria 2600255303 2601723661 238
22 iso_pu_bacteria 2600255304 2601728542 238
23 iso_pu_bacteria 2600255305 2601733201 238
24 iso_pu_bacteria 2600255306 2601737685 238
25 iso_pu_bacteria 2600255307 2601742070 238
26 iso_pu_bacteria 2600255309 2601753004 238
27 iso_pu_bacteria 2600255392 2602019492 238
28 iso_pu_bacteria 2602042052 2603663250 238
29 iso_pu_bacteria 2602042053 2603668452 238
30 iso_pu_bacteria 2602042103 2603840957 238
31 iso_pu_bacteria 2602042104 2603846057 238
32 iso_pu_bacteria 2602042105 2603851104 238
33 iso_pu_bacteria 2602042106 2603856199 238
34 iso_pu_bacteria 2602042110 2603873778 238
35 iso_pu_bacteria 2602042111 2603879152 238
36 iso_pu_bacteria 2603880178 2606050958 238
37 iso_pu_bacteria 2603880184 2606072875 238
38 iso_pu_bacteria 2603880202 2606148616 238
39 iso_pu_bacteria 2603880211 2606178849 238
40 iso_pu_bacteria 2636415599 2637227472 238
41 iso_pu_bacteria 2675903046 2676409228 238
42 iso_pu_bacteria 2775507074 2777021842 238
43 iso_pu_bacteria 2791354903 2791924914 238
44 iso_pu_bacteria 2846540461 2846542070 238
45 iso_pu_bacteria 2904513164 2904515810 238
46 iso_pu_bacteria 2919108558 2919113332 238
47 iso_pu_bacteria 2969079654 2969084510 238
48 iso_pu_bacteria 2984559226 2984561627 238
49 iso_pu_bacteria 2984595703 2984599692 238
50 iso_pu_bacteria 2506520007 2506577690 239
51 iso_pu_bacteria 2506520008 2506582828 239
52 iso_pu_bacteria 2508501071 2508851623 239
53 iso_pu_bacteria 2511231025 2511378658 239
54 iso_pu_bacteria 2511231025 2511378661 239
55 iso_pu_bacteria 2511231035 2511434202 239
56 iso_pu_bacteria 2511231035 2511434205 239
57 iso_pu_bacteria 2537561728 2538424252 239
58 iso_pu_bacteria 2547132181 2547694720 239
59 iso_pu_bacteria 2547132181 2547694723 239
60 iso_pu_bacteria 2547132416 2548651730 239
61 iso_pu_bacteria 2554235234 2555261405 239
62 iso_pu_bacteria 2554235234 2555261408 239
63 iso_pu_bacteria 2561511199 2562466751 239
64 iso_pu_bacteria 2561511199 2562466754 239
65 iso_pu_bacteria 2585427591 2585825791 239
66 iso_pu_bacteria 2585427591 2585825794 239
67 iso_pu_bacteria 2585427592 2585832530 239
68 iso_pu_bacteria 2585427592 2585832533 239
69 iso_pu_bacteria 2599185169 2599410650 239
70 iso_pu_bacteria 2599185299 2599927420 239
71 iso_pu_bacteria 2599185299 2599927423 239
72 iso_pu_bacteria 2600255254 2601523707 239
73 iso_pu_bacteria 2600255255 2601528866 239
74 iso_pu_bacteria 2600255256 2601532283 239
75 iso_pu_bacteria 2600255257 2601537653 239
76 iso_pu_bacteria 2600255280 2601615699 239
77 iso_pu_bacteria 2600255281 2601620581 239
78 iso_pu_bacteria 2600255287 2601645433 239
79 iso_pu_bacteria 2600255288 2601648978 239
80 iso_pu_bacteria 2600255289 2601653750 239
81 iso_pu_bacteria 2600255290 2601659170 239
82 iso_pu_bacteria 2600255291 2601665580 239
83 iso_pu_bacteria 2600255298 2601698438 239
84 iso_pu_bacteria 2600255299 2601703580 239
85 iso_pu_bacteria 2600255300 2601707673 239
86 iso_pu_bacteria 2600255301 2601712732 239
87 iso_pu_bacteria 2600255302 2601717009 239
88 iso_pu_bacteria 2600255303 2601723517 239
89 iso_pu_bacteria 2600255304 2601724828 239
90 iso_pu_bacteria 2600255305 2601732111 239
91 iso_pu_bacteria 2600255306 2601738011 239
92 iso_pu_bacteria 2600255307 2601742583 239
93 iso_pu_bacteria 2600255309 2601752035 239
94 iso_pu_bacteria 2600255310 2601755999 239
95 iso_pu_bacteria 2600255311 2601761370 239
96 iso_pu_bacteria 2600255392 2602020482 239
97 iso_pu_bacteria 2602042046 2603638604 239
98 iso_pu_bacteria 2602042047 2603643155 239
99 iso_pu_bacteria 2602042047 2603643158 239
100 iso_pu_bacteria 2602042052 2603658729 239
101 iso_pu_bacteria 2602042053 2603668308 239
102 iso_pu_bacteria 2602042066 2603699726 239
103 iso_pu_bacteria 2602042066 2603699729 239
104 iso_pu_bacteria 2602042067 2603703735 239
105 iso_pu_bacteria 2602042067 2603703738 239
106 iso_pu_bacteria 2602042103 2603839355 239
107 iso_pu_bacteria 2602042104 2603844589 239
108 iso_pu_bacteria 2602042105 2603849512 239
109 iso_pu_bacteria 2602042106 2603854580 239
110 iso_pu_bacteria 2602042109 2603865888 239
111 iso_pu_bacteria 2602042109 2603865891 239
112 iso_pu_bacteria 2602042110 2603870007 239
113 iso_pu_bacteria 2602042111 2603874965 239
114 iso_pu_bacteria 2603880178 2606047198 239
115 iso_pu_bacteria 2603880184 2606072731 239
116 iso_pu_bacteria 2603880202 2606146300 239
117 iso_pu_bacteria 2603880211 2606177226 239
118 iso_pu_bacteria 2608642108 2608668839 239
119 iso_pu_bacteria 2609459761 2609913794 239
120 iso_pu_bacteria 2609459761 2609913797 239
121 iso_pu_bacteria 2636415599 2637226204 239
122 iso_pu_bacteria 2648501693 2650896768 239
123 iso_pu_bacteria 2648501693 2650896771 239
124 iso_pu_bacteria 2654587920 2656278627 239
125 iso_pu_bacteria 2667528172 2671102691 239
126 iso_pu_bacteria 2667528172 2671102694 239
127 iso_pu_bacteria 2667528173 2671106936 239
128 iso_pu_bacteria 2667528173 2671106939 239
129 iso_pu_bacteria 2671180115 2671587782 239
130 iso_pu_bacteria 2671180115 2671587785 239
131 iso_pu_bacteria 2675903046 2676407603 239
132 iso_pu_bacteria 2681812866 2681995508 239
133 iso_pu_bacteria 2681812866 2681995511 239
134 iso_pu_bacteria 2681812869 2682007298 239
135 iso_pu_bacteria 2681812869 2682007301 239
136 iso_pu_bacteria 2684622997 2686352767 239
137 iso_pu_bacteria 2684622997 2686352770 239
138 iso_pu_bacteria 2687453601 2689444225 239
139 iso_pu_bacteria 2706794495 2707101843 239
140 iso_pu_bacteria 2706794495 2707101846 239
141 iso_pu_bacteria 2711768156 2712469095 239
142 iso_pu_bacteria 2711768156 2712469098 239
143 iso_pu_bacteria 2751185917 2753855307 239
144 iso_pu_bacteria 2751185917 2753855310 239
145 iso_pu_bacteria 2765235842 2765588248 239
146 iso_pu_bacteria 2765235842 2765588251 239
147 iso_pu_bacteria 2772190666 2772438225 239
148 iso_pu_bacteria 2775506706 2775542042 239
149 iso_pu_bacteria 2775506706 2775542045 239
150 iso_pu_bacteria 2775507074 2777020442 239
151 iso_pu_bacteria 2791355010 2792314961 239
152 iso_pu_bacteria 2791355010 2792314982 239
153 iso_pu_bacteria 2791355275 2793406071 239
154 iso_pu_bacteria 2791355275 2793406074 239
155 iso_pu_bacteria 2806310673 2807178772 239
156 iso_pu_bacteria 2808606414 2809127666 239
157 iso_pu_bacteria 2808606414 2809127669 239
158 iso_pu_bacteria 2811995292 2813729663 239
159 iso_pu_bacteria 2814123068 2814697157 239
160 iso_pu_bacteria 2821118458 2821119105 239
161 iso_pu_bacteria 2821118458 2821119108 239
162 iso_pu_bacteria 2823373977 2823374036 239
163 iso_pu_bacteria 2823373977 2823374039 239
164 iso_pu_bacteria 2844425489 2844426844 239
165 iso_pu_bacteria 2844425489 2844426847 239
166 iso_pu_bacteria 2844528606 2844531638 239
167 iso_pu_bacteria 2844528606 2844531641 239
168 iso_pu_bacteria 2847085930 2847088281 239
169 iso_pu_bacteria 2847085930 2847088284 239
170 iso_pu_bacteria 2847797336 2847800550 239
171 iso_pu_bacteria 2847797336 2847800553 239
172 iso_pu_bacteria 2852103415 2852103972 239
173 iso_pu_bacteria 2854601825 2854602406 239
174 iso_pu_bacteria 2854601825 2854602409 239
175 iso_pu_bacteria 2858466076 2858467648 239
176 iso_pu_bacteria 2865014394 2865015803 239
177 iso_pu_bacteria 2865014394 2865015806 239
178 iso_pu_bacteria 2869551831 2869553538 239
179 iso_pu_bacteria 2871272651 2871274177 239
180 iso_pu_bacteria 2871282230 2871285301 239
181 iso_pu_bacteria 2876601092 2876602152 239
182 iso_pu_bacteria 2876601092 2876602155 239
183 iso_pu_bacteria 2881609920 2881613497 239
184 iso_pu_bacteria 2881609920 2881613500 239
185 iso_pu_bacteria 2883291878 2883296973 239
186 iso_pu_bacteria 2883354860 2883359756 239
187 iso_pu_bacteria 2884086401 2884089680 239
188 iso_pu_bacteria 2884086401 2884089683 239
189 iso_pu_bacteria 2888366609 2888368288 239
190 iso_pu_bacteria 2888373701 2888374169 239
191 iso_pu_bacteria 2891670763 2891673701 239
192 iso_pu_bacteria 2904474040 2904475860 239
193 iso_pu_bacteria 2904474040 2904475863 239
194 iso_pu_bacteria 2904504865 2904505311 239
195 iso_pu_bacteria 2904513164 2904517681 239
196 iso_pu_bacteria 2904513164 2904517684 239
197 iso_pu_bacteria 2908669403 2908670822 239
198 iso_pu_bacteria 2919108558 2919111719 239
199 iso_pu_bacteria 2919108558 2919111722 239
200 iso_pu_bacteria 2919150387 2919152029 239
201 iso_pu_bacteria 2919150387 2919152032 239
202 iso_pu_bacteria 2923634449 2923638735 239
203 iso_pu_bacteria 2923634449 2923638738 239
204 iso_pu_bacteria 2927143783 2927144698 239
205 iso_pu_bacteria 2927143783 2927144701 239
206 iso_pu_bacteria 2927833300 2927834766 239
207 iso_pu_bacteria 2927833300 2927834769 239
208 iso_pu_bacteria 2932406140 2932408342 239
209 iso_pu_bacteria 2935625433 2935627292 239
210 iso_pu_bacteria 2935625433 2935627295 239
211 iso_pu_bacteria 2937539931 2937543614 239
212 iso_pu_bacteria 2937539931 2937543617 239
213 iso_pu_bacteria 2937967321 2937969966 239
214 iso_pu_bacteria 2939568625 2939570306 239
215 iso_pu_bacteria 2939568625 2939570309 239
216 iso_pu_bacteria 2939573065 2939575179 239
217 iso_pu_bacteria 2939573065 2939575182 239
218 iso_pu_bacteria 2939577877 2939580003 239
219 iso_pu_bacteria 2939602548 2939602705 239
220 iso_pu_bacteria 2939602548 2939602708 239
221 iso_pu_bacteria 2939607340 2939608170 239
222 iso_pu_bacteria 2939607340 2939608173 239
223 iso_pu_bacteria 2939617950 2939618919 239
224 iso_pu_bacteria 2939617950 2939618922 239
225 iso_pu_bacteria 2939642701 2939644401 239
226 iso_pu_bacteria 2939642701 2939644404 239
227 iso_pu_bacteria 2945874760 2945878766 239
228 iso_pu_bacteria 2945874760 2945878769 239
229 iso_pu_bacteria 2945951305 2945953640 239
230 iso_pu_bacteria 2945951305 2945953643 239
231 iso_pu_bacteria 2969079654 2969083219 239
232 iso_pu_bacteria 2971820967 2971824596 239
233 iso_pu_bacteria 2971820967 2971824599 239
234 iso_pu_bacteria 2974310843 2974312825 239
235 iso_pu_bacteria 2974310843 2974312828 239
236 iso_pu_bacteria 2974435778 2974437783 239
237 iso_pu_bacteria 2974435778 2974437786 239
238 iso_pu_bacteria 2978975091 2978976135 239
239 iso_pu_bacteria 2978975091 2978976138 239
240 iso_pu_bacteria 2984494565 2984495994 239
241 iso_pu_bacteria 2984494565 2984495997 239
242 iso_pu_bacteria 2984559226 2984560235 239
243 iso_pu_bacteria 2984595703 2984598314 239
244 iso_pu_bacteria 2990261002 2990262675 239
245 iso_pu_bacteria 2990261002 2990262678 239
246 iso_pu_bacteria 3000376612 3000379801 239
247 iso_pu_bacteria 3000376612 3000379804 239
248 iso_pu_bacteria 640753048 640937187 239
249 iso_pu_bacteria 8004592986 8004597462 239
250 iso_pu_bacteria 8015394850 8015398180 239
251 iso_pu_bacteria 8016733728 8016736534 239
252 iso_pu_bacteria 8016733728 8016736537 239
253 iso_pu_bacteria 8018221730 8018224268 239
254 iso_pu_bacteria 8018405270 8018407956 239
255 iso_pu_bacteria 8018405270 8018407959 239
256 iso_pu_bacteria 8019499862 8019501771 239
257 iso_pu_bacteria 8019499862 8019501774 239
258 iso_pu_bacteria 8019504834 8019505803 239
259 iso_pu_bacteria 8019504834 8019505806 239
260 iso_pu_bacteria 8054844752 8054846949 239
261 iso_pu_bacteria 8054844752 8054846952 239
262 iso_pu_bacteria 8054849141 8054854121 239
263 iso_pu_bacteria 8054849141 8054854124 239
264 iso_pu_bacteria 8055087960 8055088243 239
265 iso_pu_bacteria 8055087960 8055088246 239
266 iso_pu_bacteria 8055092621 8055093999 239
267 iso_pu_bacteria 8055092621 8055094002 239
268 iso_pu_bacteria 8055097453 8055099416 239
269 iso_pu_bacteria 8055097453 8055099419 239
270 iso_pu_bacteria 8055693939 8055695502 239
271 iso_pu_bacteria 8057304971 8057305734 239
272 iso_pu_bacteria 2600255256 2601532280 240
273 iso_pu_bacteria 2600255257 2601537650 240
274 iso_pu_bacteria 2600255310 2601755996 240
275 iso_pu_bacteria 2600255311 2601761367 240
276 iso_pu_bacteria 2602042046 2603638607 240
277 iso_pu_bacteria 2811995292 2813729666 240
278 iso_pu_bacteria 2814123068 2814697160 240
279 iso_pu_bacteria 2908669403 2908670819 240
280 3300009011 Ga0105251_10000801 Ga0105251_100008013 242
281 3300009011 Ga0105251_10004116 Ga0105251_100041162 242
282 3300009011 Ga0105251_10011846 Ga0105251_100118463 242
283 3300009011 Ga0105251_10055541 Ga0105251_100555412 242
284 3300009036 Ga0105244_10000235 Ga0105244_1000023510 242
285 3300009092 Ga0105250_10000057 Ga0105250_1000005779 242
286 3300009148 Ga0105243_10009796 Ga0105243_100097965 242
287 3300025711 Ga0207696_1000049 Ga0207696_1000049201 242
288 3300025728 Ga0207655_1005896 Ga0207655_10058965 242
289 3300025735 Ga0207713_1000105 Ga0207713_100010528 242
290 3300025735 Ga0207713_1000111 Ga0207713_100011130 242
291 3300025735 Ga0207713_1024838 Ga0207713_10248383 242
292 3300025735 Ga0207713_1042716 Ga0207713_10427162 242
293 3300025935 Ga0207709_10000782 Ga0207709_1000078211 242
294 3300027312 Ga0209371_1001146 Ga0209371_10011463 242
295 3300027312 Ga0209371_1009157 Ga0209371_10091572 242
296 3300030500 Ga0268256_1004291 Ga0268256_10042915 242
297 3300046471 Ga0495650_0026948 Ga0495650_0026948_419_1171 242
298 3300047446 Ga0495679_044205 Ga0495679_044205_92_844 242
299 3300048907 Ga0496104_0469749 Ga0496104_0469749_50_802 242
300 3300048920 Ga0496117_0197487 Ga0496117_0197487_367_1119 242
301 3300048921 Ga0496118_0070448 Ga0496118_0070448_1481_2233 242
302 3300048922 Ga0496119_0008836 Ga0496119_0008836_529_1281 242
303 3300048923 Ga0496120_0038605 Ga0496120_0038605_533_1285 242
304 3300048925 Ga0496122_0164420 Ga0496122_0164420_285_1037 242
305 3300048926 Ga0496123_0134386 Ga0496123_0134386_419_1171 242
306 3300048927 Ga0496124_0250529 Ga0496124_0250529_403_1137 242
307 3300048929 Ga0496126_0041396 Ga0496126_0041396_61_816 242
308 3300048929 Ga0496126_0353499 Ga0496126_0353499_64_816 242
309 3300049589 Ga0501073_0398333 Ga0501073_0398333_75_860 242
310 iso_pu_bacteria 2554235234 2555261700 242
311 iso_pu_bacteria 2602042109 2603869220 242
312 iso_pu_bacteria 2971820967 2971825995 242
313 2010549000 RicEn_C6732 RicEn_118820 243
314 2162886007 SwRhRL2b_contig_1581014 SwRhRL2b_0097.00008380 243
315 2162886007 SwRhRL2b_contig_2251415 SwRhRL2b_0805.00005330 243
316 2162886007 SwRhRL2b_contig_3058281 SwRhRL2b_0024.00003390 243
317 2162886007 SwRhRL2b_contig_3247475 SwRhRL2b_0079.00003230 243
318 2162886007 SwRhRL2b_contig_3785416 SwRhRL2b_0049.00002680 243
319 2162886007 SwRhRL2b_contig_3813720 SwRhRL2b_0378.00002070 243
320 2162886007 SwRhRL2b_contig_985395 SwRhRL2b_0978.00004070 243
321 3300001989 JGI24739J22299_10001393 JGI24739J22299_1000139310 243
322 3300001989 JGI24739J22299_10001393 JGI24739J22299_100013937 243
323 3300002737 JGI25162J39368_1000002 JGI25162J39368_1000002555 243
324 3300002737 JGI25162J39368_1000002 JGI25162J39368_1000002558 243
325 3300002737 JGI25162J39368_1007911 JGI25162J39368_10079112 243
326 3300002771 JGI25163J39215_1000003 JGI25163J39215_100000362 243
327 3300002771 JGI25163J39215_1000003 JGI25163J39215_100000365 243
328 3300002772 JGI25164J39214_1000041 JGI25164J39214_100004162 243
329 3300002772 JGI25164J39214_1000041 JGI25164J39214_100004165 243
330 3300002773 JGI25152J39213_1000230 JGI25152J39213_10002304 243
331 3300002773 JGI25152J39213_1000230 JGI25152J39213_10002307 243
332 3300003751 Ga0055538_1000003 Ga0055538_1000003555 243
333 3300003751 Ga0055538_1000003 Ga0055538_1000003558 243
334 3300003752 Ga0055539_1000003 Ga0055539_100000362 243
335 3300003752 Ga0055539_1000003 Ga0055539_100000365 243
336 3300003756 Ga0055533_1000005 Ga0055533_100000562 243
337 3300003756 Ga0055533_1000005 Ga0055533_100000565 243
338 3300003759 Ga0055525_1000005 Ga0055525_1000005555 243
339 3300003759 Ga0055525_1000005 Ga0055525_1000005558 243
340 3300003841 Ga0055541_1000003 Ga0055541_1000003555 243
341 3300003841 Ga0055541_1000003 Ga0055541_1000003558 243
342 3300003856 Ga0058692_1000268 Ga0058692_100026826 243
343 3300003856 Ga0058692_1000268 Ga0058692_100026829 243
344 3300003856 Ga0058692_1000327 Ga0058692_100032710 243
345 3300003856 Ga0058692_1000327 Ga0058692_100032713 243
346 3300003856 Ga0058692_1000512 Ga0058692_100051212 243
347 3300003856 Ga0058692_1001001 Ga0058692_10010013 243
348 3300003856 Ga0058692_1001001 Ga0058692_10010016 243
349 3300003856 Ga0058692_1001788 Ga0058692_10017883 243
350 3300003856 Ga0058692_1001793 Ga0058692_10017933 243
351 3300003856 Ga0058692_1001993 Ga0058692_10019934 243
352 3300003856 Ga0058692_1005580 Ga0058692_10055802 243
353 3300003856 Ga0058692_1006446 Ga0058692_10064461 243
354 3300003856 Ga0058692_1033834 Ga0058692_10338342 243
355 3300003856 Ga0058692_1035373 Ga0058692_10353731 243
356 3300003856 Ga0058692_1036181 Ga0058692_10361811 243
357 3300003856 Ga0058692_1041447 Ga0058692_10414471 243
358 3300005289 Ga0065704_10000102 Ga0065704_1000010226 243
359 3300005289 Ga0065704_10000102 Ga0065704_1000010229 243
360 3300005289 Ga0065704_10000328 Ga0065704_1000032812 243
361 3300005289 Ga0065704_10000328 Ga0065704_100003289 243
362 3300005289 Ga0065704_10001805 Ga0065704_100018054 243
363 3300005289 Ga0065704_10001805 Ga0065704_100018057 243
364 3300005289 Ga0065704_10001833 Ga0065704_100018335 243
365 3300005289 Ga0065704_10001833 Ga0065704_100018338 243
366 3300005289 Ga0065704_10085231 Ga0065704_100852312 243
367 3300005289 Ga0065704_10085231 Ga0065704_100852315 243
368 3300005289 Ga0065704_10098410 Ga0065704_100984103 243
369 3300005289 Ga0065704_10105214 Ga0065704_101052143 243
370 3300005289 Ga0065704_10126168 Ga0065704_101261682 243
371 3300005347 Ga0070668_100015549 Ga0070668_1000155495 243
372 3300005366 Ga0070659_100013918 Ga0070659_1000139183 243
373 3300005366 Ga0070659_100217972 Ga0070659_1002179721 243
374 3300005548 Ga0070665_100000110 Ga0070665_10000011058 243
375 3300005548 Ga0070665_100000110 Ga0070665_10000011061 243
376 3300005548 Ga0070665_100011851 Ga0070665_1000118514 243
377 3300005577 Ga0068857_100000479 Ga0068857_10000047910 243
378 3300005577 Ga0068857_100000479 Ga0068857_1000004797 243
379 3300006051 Ga0075364_10000400 Ga0075364_1000040023 243
380 3300006051 Ga0075364_10048284 Ga0075364_100482844 243
381 3300006051 Ga0075364_10053668 Ga0075364_100536682 243
382 3300006051 Ga0075364_10065374 Ga0075364_100653743 243
383 3300006051 Ga0075364_10092683 Ga0075364_100926831 243
384 3300006051 Ga0075364_10140557 Ga0075364_101405572 243
385 3300006195 Ga0075366_10004092 Ga0075366_100040923 243
386 3300006946 Ga0079104_1000080 Ga0079104_10000802 243
387 3300006946 Ga0079104_1000080 Ga0079104_10000805 243
388 3300006946 Ga0079104_1000089 Ga0079104_100008944 243
389 3300006946 Ga0079104_1000089 Ga0079104_100008947 243
390 3300006946 Ga0079104_1000121 Ga0079104_100012171 243
391 3300006946 Ga0079104_1000121 Ga0079104_100012174 243
392 3300006946 Ga0079104_1000345 Ga0079104_10003454 243
393 3300006946 Ga0079104_1001450 Ga0079104_10014508 243
394 3300006946 Ga0079104_1001825 Ga0079104_10018252 243
395 3300006946 Ga0079104_1008439 Ga0079104_10084392 243
396 3300006946 Ga0079104_1015031 Ga0079104_10150312 243
397 3300006946 Ga0079104_1016914 Ga0079104_10169142 243
398 3300006946 Ga0079104_1019071 Ga0079104_10190712 243
399 3300009011 Ga0105251_10000280 Ga0105251_1000028054 243
400 3300009011 Ga0105251_10000349 Ga0105251_1000034945 243
401 3300009011 Ga0105251_10000431 Ga0105251_1000043115 243
402 3300009011 Ga0105251_10000431 Ga0105251_1000043118 243
403 3300009011 Ga0105251_10001221 Ga0105251_100012214 243
404 3300009011 Ga0105251_10002143 Ga0105251_1000214318 243
405 3300009011 Ga0105251_10002544 Ga0105251_1000254412 243
406 3300009011 Ga0105251_10002544 Ga0105251_1000254415 243
407 3300009011 Ga0105251_10002780 Ga0105251_1000278011 243
408 3300009011 Ga0105251_10003006 Ga0105251_100030061 243
409 3300009011 Ga0105251_10005723 Ga0105251_100057239 243
410 3300009011 Ga0105251_10012693 Ga0105251_100126934 243
411 3300009011 Ga0105251_10030129 Ga0105251_100301293 243
412 3300009011 Ga0105251_10040104 Ga0105251_100401042 243
413 3300009011 Ga0105251_10045149 Ga0105251_100451493 243
414 3300009011 Ga0105251_10058605 Ga0105251_100586052 243
415 3300009011 Ga0105251_10129492 Ga0105251_101294921 243
416 3300009011 Ga0105251_10135865 Ga0105251_101358651 243
417 3300009011 Ga0105251_10196575 Ga0105251_101965751 243
418 3300009036 Ga0105244_10000167 Ga0105244_1000016746 243
419 3300009036 Ga0105244_10000167 Ga0105244_1000016749 243
420 3300009036 Ga0105244_10000239 Ga0105244_1000023921 243
421 3300009036 Ga0105244_10000239 Ga0105244_1000023924 243
422 3300009036 Ga0105244_10000485 Ga0105244_1000048520 243
423 3300009036 Ga0105244_10001569 Ga0105244_100015694 243
424 3300009036 Ga0105244_10001569 Ga0105244_100015697 243
425 3300009036 Ga0105244_10002311 Ga0105244_1000231113 243
426 3300009036 Ga0105244_10004232 Ga0105244_1000423210 243
427 3300009036 Ga0105244_10004232 Ga0105244_100042327 243
428 3300009036 Ga0105244_10005667 Ga0105244_100056671 243
429 3300009036 Ga0105244_10006115 Ga0105244_100061154 243
430 3300009036 Ga0105244_10006115 Ga0105244_100061157 243
431 3300009036 Ga0105244_10015990 Ga0105244_100159905 243
432 3300009036 Ga0105244_10016362 Ga0105244_100163622 243
433 3300009036 Ga0105244_10016362 Ga0105244_100163625 243
434 3300009036 Ga0105244_10016854 Ga0105244_100168543 243
435 3300009036 Ga0105244_10017522 Ga0105244_100175224 243
436 3300009036 Ga0105244_10027379 Ga0105244_100273793 243
437 3300009036 Ga0105244_10027881 Ga0105244_100278813 243
438 3300009036 Ga0105244_10040517 Ga0105244_100405172 243
439 3300009036 Ga0105244_10042926 Ga0105244_100429262 243
440 3300009036 Ga0105244_10045212 Ga0105244_100452122 243
441 3300009036 Ga0105244_10096979 Ga0105244_100969792 243
442 3300009036 Ga0105244_10114208 Ga0105244_101142082 243
443 3300009036 Ga0105244_10166074 Ga0105244_101660741 243
444 3300009036 Ga0105244_10168318 Ga0105244_101683181 243
445 3300009036 Ga0105244_10191869 Ga0105244_101918691 243
446 3300009092 Ga0105250_10000026 Ga0105250_1000002646 243
447 3300009092 Ga0105250_10000026 Ga0105250_1000002654 243
448 3300009092 Ga0105250_10000204 Ga0105250_1000020437 243
449 3300009092 Ga0105250_10000204 Ga0105250_1000020440 243
450 3300009092 Ga0105250_10000439 Ga0105250_1000043926 243
451 3300009092 Ga0105250_10000973 Ga0105250_1000097310 243
452 3300009092 Ga0105250_10000973 Ga0105250_100009737 243
453 3300009092 Ga0105250_10001480 Ga0105250_1000148012 243
454 3300009092 Ga0105250_10001480 Ga0105250_100014809 243
455 3300009092 Ga0105250_10003582 Ga0105250_100035824 243
456 3300009092 Ga0105250_10003582 Ga0105250_100035827 243
457 3300009092 Ga0105250_10016403 Ga0105250_100164033 243
458 3300009092 Ga0105250_10023028 Ga0105250_100230283 243
459 3300009092 Ga0105250_10051274 Ga0105250_100512742 243
460 3300009101 Ga0105247_10000025 Ga0105247_1000002546 243
461 3300009101 Ga0105247_10247269 Ga0105247_102472692 243
462 3300009148 Ga0105243_10004349 Ga0105243_100043494 243
463 3300009148 Ga0105243_10107798 Ga0105243_101077981 243
464 3300009174 Ga0105241_10000005 Ga0105241_1000000561 243
465 3300009545 Ga0105237_10365740 Ga0105237_103657402 243
466 3300009545 Ga0105237_10536812 Ga0105237_105368122 243
467 3300011119 Ga0105246_10008148 Ga0105246_100081483 243
468 3300011119 Ga0105246_10046428 Ga0105246_100464282 243
469 3300013100 Ga0157373_10000286 Ga0157373_100002864 243
470 3300013100 Ga0157373_10007099 Ga0157373_100070995 243
471 3300013100 Ga0157373_10007282 Ga0157373_1000728210 243
472 3300013100 Ga0157373_10007282 Ga0157373_100072827 243
473 3300013100 Ga0157373_10014354 Ga0157373_100143545 243
474 3300013100 Ga0157373_10156271 Ga0157373_101562712 243
475 3300013100 Ga0157373_10418810 Ga0157373_104188102 243
476 3300013102 Ga0157371_10000006 Ga0157371_10000006303 243
477 3300013102 Ga0157371_10000006 Ga0157371_10000006306 243
478 3300013102 Ga0157371_10000353 Ga0157371_1000035329 243
479 3300013102 Ga0157371_10000353 Ga0157371_1000035332 243
480 3300013102 Ga0157371_10001970 Ga0157371_1000197011 243
481 3300013102 Ga0157371_10001970 Ga0157371_1000197014 243
482 3300013102 Ga0157371_10002148 Ga0157371_100021486 243
483 3300013102 Ga0157371_10002148 Ga0157371_100021489 243
484 3300013102 Ga0157371_10021688 Ga0157371_100216883 243
485 3300013102 Ga0157371_10021688 Ga0157371_100216886 243
486 3300013102 Ga0157371_10040327 Ga0157371_100403273 243
487 3300013102 Ga0157371_10048750 Ga0157371_100487501 243
488 3300013102 Ga0157371_10071063 Ga0157371_100710632 243
489 3300013104 Ga0157370_10006410 Ga0157370_1000641012 243
490 3300013104 Ga0157370_10006410 Ga0157370_100064109 243
491 3300013104 Ga0157370_10024391 Ga0157370_100243912 243
492 3300013104 Ga0157370_10024391 Ga0157370_100243915 243
493 3300013105 Ga0157369_10002623 Ga0157369_1000262318 243
494 3300013105 Ga0157369_10002623 Ga0157369_1000262321 243
495 3300013105 Ga0157369_10050809 Ga0157369_100508092 243
496 3300013105 Ga0157369_10179844 Ga0157369_101798442 243
497 3300013306 Ga0163162_10014980 Ga0163162_100149802 243
498 3300013306 Ga0163162_10130019 Ga0163162_101300193 243
499 3300013306 Ga0163162_10218082 Ga0163162_102180822 243
500 3300013306 Ga0163162_11057743 Ga0163162_110577432 243
501 3300013307 Ga0157372_10024555 Ga0157372_100245557 243
502 3300013307 Ga0157372_10025637 Ga0157372_100256379 243
503 3300013307 Ga0157372_10033607 Ga0157372_100336074 243
504 3300013307 Ga0157372_10037403 Ga0157372_100374035 243
505 3300013307 Ga0157372_10037403 Ga0157372_100374038 243
506 3300013307 Ga0157372_10116895 Ga0157372_101168952 243
507 3300013307 Ga0157372_10129060 Ga0157372_101290604 243
508 3300013307 Ga0157372_10130002 Ga0157372_101300024 243
509 3300013307 Ga0157372_10293747 Ga0157372_102937472 243
510 3300014497 Ga0182008_10012759 Ga0182008_100127592 243
511 3300014497 Ga0182008_10012759 Ga0182008_100127595 243
512 3300014497 Ga0182008_10021452 Ga0182008_100214524 243
513 3300015261 Ga0182006_1000086 Ga0182006_100008663 243
514 3300015261 Ga0182006_1000086 Ga0182006_100008666 243
515 3300015261 Ga0182006_1002872 Ga0182006_100287210 243
516 3300015261 Ga0182006_1002872 Ga0182006_10028727 243
517 3300015261 Ga0182006_1083262 Ga0182006_10832622 243
518 3300015262 Ga0182007_10011146 Ga0182007_100111462 243
519 3300015679 Ga0183366_1001 Ga0183366_1001620 243
520 3300015679 Ga0183366_1001 Ga0183366_1001623 243
521 3300015680 Ga0183370_1001 Ga0183370_1001620 243
522 3300015680 Ga0183370_1001 Ga0183370_1001623 243
523 3300015685 Ga0183369_1001 Ga0183369_1001620 243
524 3300015685 Ga0183369_1001 Ga0183369_1001623 243
525 3300015687 Ga0183368_1001 Ga0183368_1001620 243
526 3300015687 Ga0183368_1001 Ga0183368_1001623 243
527 3300017792 Ga0163161_10000001 Ga0163161_10000001403 243
528 3300017792 Ga0163161_10054287 Ga0163161_100542872 243
529 3300017792 Ga0163161_10118235 Ga0163161_101182352 243
530 3300021384 Ga0213876_10000061 Ga0213876_1000006153 243
531 3300021384 Ga0213876_10000061 Ga0213876_1000006156 243
532 3300025207 Ga0209760_100002 Ga0209760_100002154 243
533 3300025207 Ga0209760_100002 Ga0209760_100002157 243
534 3300025207 Ga0209760_101417 Ga0209760_1014173 243
535 3300025224 Ga0209784_100001 Ga0209784_1000012821 243
536 3300025224 Ga0209784_100001 Ga0209784_1000012824 243
537 3300025225 Ga0209566_100001 Ga0209566_1000012821 243
538 3300025225 Ga0209566_100001 Ga0209566_1000012824 243
539 3300025226 Ga0209674_100002 Ga0209674_1000022821 243
540 3300025226 Ga0209674_100002 Ga0209674_1000022824 243
541 3300025230 Ga0209563_100002 Ga0209563_1000021356 243
542 3300025230 Ga0209563_100002 Ga0209563_1000021359 243
543 3300025231 Ga0207427_100009 Ga0207427_100009549 243
544 3300025231 Ga0207427_100009 Ga0207427_100009552 243
545 3300025233 Ga0209437_100001 Ga0209437_1000011356 243
546 3300025233 Ga0209437_100001 Ga0209437_1000011359 243
547 3300025233 Ga0209437_100035 Ga0209437_100035135 243
548 3300025233 Ga0209437_100035 Ga0209437_100035138 243
549 3300025245 Ga0207425_1018569 Ga0207425_10185692 243
550 3300025253 Ga0209677_100002 Ga0209677_1000021356 243
551 3300025253 Ga0209677_100002 Ga0209677_1000021359 243
552 3300025258 Ga0209129_1000018 Ga0209129_100001884 243
553 3300025258 Ga0209129_1000018 Ga0209129_100001887 243
554 3300025261 Ga0209233_1002972 Ga0209233_10029722 243
555 3300025261 Ga0209233_1006105 Ga0209233_10061053 243
556 3300025321 Ga0207656_10037636 Ga0207656_100376361 243
557 3300025711 Ga0207696_1000001 Ga0207696_1000001482 243
558 3300025711 Ga0207696_1000004 Ga0207696_1000004517 243
559 3300025711 Ga0207696_1000053 Ga0207696_1000053143 243
560 3300025711 Ga0207696_1000053 Ga0207696_1000053146 243
561 3300025711 Ga0207696_1000059 Ga0207696_1000059176 243
562 3300025711 Ga0207696_1000059 Ga0207696_1000059184 243
563 3300025711 Ga0207696_1000169 Ga0207696_100016935 243
564 3300025711 Ga0207696_1000169 Ga0207696_100016938 243
565 3300025711 Ga0207696_1000538 Ga0207696_100053815 243
566 3300025711 Ga0207696_1000538 Ga0207696_100053818 243
567 3300025711 Ga0207696_1000596 Ga0207696_10005965 243
568 3300025711 Ga0207696_1000596 Ga0207696_10005968 243
569 3300025711 Ga0207696_1000838 Ga0207696_10008383 243
570 3300025711 Ga0207696_1001488 Ga0207696_10014884 243
571 3300025711 Ga0207696_1001488 Ga0207696_10014887 243
572 3300025711 Ga0207696_1002420 Ga0207696_10024208 243
573 3300025711 Ga0207696_1013337 Ga0207696_10133372 243
574 3300025711 Ga0207696_1034275 Ga0207696_10342752 243
575 3300025728 Ga0207655_1000001 Ga0207655_1000001722 243
576 3300025728 Ga0207655_1000001 Ga0207655_1000001725 243
577 3300025728 Ga0207655_1000023 Ga0207655_100002332 243
578 3300025728 Ga0207655_1000023 Ga0207655_100002335 243
579 3300025728 Ga0207655_1000060 Ga0207655_1000060220 243
580 3300025728 Ga0207655_1000132 Ga0207655_100013230 243
581 3300025728 Ga0207655_1000132 Ga0207655_100013233 243
582 3300025728 Ga0207655_1000155 Ga0207655_100015530 243
583 3300025728 Ga0207655_1000155 Ga0207655_100015533 243
584 3300025728 Ga0207655_1000283 Ga0207655_100028316 243
585 3300025728 Ga0207655_1000344 Ga0207655_100034418 243
586 3300025728 Ga0207655_1000344 Ga0207655_100034421 243
587 3300025728 Ga0207655_1000356 Ga0207655_100035643 243
588 3300025728 Ga0207655_1000356 Ga0207655_100035646 243
589 3300025728 Ga0207655_1001066 Ga0207655_100106627 243
590 3300025728 Ga0207655_1002185 Ga0207655_10021855 243
591 3300025728 Ga0207655_1002185 Ga0207655_10021858 243
592 3300025728 Ga0207655_1003536 Ga0207655_10035366 243
593 3300025728 Ga0207655_1003536 Ga0207655_10035369 243
594 3300025728 Ga0207655_1004058 Ga0207655_10040585 243
595 3300025728 Ga0207655_1004058 Ga0207655_10040588 243
596 3300025728 Ga0207655_1006737 Ga0207655_10067373 243
597 3300025728 Ga0207655_1011519 Ga0207655_10115193 243
598 3300025728 Ga0207655_1011628 Ga0207655_10116284 243
599 3300025728 Ga0207655_1025319 Ga0207655_10253192 243
600 3300025728 Ga0207655_1027205 Ga0207655_10272052 243
601 3300025728 Ga0207655_1037615 Ga0207655_10376152 243
602 3300025728 Ga0207655_1045183 Ga0207655_10451831 243
603 3300025728 Ga0207655_1084094 Ga0207655_10840942 243
604 3300025728 Ga0207655_1088629 Ga0207655_10886292 243
605 3300025728 Ga0207655_1103622 Ga0207655_11036222 243
606 3300025728 Ga0207655_1107716 Ga0207655_11077161 243
607 3300025735 Ga0207713_1000001 Ga0207713_1000001476 243
608 3300025735 Ga0207713_1000001 Ga0207713_1000001479 243
609 3300025735 Ga0207713_1000006 Ga0207713_1000006523 243
610 3300025735 Ga0207713_1000006 Ga0207713_1000006526 243
611 3300025735 Ga0207713_1000059 Ga0207713_1000059137 243
612 3300025735 Ga0207713_1000059 Ga0207713_1000059140 243
613 3300025735 Ga0207713_1000092 Ga0207713_100009251 243
614 3300025735 Ga0207713_1000142 Ga0207713_100014249 243
615 3300025735 Ga0207713_1000210 Ga0207713_100021051 243
616 3300025735 Ga0207713_1000210 Ga0207713_100021054 243
617 3300025735 Ga0207713_1002407 Ga0207713_100240712 243
618 3300025735 Ga0207713_1004665 Ga0207713_10046653 243
619 3300025735 Ga0207713_1005171 Ga0207713_10051719 243
620 3300025735 Ga0207713_1010861 Ga0207713_10108611 243
621 3300025735 Ga0207713_1017157 Ga0207713_10171573 243
622 3300025735 Ga0207713_1018817 Ga0207713_10188173 243
623 3300025735 Ga0207713_1025710 Ga0207713_10257103 243
624 3300025735 Ga0207713_1027538 Ga0207713_10275383 243
625 3300025735 Ga0207713_1050954 Ga0207713_10509542 243
626 3300025735 Ga0207713_1051561 Ga0207713_10515612 243
627 3300025735 Ga0207713_1060779 Ga0207713_10607791 243
628 3300025735 Ga0207713_1064268 Ga0207713_10642682 243
629 3300025735 Ga0207713_1094431 Ga0207713_10944311 243
630 3300025735 Ga0207713_1096044 Ga0207713_10960442 243
631 3300025735 Ga0207713_1113354 Ga0207713_11133541 243
632 3300025900 Ga0207710_10000074 Ga0207710_1000007491 243
633 3300025911 Ga0207654_10000007 Ga0207654_10000007331 243
634 3300025913 Ga0207695_10271561 Ga0207695_102715612 243
635 3300025913 Ga0207695_10537184 Ga0207695_105371842 243
636 3300025914 Ga0207671_10221707 Ga0207671_102217072 243
637 3300025932 Ga0207690_10022408 Ga0207690_100224082 243
638 3300025932 Ga0207690_10092869 Ga0207690_100928692 243
639 3300025935 Ga0207709_10272757 Ga0207709_102727572 243
640 3300025935 Ga0207709_10314401 Ga0207709_103144011 243
641 3300025972 Ga0207668_10071700 Ga0207668_100717003 243
642 3300025972 Ga0207668_10100567 Ga0207668_101005672 243
643 3300026116 Ga0207674_10004131 Ga0207674_1000413112 243
644 3300026116 Ga0207674_10004131 Ga0207674_1000413115 243
645 3300027111 Ga0209281_1000001 Ga0209281_10000011280 243
646 3300027111 Ga0209281_1000001 Ga0209281_10000011283 243
647 3300027111 Ga0209281_1000027 Ga0209281_1000027416 243
648 3300027111 Ga0209281_1000101 Ga0209281_100010169 243
649 3300027111 Ga0209281_1000101 Ga0209281_100010172 243
650 3300027111 Ga0209281_1000148 Ga0209281_100014837 243
651 3300027111 Ga0209281_1000148 Ga0209281_100014840 243
652 3300027111 Ga0209281_1000203 Ga0209281_100020344 243
653 3300027111 Ga0209281_1000203 Ga0209281_100020347 243
654 3300027111 Ga0209281_1000204 Ga0209281_100020465 243
655 3300027111 Ga0209281_1000204 Ga0209281_100020468 243
656 3300027111 Ga0209281_1000240 Ga0209281_100024047 243
657 3300027111 Ga0209281_1000240 Ga0209281_100024050 243
658 3300027111 Ga0209281_1000406 Ga0209281_100040640 243
659 3300027111 Ga0209281_1000406 Ga0209281_100040643 243
660 3300027111 Ga0209281_1000504 Ga0209281_100050430 243
661 3300027111 Ga0209281_1000504 Ga0209281_100050433 243
662 3300027111 Ga0209281_1000861 Ga0209281_10008614 243
663 3300027111 Ga0209281_1000861 Ga0209281_10008617 243
664 3300027111 Ga0209281_1002255 Ga0209281_10022553 243
665 3300027111 Ga0209281_1002255 Ga0209281_10022556 243
666 3300027111 Ga0209281_1008687 Ga0209281_10086872 243
667 3300027312 Ga0209371_1000001 Ga0209371_1000001576 243
668 3300027312 Ga0209371_1000001 Ga0209371_1000001579 243
669 3300027312 Ga0209371_1000010 Ga0209371_1000010382 243
670 3300027312 Ga0209371_1000010 Ga0209371_1000010385 243
671 3300027312 Ga0209371_1000047 Ga0209371_100004748 243
672 3300027312 Ga0209371_1000047 Ga0209371_100004751 243
673 3300027312 Ga0209371_1000056 Ga0209371_1000056196 243
674 3300027312 Ga0209371_1000056 Ga0209371_1000056199 243
675 3300027312 Ga0209371_1000097 Ga0209371_1000097114 243
676 3300027312 Ga0209371_1000097 Ga0209371_1000097117 243
677 3300027312 Ga0209371_1000105 Ga0209371_100010533 243
678 3300027312 Ga0209371_1000105 Ga0209371_100010536 243
679 3300027312 Ga0209371_1000215 Ga0209371_100021541 243
680 3300027312 Ga0209371_1000215 Ga0209371_100021544 243
681 3300027312 Ga0209371_1000646 Ga0209371_100064610 243
682 3300027312 Ga0209371_1000646 Ga0209371_10006467 243
683 3300027312 Ga0209371_1000669 Ga0209371_10006695 243
684 3300027312 Ga0209371_1000695 Ga0209371_10006956 243
685 3300027312 Ga0209371_1000695 Ga0209371_10006959 243
686 3300027312 Ga0209371_1000951 Ga0209371_10009514 243
687 3300027312 Ga0209371_1000951 Ga0209371_10009517 243
688 3300027312 Ga0209371_1000967 Ga0209371_100096711 243
689 3300027312 Ga0209371_1000967 Ga0209371_100096714 243
690 3300027312 Ga0209371_1001006 Ga0209371_100100618 243
691 3300027312 Ga0209371_1003729 Ga0209371_10037297 243
692 3300027312 Ga0209371_1005642 Ga0209371_10056424 243
693 3300027312 Ga0209371_1007936 Ga0209371_10079361 243
694 3300027312 Ga0209371_1007936 Ga0209371_10079364 243
695 3300027312 Ga0209371_1007977 Ga0209371_10079774 243
696 3300027312 Ga0209371_1015216 Ga0209371_10152163 243
697 3300027312 Ga0209371_1015324 Ga0209371_10153242 243
698 3300027312 Ga0209371_1017753 Ga0209371_10177532 243
699 3300028379 Ga0268266_10000100 Ga0268266_1000010054 243
700 3300028379 Ga0268266_10000100 Ga0268266_1000010057 243
701 3300028379 Ga0268266_10096298 Ga0268266_100962983 243
702 3300028379 Ga0268266_10163387 Ga0268266_101633873 243
703 3300030500 Ga0268256_1000001 Ga0268256_10000012062 243
704 3300030500 Ga0268256_1000001 Ga0268256_10000012065 243
705 3300030500 Ga0268256_1000003 Ga0268256_1000003606 243
706 3300030500 Ga0268256_1000003 Ga0268256_1000003609 243
707 3300030500 Ga0268256_1000022 Ga0268256_1000022480 243
708 3300030500 Ga0268256_1000022 Ga0268256_1000022483 243
709 3300030500 Ga0268256_1000073 Ga0268256_100007351 243
710 3300030500 Ga0268256_1000073 Ga0268256_100007354 243
711 3300030500 Ga0268256_1000126 Ga0268256_100012673 243
712 3300030500 Ga0268256_1000126 Ga0268256_100012676 243
713 3300030500 Ga0268256_1000172 Ga0268256_100017231 243
714 3300030500 Ga0268256_1000172 Ga0268256_100017234 243
715 3300030500 Ga0268256_1000574 Ga0268256_10005746 243
716 3300030500 Ga0268256_1000574 Ga0268256_10005749 243
717 3300030500 Ga0268256_1000577 Ga0268256_100057728 243
718 3300030500 Ga0268256_1000791 Ga0268256_100079114 243
719 3300030500 Ga0268256_1000791 Ga0268256_100079117 243
720 3300030500 Ga0268256_1000867 Ga0268256_100086714 243
721 3300030500 Ga0268256_1000867 Ga0268256_100086717 243
722 3300030500 Ga0268256_1001047 Ga0268256_10010472 243
723 3300030500 Ga0268256_1002897 Ga0268256_10028972 243
724 3300030500 Ga0268256_1003740 Ga0268256_10037404 243
725 3300030500 Ga0268256_1005579 Ga0268256_10055794 243
726 3300030500 Ga0268256_1008004 Ga0268256_10080044 243
727 3300030500 Ga0268256_1016688 Ga0268256_10166882 243
728 3300030500 Ga0268256_1018583 Ga0268256_10185832 243
729 3300030500 Ga0268256_1019807 Ga0268256_10198072 243
730 3300030742 Ga0316183_1148904 Ga0316183_11489042 243
731 3300039437 Ga0436365_1910565 Ga0436365_1910565_97452_98183 243
732 3300039437 Ga0436365_1910565 Ga0436365_1910565_99763_100494 243
733 3300041405 Ga0439438_000001 Ga0439438_000001_267740_268471 243
734 3300041405 Ga0439438_000001 Ga0439438_000001_269950_270681 243
735 3300041405 Ga0439438_013337 Ga0439438_013337_407_1138 243
736 3300041405 Ga0439438_018280 Ga0439438_018280_492_1232 243
737 3300041407 Ga0439447_006406 Ga0439447_006406_2373_3104 243
738 3300041407 Ga0439447_006415 Ga0439447_006415_1541_2272 243
739 3300041407 Ga0439447_011461 Ga0439447_011461_933_1673 243
740 3300041411 Ga0439466_0000003 Ga0439466_0000003_228394_229134 243
741 3300041411 Ga0439466_0000003 Ga0439466_0000003_230641_231372 243
742 3300042006 Ga0439432_006788 Ga0439432_006788_3192_3923 243
743 3300042006 Ga0439432_006788 Ga0439432_006788_938_1678 243
744 3300042006 Ga0439432_008405 Ga0439432_008405_2040_2771 243
745 3300042006 Ga0439432_008424 Ga0439432_008424_1288_2019 243
746 3300042010 Ga0439452_000001 Ga0439452_000001_219736_220467 243
747 3300042010 Ga0439452_000001 Ga0439452_000001_221981_222721 243
748 3300042010 Ga0439452_000003 Ga0439452_000003_281168_281899 243
749 3300042010 Ga0439452_000003 Ga0439452_000003_283441_284172 243
750 3300042010 Ga0439452_000008 Ga0439452_000008_458446_459177 243
751 3300042010 Ga0439452_000008 Ga0439452_000008_460737_461468 243
752 3300042010 Ga0439452_000030 Ga0439452_000030_56219_56950 243
753 3300042010 Ga0439452_000030 Ga0439452_000030_58519_59250 243
754 3300042010 Ga0439452_000237 Ga0439452_000237_30246_30977 243
755 3300042010 Ga0439452_000237 Ga0439452_000237_32548_33279 243
756 3300042010 Ga0439452_002293 Ga0439452_002293_975_1706 243
757 3300042010 Ga0439452_007806 Ga0439452_007806_1905_2636 243
758 3300042016 Ga0439463_006343 Ga0439463_006343_1897_2637 243
759 3300042137 Ga0450902_019205 Ga0450902_019205_311_1042 243
760 3300042146 Ga0450907_000788 Ga0450907_000788_5463_6194 243
761 3300042439 Ga0439464_0004022 Ga0439464_0004022_2187_2927 243
762 3300044669 Ga0466981_0000005 Ga0466981_0000005_162187_162918 243
763 3300044669 Ga0466981_0000005 Ga0466981_0000005_164490_165221 243
764 3300046453 Ga0495627_000018 Ga0495627_000018_121371_122102 243
765 3300046453 Ga0495627_015211 Ga0495627_015211_414_1145 243
766 3300046458 Ga0495591_000014 Ga0495591_000014_29909_30640 243
767 3300046458 Ga0495591_000014 Ga0495591_000014_32163_32894 243
768 3300046458 Ga0495591_000160 Ga0495591_000160_45713_46444 243
769 3300046458 Ga0495591_000160 Ga0495591_000160_48007_48738 243
770 3300046458 Ga0495591_002208 Ga0495591_002208_9015_9749 243
771 3300046458 Ga0495591_007224 Ga0495591_007224_623_1354 243
772 3300046460 Ga0495638_0005900 Ga0495638_0005900_2072_2803 243
773 3300046471 Ga0495650_0000018 Ga0495650_0000018_273018_273752 243
774 3300046471 Ga0495650_0000018 Ga0495650_0000018_275377_276135 243
775 3300046471 Ga0495650_0000021 Ga0495650_0000021_400245_400976 243
776 3300046471 Ga0495650_0000021 Ga0495650_0000021_402545_403276 243
777 3300046471 Ga0495650_0000032 Ga0495650_0000032_85412_86146 243
778 3300046471 Ga0495650_0018784 Ga0495650_0018784_2083_2814 243
779 3300046474 Ga0495605_0024915 Ga0495605_0024915_603_1337 243
780 3300046491 Ga0495584_0017962 Ga0495584_0017962_1775_2509 243
781 3300046492 Ga0495585_0062937 Ga0495585_0062937_914_1654 243
782 3300046507 Ga0495606_0002072 Ga0495606_0002072_8826_9560 243
783 3300046515 Ga0495620_0023359 Ga0495620_0023359_390_1142 243
784 3300046523 Ga0495644_0002443 Ga0495644_0002443_5316_6050 243
785 3300046524 Ga0495648_0001904 Ga0495648_0001904_13897_14631 243
786 3300046524 Ga0495648_0007155 Ga0495648_0007155_4121_4852 243
787 3300046524 Ga0495648_0007155 Ga0495648_0007155_6359_7099 243
788 3300046530 Ga0495654_0000049 Ga0495654_0000049_90532_91263 243
789 3300046530 Ga0495654_0000049 Ga0495654_0000049_92786_93517 243
790 3300046530 Ga0495654_0000052 Ga0495654_0000052_122083_122817 243
791 3300046530 Ga0495654_0000707 Ga0495654_0000707_25288_26019 243
792 3300046530 Ga0495654_0030293 Ga0495654_0030293_539_1270 243
793 3300046542 Ga0495597_0013052 Ga0495597_0013052_2464_3195 243
794 3300046660 Ga0495625_0000891 Ga0495625_0000891_6986_7717 243
795 3300046660 Ga0495625_0000891 Ga0495625_0000891_9271_10002 243
796 3300046674 Ga0495588_0015337 Ga0495588_0015337_886_1617 243
797 3300046692 Ga0495671_0007030 Ga0495671_0007030_948_1682 243
798 3300046694 Ga0495649_0001132 Ga0495649_0001132_19235_19966 243
799 3300046694 Ga0495649_0001135 Ga0495649_0001135_19232_19963 243
800 3300046694 Ga0495649_0057909 Ga0495649_0057909_119_853 243
801 3300046694 Ga0495649_0112665 Ga0495649_0112665_329_1060 243
802 3300046794 Ga0495589_0000002 Ga0495589_0000002_175583_176314 243
803 3300046794 Ga0495589_0016291 Ga0495589_0016291_1765_2511 243
804 3300046810 Ga0495660_0000004 Ga0495660_0000004_519855_520589 243
805 3300046810 Ga0495660_0000004 Ga0495660_0000004_522214_522972 243
806 3300046810 Ga0495660_0000038 Ga0495660_0000038_54268_55002 243
807 3300046810 Ga0495660_0017998 Ga0495660_0017998_2307_3038 243
808 3300046810 Ga0495660_0017998 Ga0495660_0017998_60_800 243
809 3300047320 Ga0495672_0000002 Ga0495672_0000002_49141_49875 243
810 3300047320 Ga0495672_0000012 Ga0495672_0000012_280781_281512 243
811 3300047320 Ga0495672_0000012 Ga0495672_0000012_283019_283759 243
812 3300047320 Ga0495672_0000249 Ga0495672_0000249_72103_72834 243
813 3300047320 Ga0495672_0000249 Ga0495672_0000249_74388_75119 243
814 3300047321 Ga0495676_0257647 Ga0495676_0257647_108_842 243
815 3300047446 Ga0495679_000369 Ga0495679_000369_4611_5342 243
816 3300047446 Ga0495679_000369 Ga0495679_000369_6896_7627 243
817 3300047446 Ga0495679_005750 Ga0495679_005750_1944_2675 243
818 3300047446 Ga0495679_012262 Ga0495679_012262_413_1165 243
819 3300047469 Ga0495673_0000022 Ga0495673_0000022_128050_128781 243
820 3300047469 Ga0495673_0000095 Ga0495673_0000095_62229_62963 243
821 3300047470 Ga0495681_0106787 Ga0495681_0106787_382_1113 243
822 3300048903 Ga0496100_0373596 Ga0496100_0373596_211_942 243
823 3300048904 Ga0496101_0000076 Ga0496101_0000076_69237_69968 243
824 3300048904 Ga0496101_0000076 Ga0496101_0000076_71494_72225 243
825 3300048905 Ga0496102_0003536 Ga0496102_0003536_1063_1794 243
826 3300048905 Ga0496102_0003536 Ga0496102_0003536_3301_4041 243
827 3300048905 Ga0496102_0040848 Ga0496102_0040848_1778_2509 243
828 3300048906 Ga0496103_0207517 Ga0496103_0207517_169_909 243
829 3300048907 Ga0496104_0001472 Ga0496104_0001472_13144_13875 243
830 3300048907 Ga0496104_0001472 Ga0496104_0001472_15440_16171 243
831 3300048907 Ga0496104_0001542 Ga0496104_0001542_2441_3175 243
832 3300048907 Ga0496104_0001542 Ga0496104_0001542_4800_5558 243
833 3300048908 Ga0496105_0016667 Ga0496105_0016667_3778_4518 243
834 3300048908 Ga0496105_0100676 Ga0496105_0100676_65_805 243
835 3300048908 Ga0496105_0218048 Ga0496105_0218048_40_771 243
836 3300048908 Ga0496105_0456008 Ga0496105_0456008_41_772 243
837 3300048919 Ga0496116_0000023 Ga0496116_0000023_417168_417899 243
838 3300048919 Ga0496116_0000083 Ga0496116_0000083_105040_105774 243
839 3300048919 Ga0496116_0000083 Ga0496116_0000083_107399_108157 243
840 3300048919 Ga0496116_0000298 Ga0496116_0000298_45995_46729 243
841 3300048919 Ga0496116_0000298 Ga0496116_0000298_48252_48983 243
842 3300048919 Ga0496116_0000460 Ga0496116_0000460_11108_11848 243
843 3300048919 Ga0496116_0000460 Ga0496116_0000460_13362_14093 243
844 3300048919 Ga0496116_0000487 Ga0496116_0000487_13512_14372 243
845 3300048919 Ga0496116_0000487 Ga0496116_0000487_15786_16517 243
846 3300048919 Ga0496116_0007683 Ga0496116_0007683_7207_7938 243
847 3300048919 Ga0496116_0011721 Ga0496116_0011721_4321_5052 243
848 3300048919 Ga0496116_0022713 Ga0496116_0022713_1505_2236 243
849 3300048919 Ga0496116_0022713 Ga0496116_0022713_3743_4483 243
850 3300048919 Ga0496116_0023969 Ga0496116_0023969_1622_2353 243
851 3300048919 Ga0496116_0040396 Ga0496116_0040396_858_1589 243
852 3300048919 Ga0496116_0055430 Ga0496116_0055430_240_977 243
853 3300048920 Ga0496117_0000004 Ga0496117_0000004_529282_530022 243
854 3300048920 Ga0496117_0000004 Ga0496117_0000004_531529_532260 243
855 3300048920 Ga0496117_0000131 Ga0496117_0000131_32057_32797 243
856 3300048920 Ga0496117_0000131 Ga0496117_0000131_34304_35035 243
857 3300048920 Ga0496117_0001846 Ga0496117_0001846_17760_18491 243
858 3300048920 Ga0496117_0001846 Ga0496117_0001846_20005_20745 243
859 3300048920 Ga0496117_0001904 Ga0496117_0001904_6876_7607 243
860 3300048920 Ga0496117_0004395 Ga0496117_0004395_1544_2275 243
861 3300048920 Ga0496117_0006883 Ga0496117_0006883_8941_9672 243
862 3300048920 Ga0496117_0011816 Ga0496117_0011816_3142_3873 243
863 3300048920 Ga0496117_0011816 Ga0496117_0011816_5433_6164 243
864 3300048920 Ga0496117_0015283 Ga0496117_0015283_3240_3998 243
865 3300048920 Ga0496117_0015283 Ga0496117_0015283_881_1615 243
866 3300048920 Ga0496117_0028493 Ga0496117_0028493_1522_2253 243
867 3300048920 Ga0496117_0029098 Ga0496117_0029098_603_1334 243
868 3300048920 Ga0496117_0034763 Ga0496117_0034763_832_1563 243
869 3300048920 Ga0496117_0036534 Ga0496117_0036534_1385_2116 243
870 3300048920 Ga0496117_0046440 Ga0496117_0046440_914_1723 243
871 3300048920 Ga0496117_0047723 Ga0496117_0047723_966_1700 243
872 3300048920 Ga0496117_0053991 Ga0496117_0053991_2009_2740 243
873 3300048920 Ga0496117_0254704 Ga0496117_0254704_19_771 243
874 3300048920 Ga0496117_0320344 Ga0496117_0320344_70_801 243
875 3300048920 Ga0496117_0343454 Ga0496117_0343454_13_744 243
876 3300048921 Ga0496118_0000024 Ga0496118_0000024_37387_38127 243
877 3300048921 Ga0496118_0000024 Ga0496118_0000024_39634_40365 243
878 3300048921 Ga0496118_0001997 Ga0496118_0001997_15474_16205 243
879 3300048921 Ga0496118_0001997 Ga0496118_0001997_17712_18452 243
880 3300048921 Ga0496118_0002117 Ga0496118_0002117_11154_11894 243
881 3300048921 Ga0496118_0002117 Ga0496118_0002117_8909_9640 243
882 3300048921 Ga0496118_0003269 Ga0496118_0003269_18271_19005 243
883 3300048921 Ga0496118_0004340 Ga0496118_0004340_38_790 243
884 3300048921 Ga0496118_0004726 Ga0496118_0004726_11281_12012 243
885 3300048921 Ga0496118_0004726 Ga0496118_0004726_8990_9721 243
886 3300048921 Ga0496118_0013702 Ga0496118_0013702_5306_6037 243
887 3300048921 Ga0496118_0024772 Ga0496118_0024772_3671_4480 243
888 3300048921 Ga0496118_0033081 Ga0496118_0033081_2914_3645 243
889 3300048921 Ga0496118_0041457 Ga0496118_0041457_38_769 243
890 3300048921 Ga0496118_0059231 Ga0496118_0059231_1506_2237 243
891 3300048921 Ga0496118_0075486 Ga0496118_0075486_114_845 243
892 3300048921 Ga0496118_0084913 Ga0496118_0084913_1386_2117 243
893 3300048921 Ga0496118_0127045 Ga0496118_0127045_832_1563 243
894 3300048921 Ga0496118_0128540 Ga0496118_0128540_506_1240 243
895 3300048921 Ga0496118_0135845 Ga0496118_0135845_69_800 243
896 3300048921 Ga0496118_0157116 Ga0496118_0157116_398_1129 243
897 3300048921 Ga0496118_0268582 Ga0496118_0268582_52_789 243
898 3300048922 Ga0496119_0000008 Ga0496119_0000008_127287_128018 243
899 3300048922 Ga0496119_0000008 Ga0496119_0000008_129578_130309 243
900 3300048922 Ga0496119_0000056 Ga0496119_0000056_17479_18210 243
901 3300048922 Ga0496119_0000068 Ga0496119_0000068_11463_12194 243
902 3300048922 Ga0496119_0000068 Ga0496119_0000068_9216_9956 243
903 3300048922 Ga0496119_0000599 Ga0496119_0000599_11468_12199 243
904 3300048922 Ga0496119_0000599 Ga0496119_0000599_9221_9961 243
905 3300048922 Ga0496119_0001030 Ga0496119_0001030_10799_11530 243
906 3300048922 Ga0496119_0001264 Ga0496119_0001264_19317_20048 243
907 3300048922 Ga0496119_0004277 Ga0496119_0004277_1612_2343 243
908 3300048922 Ga0496119_0021556 Ga0496119_0021556_3018_3800 243
909 3300048922 Ga0496119_0021556 Ga0496119_0021556_795_1526 243
910 3300048922 Ga0496119_0032923 Ga0496119_0032923_611_1342 243
911 3300048922 Ga0496119_0038348 Ga0496119_0038348_1635_2366 243
912 3300048922 Ga0496119_0043137 Ga0496119_0043137_1265_1996 243
913 3300048922 Ga0496119_0046001 Ga0496119_0046001_333_1067 243
914 3300048922 Ga0496119_0047518 Ga0496119_0047518_1848_2657 243
915 3300048922 Ga0496119_0053716 Ga0496119_0053716_1655_2386 243
916 3300048922 Ga0496119_0102671 Ga0496119_0102671_13_744 243
917 3300048923 Ga0496120_0000046 Ga0496120_0000046_14227_14961 243
918 3300048923 Ga0496120_0000046 Ga0496120_0000046_16484_17215 243
919 3300048923 Ga0496120_0000063 Ga0496120_0000063_11278_12009 243
920 3300048923 Ga0496120_0000366 Ga0496120_0000366_48431_49162 243
921 3300048923 Ga0496120_0000680 Ga0496120_0000680_19888_20619 243
922 3300048923 Ga0496120_0000680 Ga0496120_0000680_22145_22876 243
923 3300048923 Ga0496120_0000712 Ga0496120_0000712_11463_12194 243
924 3300048923 Ga0496120_0000712 Ga0496120_0000712_9216_9956 243
925 3300048923 Ga0496120_0001102 Ga0496120_0001102_11468_12199 243
926 3300048923 Ga0496120_0001102 Ga0496120_0001102_9221_9961 243
927 3300048923 Ga0496120_0001204 Ga0496120_0001204_11394_12125 243
928 3300048923 Ga0496120_0001303 Ga0496120_0001303_13_744 243
929 3300048923 Ga0496120_0002992 Ga0496120_0002992_10181_10912 243
930 3300048923 Ga0496120_0002992 Ga0496120_0002992_12404_13186 243
931 3300048923 Ga0496120_0005112 Ga0496120_0005112_6017_6775 243
932 3300048923 Ga0496120_0005112 Ga0496120_0005112_8400_9134 243
933 3300048923 Ga0496120_0008220 Ga0496120_0008220_6454_7185 243
934 3300048923 Ga0496120_0033015 Ga0496120_0033015_1544_2275 243
935 3300048923 Ga0496120_0057375 Ga0496120_0057375_685_1437 243
936 3300048923 Ga0496120_0136609 Ga0496120_0136609_274_1005 243
937 3300048924 Ga0496121_0000047 Ga0496121_0000047_320206_320946 243
938 3300048924 Ga0496121_0000047 Ga0496121_0000047_322453_323184 243
939 3300048924 Ga0496121_0001421 Ga0496121_0001421_1632_2363 243
940 3300048924 Ga0496121_0002086 Ga0496121_0002086_25102_25833 243
941 3300048924 Ga0496121_0002086 Ga0496121_0002086_27404_28135 243
942 3300048924 Ga0496121_0002854 Ga0496121_0002854_1642_2373 243
943 3300048924 Ga0496121_0003230 Ga0496121_0003230_10143_10952 243
944 3300048924 Ga0496121_0003230 Ga0496121_0003230_12515_13246 243
945 3300048924 Ga0496121_0005091 Ga0496121_0005091_16398_17129 243
946 3300048924 Ga0496121_0010784 Ga0496121_0010784_8187_8918 243
947 3300048924 Ga0496121_0018365 Ga0496121_0018365_5603_6334 243
948 3300048924 Ga0496121_0026603 Ga0496121_0026603_4620_5351 243
949 3300048924 Ga0496121_0103180 Ga0496121_0103180_464_1195 243
950 3300048924 Ga0496121_0226723 Ga0496121_0226723_69_800 243
951 3300048924 Ga0496121_0310780 Ga0496121_0310780_266_1006 243
952 3300048925 Ga0496122_0000099 Ga0496122_0000099_140540_141271 243
953 3300048925 Ga0496122_0000099 Ga0496122_0000099_142834_143565 243
954 3300048925 Ga0496122_0000135 Ga0496122_0000135_140400_141134 243
955 3300048925 Ga0496122_0000135 Ga0496122_0000135_142759_143490 243
956 3300048925 Ga0496122_0001448 Ga0496122_0001448_13767_14498 243
957 3300048925 Ga0496122_0001448 Ga0496122_0001448_16066_16797 243
958 3300048925 Ga0496122_0002083 Ga0496122_0002083_23311_24051 243
959 3300048925 Ga0496122_0002083 Ga0496122_0002083_25558_26289 243
960 3300048925 Ga0496122_0003773 Ga0496122_0003773_6096_6827 243
961 3300048925 Ga0496122_0003773 Ga0496122_0003773_8407_9144 243
962 3300048925 Ga0496122_0004020 Ga0496122_0004020_11727_12458 243
963 3300048925 Ga0496122_0004020 Ga0496122_0004020_13984_14715 243
964 3300048925 Ga0496122_0014431 Ga0496122_0014431_5017_5748 243
965 3300048925 Ga0496122_0017318 Ga0496122_0017318_5241_5972 243
966 3300048925 Ga0496122_0019055 Ga0496122_0019055_5132_5863 243
967 3300048925 Ga0496122_0019278 Ga0496122_0019278_1183_1914 243
968 3300048925 Ga0496122_0027114 Ga0496122_0027114_2372_3103 243
969 3300048925 Ga0496122_0031874 Ga0496122_0031874_2871_3602 243
970 3300048925 Ga0496122_0034629 Ga0496122_0034629_1496_2227 243
971 3300048925 Ga0496122_0037622 Ga0496122_0037622_722_1453 243
972 3300048925 Ga0496122_0056764 Ga0496122_0056764_1789_2520 243
973 3300048925 Ga0496122_0063640 Ga0496122_0063640_1890_2621 243
974 3300048925 Ga0496122_0067705 Ga0496122_0067705_819_1550 243
975 3300048925 Ga0496122_0172290 Ga0496122_0172290_196_927 243
976 3300048926 Ga0496123_0000004 Ga0496123_0000004_140308_141042 243
977 3300048926 Ga0496123_0000004 Ga0496123_0000004_142667_143398 243
978 3300048926 Ga0496123_0000005 Ga0496123_0000005_156800_157609 243
979 3300048926 Ga0496123_0000005 Ga0496123_0000005_159172_159903 243
980 3300048926 Ga0496123_0000126 Ga0496123_0000126_49921_50658 243
981 3300048926 Ga0496123_0000126 Ga0496123_0000126_52238_52969 243
982 3300048926 Ga0496123_0001188 Ga0496123_0001188_13767_14498 243
983 3300048926 Ga0496123_0001188 Ga0496123_0001188_16066_16797 243
984 3300048926 Ga0496123_0003627 Ga0496123_0003627_2146_2877 243
985 3300048926 Ga0496123_0003811 Ga0496123_0003811_2868_3599 243
986 3300048926 Ga0496123_0003811 Ga0496123_0003811_621_1361 243
987 3300048926 Ga0496123_0008336 Ga0496123_0008336_7034_7765 243
988 3300048926 Ga0496123_0010428 Ga0496123_0010428_6944_7753 243
989 3300048926 Ga0496123_0012419 Ga0496123_0012419_3915_4646 243
990 3300048926 Ga0496123_0012419 Ga0496123_0012419_6206_6937 243
991 3300048926 Ga0496123_0013435 Ga0496123_0013435_5064_5795 243
992 3300048926 Ga0496123_0024194 Ga0496123_0024194_3509_4240 243
993 3300048926 Ga0496123_0026496 Ga0496123_0026496_1310_2041 243
994 3300048926 Ga0496123_0101305 Ga0496123_0101305_539_1270 243
995 3300048926 Ga0496123_0115035 Ga0496123_0115035_725_1456 243
996 3300048926 Ga0496123_0128357 Ga0496123_0128357_258_989 243
997 3300048926 Ga0496123_0134116 Ga0496123_0134116_310_1041 243
998 3300048927 Ga0496124_0000017 Ga0496124_0000017_57842_58573 243
999 3300048927 Ga0496124_0000101 Ga0496124_0000101_82228_82959 243
1000 3300048927 Ga0496124_0000101 Ga0496124_0000101_84519_85250 243
1001 3300048927 Ga0496124_0000140 Ga0496124_0000140_70043_70801 243
1002 3300048927 Ga0496124_0000140 Ga0496124_0000140_72426_73160 243
1003 3300048927 Ga0496124_0000270 Ga0496124_0000270_61956_62708 243
1004 3300048927 Ga0496124_0000270 Ga0496124_0000270_64275_65006 243
1005 3300048927 Ga0496124_0000451 Ga0496124_0000451_26016_26747 243
1006 3300048927 Ga0496124_0000451 Ga0496124_0000451_28318_29049 243
1007 3300048927 Ga0496124_0002064 Ga0496124_0002064_14018_14878 243
1008 3300048927 Ga0496124_0002064 Ga0496124_0002064_16292_17023 243
1009 3300048927 Ga0496124_0009975 Ga0496124_0009975_732_1463 243
1010 3300048927 Ga0496124_0018351 Ga0496124_0018351_2333_3064 243
1011 3300048927 Ga0496124_0018351 Ga0496124_0018351_86_826 243
1012 3300048927 Ga0496124_0021397 Ga0496124_0021397_510_1241 243
1013 3300048927 Ga0496124_0024549 Ga0496124_0024549_3967_4698 243
1014 3300048927 Ga0496124_0044827 Ga0496124_0044827_1216_1947 243
1015 3300048927 Ga0496124_0062405 Ga0496124_0062405_2326_3066 243
1016 3300048927 Ga0496124_0063595 Ga0496124_0063595_664_1395 243
1017 3300048927 Ga0496124_0077598 Ga0496124_0077598_1525_2256 243
1018 3300048927 Ga0496124_0092985 Ga0496124_0092985_1582_2313 243
1019 3300048927 Ga0496124_0099975 Ga0496124_0099975_1588_2319 243
1020 3300048927 Ga0496124_0104589 Ga0496124_0104589_540_1271 243
1021 3300048927 Ga0496124_0220104 Ga0496124_0220104_521_1252 243
1022 3300048927 Ga0496124_0253870 Ga0496124_0253870_523_1254 243
1023 3300048927 Ga0496124_0279268 Ga0496124_0279268_452_1183 243
1024 3300048928 Ga0496125_0000091 Ga0496125_0000091_198352_199083 243
1025 3300048928 Ga0496125_0000091 Ga0496125_0000091_200722_201453 243
1026 3300048928 Ga0496125_0000131 Ga0496125_0000131_54552_55310 243
1027 3300048928 Ga0496125_0000131 Ga0496125_0000131_56935_57669 243
1028 3300048928 Ga0496125_0008405 Ga0496125_0008405_8171_8902 243
1029 3300048928 Ga0496125_0021179 Ga0496125_0021179_1292_2032 243
1030 3300048928 Ga0496125_0021179 Ga0496125_0021179_3539_4270 243
1031 3300048928 Ga0496125_0021293 Ga0496125_0021293_4281_5012 243
1032 3300048928 Ga0496125_0035342 Ga0496125_0035342_645_1376 243
1033 3300048928 Ga0496125_0048443 Ga0496125_0048443_1381_2112 243
1034 3300048928 Ga0496125_0058582 Ga0496125_0058582_843_1574 243
1035 3300048928 Ga0496125_0198067 Ga0496125_0198067_259_990 243
1036 3300048928 Ga0496125_0331720 Ga0496125_0331720_102_833 243
1037 3300048929 Ga0496126_0000300 Ga0496126_0000300_59962_60696 243
1038 3300048929 Ga0496126_0000300 Ga0496126_0000300_62321_63079 243
1039 3300048929 Ga0496126_0009092 Ga0496126_0009092_8256_8987 243
1040 3300048929 Ga0496126_0044069 Ga0496126_0044069_2562_3293 243
1041 3300048929 Ga0496126_0044069 Ga0496126_0044069_260_991 243
1042 3300048929 Ga0496126_0051604 Ga0496126_0051604_2461_3270 243
1043 3300048929 Ga0496126_0053886 Ga0496126_0053886_867_1598 243
1044 3300048929 Ga0496126_0053989 Ga0496126_0053989_2398_3129 243
1045 3300048929 Ga0496126_0053989 Ga0496126_0053989_29_760 243
1046 3300048929 Ga0496126_0066845 Ga0496126_0066845_400_1131 243
1047 3300048929 Ga0496126_0074676 Ga0496126_0074676_1473_2204 243
1048 3300048929 Ga0496126_0164105 Ga0496126_0164105_291_1022 243
1049 3300048929 Ga0496126_0186933 Ga0496126_0186933_410_1141 243
1050 3300048929 Ga0496126_0205284 Ga0496126_0205284_858_1589 243
1051 3300048929 Ga0496126_0245338 Ga0496126_0245338_68_799 243
1052 3300049459 Ga0495678_000360 Ga0495678_000360_43832_44566 243
1053 3300049460 Ga0495682_0000015 Ga0495682_0000015_188619_189353 243
1054 3300050491 nmdc:mga00v17_115318_c1 nmdc:mga00v17_115318_c1_689_1420 243
1055 3300050491 nmdc:mga00v17_133107_c1 nmdc:mga00v17_133107_c1_174_905 243
1056 3300050491 nmdc:mga00v17_46659_c1 nmdc:mga00v17_46659_c1_1440_2171 243
1057 3300050491 nmdc:mga00v17_47482_c1 nmdc:mga00v17_47482_c1_1810_2541 243
1058 3300050491 nmdc:mga00v17_55251_c1 nmdc:mga00v17_55251_c1_1436_2167 243
1059 3300050491 nmdc:mga00v17_5843_c1 nmdc:mga00v17_5843_c1_2000_2740 243
1060 3300050493 nmdc:mga0k408_2863_c2 nmdc:mga0k408_2863_c2_1356_2087 243
1061 3300053126 Ga0500621_000001 Ga0500621_000001_684756_685490 243
1062 iso_pu_bacteria 2599185169 2599410653 243
1063 iso_pu_bacteria 2600255254 2601523704 243
1064 iso_pu_bacteria 2600255255 2601528863 243
1065 iso_pu_bacteria 2600255280 2601615696 243
1066 iso_pu_bacteria 2600255281 2601620584 243
1067 iso_pu_bacteria 2600255287 2601645436 243
1068 iso_pu_bacteria 2600255288 2601648981 243
1069 iso_pu_bacteria 2600255289 2601653747 243
1070 iso_pu_bacteria 2600255290 2601659167 243
1071 iso_pu_bacteria 2600255291 2601665577 243
1072 iso_pu_bacteria 2600255298 2601698435 243
1073 iso_pu_bacteria 2600255299 2601703583 243
1074 iso_pu_bacteria 2600255300 2601707676 243
1075 iso_pu_bacteria 2600255301 2601712735 243
1076 iso_pu_bacteria 2600255302 2601717006 243
1077 iso_pu_bacteria 2600255303 2601723520 243
1078 iso_pu_bacteria 2600255304 2601724831 243
1079 iso_pu_bacteria 2600255305 2601732114 243
1080 iso_pu_bacteria 2600255306 2601738008 243
1081 iso_pu_bacteria 2600255307 2601742586 243
1082 iso_pu_bacteria 2600255309 2601752038 243
1083 iso_pu_bacteria 2600255392 2602020485 243
1084 iso_pu_bacteria 2602042052 2603658732 243
1085 iso_pu_bacteria 2602042053 2603668311 243
1086 iso_pu_bacteria 2602042103 2603839352 243
1087 iso_pu_bacteria 2602042104 2603844592 243
1088 iso_pu_bacteria 2602042105 2603849509 243
1089 iso_pu_bacteria 2602042106 2603854577 243
1090 iso_pu_bacteria 2602042110 2603870010 243
1091 iso_pu_bacteria 2602042111 2603874968 243
1092 iso_pu_bacteria 2603880178 2606047201 243
1093 iso_pu_bacteria 2603880184 2606072734 243
1094 iso_pu_bacteria 2603880202 2606146297 243
1095 iso_pu_bacteria 2603880211 2606177223 243
1096 iso_pu_bacteria 2636415599 2637226201 243
1097 iso_pu_bacteria 2675903046 2676407606 243
1098 iso_pu_bacteria 2775507074 2777020445 243
1099 iso_pu_bacteria 2791354903 2791924917 243
1100 iso_pu_bacteria 2969079654 2969083216 243
1101 iso_pu_bacteria 2984559226 2984560232 243
1102 iso_pu_bacteria 2984595703 2984598311 243
1103 iso_pu_bacteria 8057304971 8057305737 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

66

286

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y7i-assembly1.cif.gz_B structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. 0.9717 20 242
2y7i-assembly1.cif.gz_B structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. 0.9633 20 242
5owf-assembly1.cif.gz_A structure of a lao-binding protein mutant with glutamine 0.9624 21 243
6mlj-assembly2.cif.gz_B crystal structure of the periplasmic lysine-, arginine-, ornithine-binding protein (lao) s70a mutant from salmonella typhimurium complexed with arginine 0.9609 21 243
6mln-assembly1.cif.gz_E crystal structure of the periplasmic lysine-, arginine-, ornithine-binding protein (lao) s72a mutant from salmonella typhimurium complexed with arginine 0.9609 21 243
ID Description Score Start End Superfamily
af_P30859_22_240_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9984 23 240 1.20.1070.10
af_P30859_22_240_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9894 23 240 1.20.1070.10
af_P0AEU0_25_107_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9878 21 101 3.40.190.10
af_P30860_108_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9793 108 189 3.40.190.10
5owfA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9769 21 243 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6M1HTT2-F1-model_v4 deleted 0.9959 28 243
AF-A0A711Z809-F1-model_v4 Arginine transport ATP-binding protein ArtP (EC 7.4.2.1) 0.994 28 243 GO:0005524
GO:0005886
GO:0015276
GO:0016887
GO:0030288
AF-A0A6M1HTT2-F1-model_v4 deleted 0.9868 28 243
AF-A0A540WGW1-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9862 66 206
AF-A0A3S4FUL6-F1-model_v4 ABC transporter arginine-binding protein 2 0.9843 85 243

Feature Viewer

pLDDT pTM Quality
92.89 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map