F489600

General Info

Members Datasets Scaffolds Average Seq Length
1077 347 2154 165

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10027900|Ga0207699_100279002
Length 199
Sequence MKITVTVNAADYTRVVEPRLLLIHFLRDDLRLTGSHWGCDTSNCGACVVWLNETPIKSCTVLAVMADGQRITTVEGLAAAHRLDPVQEAFAACHGLQCGFCTPGMMMTARWLLDSNPDPTEEEVREAISGQVCRCTGYENIVRSVLWAAKHEGGAAGAVPGLRPGEGAMGESLPHRGVSGGLCPPVARSAPVAKSARVP

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
119 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
195 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
232 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
282 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
293 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
296 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
346 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
347 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.39
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 6.59
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10027900 3300025906 Bacteria 3131
2 JGI24737J22298_10160246 3300001990 Bacteria 664
3 JGI24735J21928_10093421 3300002067 Bacteria 863
4 JGI25405J52794_10035640 3300003911 Bacteria 1042
5 Ga0070683_100307317 3300005329 Bacteria 1509
6 Ga0070683_100497232 3300005329 Bacteria 1165
7 Ga0070683_100741731 3300005329 Bacteria 941
8 Ga0070690_100065426 3300005330 Bacteria 2351
9 Ga0070690_100870557 3300005330 Bacteria 703
10 Ga0070670_100524492 3300005331 Bacteria 1055
11 Ga0070670_100768070 3300005331 Bacteria 869
12 Ga0068869_100906888 3300005334 Bacteria 763
13 Ga0070666_10275128 3300005335 Bacteria 1196
14 Ga0070682_100122746 3300005337 Bacteria 1746
15 Ga0068868_100016481 3300005338 Bacteria 5489
16 Ga0068868_100038154 3300005338 Bacteria 3728
17 Ga0068868_100050853 3300005338 Bacteria 3256
18 Ga0068868_100802099 3300005338 Bacteria 849
19 Ga0070660_100027711 3300005339 Bacteria 4230
20 Ga0070660_100039597 3300005339 Bacteria 3583
21 Ga0070660_100061081 3300005339 Bacteria 2925
22 Ga0070660_100278383 3300005339 Bacteria 1369
23 Ga0070689_100550756 3300005340 Bacteria 994
24 Ga0070691_10039982 3300005341 Bacteria 2216
25 Ga0070691_10062670 3300005341 Bacteria 1791
26 Ga0070691_10089050 3300005341 Bacteria 1520
27 Ga0070691_10228752 3300005341 Bacteria 989
28 Ga0070687_100357250 3300005343 Bacteria 945
29 Ga0070661_101215401 3300005344 Bacteria 631
30 Ga0070692_10026793 3300005345 Bacteria 2852
31 Ga0070692_10212074 3300005345 Bacteria 1140
32 Ga0070692_10500182 3300005345 Bacteria 787
33 Ga0070668_100604672 3300005347 Bacteria 959
34 Ga0070669_100303473 3300005353 Bacteria 1285
35 Ga0070671_100489358 3300005355 Bacteria 1057
36 Ga0070671_100949736 3300005355 Bacteria 752
37 Ga0070671_101116593 3300005355 Bacteria 693
38 Ga0070674_100051847 3300005356 Bacteria 2829
39 Ga0070673_101692510 3300005364 Bacteria 598
40 Ga0070688_100233666 3300005365 Bacteria 1302
41 Ga0070688_100306472 3300005365 Bacteria 1149
42 Ga0070659_100033283 3300005366 Bacteria 4002
43 Ga0070659_100194188 3300005366 Bacteria 1669
44 Ga0070667_101420759 3300005367 Bacteria 651
45 Ga0070709_10002265 3300005434 Bacteria 10430
46 Ga0070709_10019775 3300005434 Bacteria 3899
47 Ga0070709_10167921 3300005434 Bacteria 1531
48 Ga0070709_10179577 3300005434 Bacteria 1485
49 Ga0070709_10686549 3300005434 Bacteria 795
50 Ga0070714_100115390 3300005435 Bacteria 2383
51 Ga0070714_100256802 3300005435 Bacteria 1617
52 Ga0070714_100260198 3300005435 Bacteria 1607
53 Ga0070714_100354509 3300005435 Bacteria 1378
54 Ga0070714_100466077 3300005435 Bacteria 1202
55 Ga0070714_100615307 3300005435 Bacteria 1044
56 Ga0070714_100843212 3300005435 Bacteria 889
57 Ga0070714_100978775 3300005435 Bacteria 823
58 Ga0070713_100023504 3300005436 Bacteria 4784
59 Ga0070713_100040276 3300005436 Bacteria 3798
60 Ga0070713_100065915 3300005436 Bacteria 3044
61 Ga0070713_100083999 3300005436 Bacteria 2723
62 Ga0070713_100114161 3300005436 Bacteria 2359
63 Ga0070713_100210599 3300005436 Bacteria 1760
64 Ga0070713_100336574 3300005436 Bacteria 1397
65 Ga0070713_100819919 3300005436 Bacteria 892
66 Ga0070713_100964657 3300005436 Bacteria 822
67 Ga0070710_10000062 3300005437 Bacteria 49803
68 Ga0070710_10001471 3300005437 Bacteria 11090
69 Ga0070710_10085055 3300005437 Bacteria 1854
70 Ga0070710_10181653 3300005437 Bacteria 1317
71 Ga0070710_10183221 3300005437 Bacteria 1312
72 Ga0070710_10271182 3300005437 Bacteria 1097
73 Ga0070710_10280668 3300005437 Bacteria 1081
74 Ga0070710_10443148 3300005437 Bacteria 879
75 Ga0070701_10386290 3300005438 Bacteria 883
76 Ga0070701_10619525 3300005438 Bacteria 719
77 Ga0070701_10753897 3300005438 Bacteria 660
78 Ga0070711_100005424 3300005439 Bacteria 7623
79 Ga0070711_100008495 3300005439 Bacteria 6291
80 Ga0070711_100016448 3300005439 Bacteria 4699
81 Ga0070711_100016904 3300005439 Bacteria 4638
82 Ga0070711_100073573 3300005439 Bacteria 2415
83 Ga0070711_100419923 3300005439 Bacteria 1090
84 Ga0070700_100041681 3300005441 Bacteria 2815
85 Ga0070700_100340297 3300005441 Bacteria 1109
86 Ga0070694_100087949 3300005444 Bacteria 2174
87 Ga0070694_100216858 3300005444 Bacteria 1434
88 Ga0070708_100005426 3300005445 Bacteria 10110
89 Ga0070708_100016992 3300005445 Bacteria 6055
90 Ga0070708_100480890 3300005445 Bacteria 1172
91 Ga0070663_100196445 3300005455 Bacteria 1572
92 Ga0070663_100464970 3300005455 Bacteria 1045
93 Ga0070678_100137178 3300005456 Bacteria 1952
94 Ga0070678_100178806 3300005456 Bacteria 1735
95 Ga0070678_100370996 3300005456 Bacteria 1236
96 Ga0070662_100230604 3300005457 Bacteria 1481
97 Ga0070681_10317335 3300005458 Bacteria 1468
98 Ga0068867_100084429 3300005459 Bacteria 2399
99 Ga0068867_100695110 3300005459 Bacteria 897
100 Ga0070685_10114512 3300005466 Bacteria 1666
101 Ga0070685_10659487 3300005466 Bacteria 759
102 Ga0070706_100002279 3300005467 Bacteria 19411
103 Ga0070706_100002738 3300005467 Bacteria 17618
104 Ga0070706_100008799 3300005467 Bacteria 9408
105 Ga0070706_100010481 3300005467 Bacteria 8604
106 Ga0070706_100054380 3300005467 Bacteria 3695
107 Ga0070706_100103563 3300005467 Bacteria 2646
108 Ga0070706_100135523 3300005467 Bacteria 2298
109 Ga0070706_100398727 3300005467 Bacteria 1281
110 Ga0070706_100413919 3300005467 Bacteria 1255
111 Ga0070706_100500708 3300005467 Bacteria 1130
112 Ga0070706_100860426 3300005467 Bacteria 838
113 Ga0070707_100000766 3300005468 Bacteria 31770
114 Ga0070707_100005165 3300005468 Bacteria 12231
115 Ga0070707_100006185 3300005468 Bacteria 11148
116 Ga0070707_100011348 3300005468 Bacteria 8305
117 Ga0070707_100020722 3300005468 Bacteria 6205
118 Ga0070707_100085411 3300005468 Bacteria 3050
119 Ga0070707_100335877 3300005468 Bacteria 1468
120 Ga0070707_100377055 3300005468 Bacteria 1378
121 Ga0070707_100396758 3300005468 Bacteria 1339
122 Ga0070707_101018551 3300005468 Bacteria 793
123 Ga0070698_100000052 3300005471 Bacteria 82128
124 Ga0070698_100000240 3300005471 Bacteria 54607
125 Ga0070698_100001129 3300005471 Bacteria 29516
126 Ga0070698_100003354 3300005471 Bacteria 17626
127 Ga0070698_100005243 3300005471 Bacteria 14179
128 Ga0070698_100013120 3300005471 Bacteria 8768
129 Ga0070698_100055330 3300005471 Bacteria 4025
130 Ga0070698_100212488 3300005471 Bacteria 1869
131 Ga0070699_100253103 3300005518 Bacteria 1574
132 Ga0070699_101257490 3300005518 Bacteria 679
133 Ga0070679_100012946 3300005530 Bacteria 7990
134 Ga0070679_100114074 3300005530 Bacteria 2687
135 Ga0070679_100663271 3300005530 Bacteria 986
136 Ga0070684_100043947 3300005535 Bacteria 3861
137 Ga0070684_100195894 3300005535 Bacteria 1840
138 Ga0070684_100680421 3300005535 Bacteria 959
139 Ga0070684_100799064 3300005535 Bacteria 882
140 Ga0070684_101097988 3300005535 Bacteria 747
141 Ga0070697_100007609 3300005536 Bacteria 8432
142 Ga0068853_100004797 3300005539 Bacteria 10518
143 Ga0068853_100594607 3300005539 Bacteria 1050
144 Ga0070672_101059232 3300005543 Bacteria 720
145 Ga0070686_100083169 3300005544 Bacteria 2124
146 Ga0070686_100084243 3300005544 Bacteria 2112
147 Ga0070695_100011751 3300005545 Bacteria 5242
148 Ga0070696_100207430 3300005546 Bacteria 1465
149 Ga0070696_100621978 3300005546 Bacteria 873
150 Ga0070693_100229791 3300005547 Bacteria 1220
151 Ga0070665_100024902 3300005548 Bacteria 6031
152 Ga0070665_100129287 3300005548 Bacteria 2528
153 Ga0070665_100159587 3300005548 Bacteria 2257
154 Ga0070704_100009198 3300005549 Bacteria 5959
155 Ga0068855_100062078 3300005563 Bacteria 4364
156 Ga0068855_100064949 3300005563 Bacteria 4255
157 Ga0068855_100986362 3300005563 Bacteria 886
158 Ga0070664_100403696 3300005564 Bacteria 1250
159 Ga0068857_100142928 3300005577 Bacteria 2164
160 Ga0068857_100175450 3300005577 Bacteria 1950
161 Ga0068857_100205191 3300005577 Bacteria 1798
162 Ga0068854_100002781 3300005578 Bacteria 10867
163 Ga0068854_100232659 3300005578 Bacteria 1463
164 Ga0068854_100522646 3300005578 Bacteria 1003
165 Ga0068856_100116981 3300005614 Bacteria 2666
166 Ga0068856_100201091 3300005614 Bacteria 2007
167 Ga0068856_100217338 3300005614 Bacteria 1926
168 Ga0068856_100336074 3300005614 Bacteria 1529
169 Ga0068856_100371172 3300005614 Bacteria 1450
170 Ga0068856_100409676 3300005614 Bacteria 1375
171 Ga0068856_100711659 3300005614 Bacteria 1024
172 Ga0070702_100035399 3300005615 Bacteria 2758
173 Ga0070702_100037322 3300005615 Bacteria 2698
174 Ga0070702_100088248 3300005615 Bacteria 1875
175 Ga0068852_100639401 3300005616 Bacteria 1071
176 Ga0068859_100057132 3300005617 Bacteria 3931
177 Ga0068859_100065371 3300005617 Bacteria 3671
178 Ga0068859_100426432 3300005617 Bacteria 1423
179 Ga0068859_100692745 3300005617 Bacteria 1110
180 Ga0068864_100041744 3300005618 Bacteria 3923
181 Ga0068864_100072061 3300005618 Bacteria 3010
182 Ga0068864_100279276 3300005618 Bacteria 1558
183 Ga0068864_100343175 3300005618 Bacteria 1408
184 Ga0068866_10063641 3300005718 Bacteria 1923
185 Ga0068866_10197049 3300005718 Bacteria 1201
186 Ga0068851_10026810 3300005834 Bacteria 2835
187 Ga0068863_100045859 3300005841 Bacteria 4148
188 Ga0068863_100046775 3300005841 Bacteria 4107
189 Ga0068863_100418425 3300005841 Bacteria 1312
190 Ga0068863_100472858 3300005841 Bacteria 1232
191 Ga0068863_100915285 3300005841 Bacteria 878
192 Ga0068863_101903271 3300005841 Bacteria 605
193 Ga0068858_100211923 3300005842 Bacteria 1833
194 Ga0068858_100486811 3300005842 Bacteria 1191
195 Ga0068860_100020629 3300005843 Bacteria 6384
196 Ga0068860_100131329 3300005843 Bacteria 2403
197 Ga0068860_100379837 3300005843 Bacteria 1395
198 Ga0081455_10001937 3300005937 Bacteria 24871
199 Ga0081455_10016218 3300005937 Bacteria 7200
200 Ga0081538_10002084 3300005981 Bacteria 19923
201 Ga0081538_10004035 3300005981 Bacteria 13659
202 Ga0081540_1003740 3300005983 Bacteria 11922
203 Ga0081540_1005630 3300005983 Bacteria 9330
204 Ga0081540_1023540 3300005983 Bacteria 3598
205 Ga0070717_10023809 3300006028 Bacteria 4857
206 Ga0070717_10083818 3300006028 Bacteria 2681
207 Ga0070717_10110358 3300006028 Bacteria 2346
208 Ga0070717_10116251 3300006028 Bacteria 2287
209 Ga0070717_10118858 3300006028 Bacteria 2262
210 Ga0070717_10170150 3300006028 Bacteria 1894
211 Ga0070717_10241112 3300006028 Bacteria 1594
212 Ga0070717_10583525 3300006028 Bacteria 1013
213 Ga0070717_10745248 3300006028 Bacteria 890
214 Ga0075365_10466746 3300006038 Bacteria 892
215 Ga0075432_10055200 3300006058 Bacteria 1407
216 Ga0070715_10006440 3300006163 Bacteria 3994
217 Ga0070715_10008224 3300006163 Bacteria 3627
218 Ga0070715_10023449 3300006163 Bacteria 2418
219 Ga0070715_10068850 3300006163 Bacteria 1575
220 Ga0070715_10071947 3300006163 Bacteria 1547
221 Ga0070715_10522790 3300006163 Bacteria 683
222 Ga0070716_100043934 3300006173 Bacteria 2501
223 Ga0070716_100065349 3300006173 Bacteria 2118
224 Ga0070716_100104672 3300006173 Bacteria 1742
225 Ga0070716_100288058 3300006173 Bacteria 1137
226 Ga0070716_100297222 3300006173 Bacteria 1121
227 Ga0070712_100012380 3300006175 Bacteria 5422
228 Ga0070712_100168892 3300006175 Bacteria 1695
229 Ga0070712_100199023 3300006175 Bacteria 1572
230 Ga0070712_100271233 3300006175 Bacteria 1363
231 Ga0070712_100464804 3300006175 Bacteria 1055
232 Ga0070712_100475036 3300006175 Bacteria 1044
233 Ga0070712_100717420 3300006175 Bacteria 854
234 Ga0097621_100211628 3300006237 Bacteria 1687
235 Ga0097621_100879294 3300006237 Bacteria 834
236 Ga0068871_100015846 3300006358 Bacteria 5657
237 Ga0068871_100350500 3300006358 Bacteria 1306
238 Ga0075431_100007823 3300006847 Bacteria 10649
239 Ga0075431_100971727 3300006847 Bacteria 817
240 Ga0075433_10047959 3300006852 Bacteria 3715
241 Ga0075433_10065399 3300006852 Bacteria 3190
242 Ga0075433_10066227 3300006852 Bacteria 3169
243 Ga0075433_10142550 3300006852 Bacteria 2130
244 Ga0075434_100001286 3300006871 Bacteria 20926
245 Ga0075434_100005698 3300006871 Bacteria 11373
246 Ga0075434_100072103 3300006871 Bacteria 3446
247 Ga0075434_100074251 3300006871 Bacteria 3394
248 Ga0075434_100139705 3300006871 Bacteria 2442
249 Ga0075434_100722957 3300006871 Bacteria 1013
250 Ga0075434_101271474 3300006871 Bacteria 747
251 Ga0068865_100346889 3300006881 Bacteria 1201
252 Ga0068865_100426423 3300006881 Bacteria 1092
253 Ga0075436_100076354 3300006914 Bacteria 2320
254 Ga0075436_100089709 3300006914 Bacteria 2136
255 Ga0075436_100123136 3300006914 Bacteria 1816
256 Ga0075436_100185475 3300006914 Bacteria 1471
257 Ga0075436_100674392 3300006914 Bacteria 765
258 Ga0097620_100057135 3300006931 Bacteria 3931
259 Ga0097620_100065372 3300006931 Bacteria 3671
260 Ga0097620_100426414 3300006931 Bacteria 1423
261 Ga0097620_100692773 3300006931 Bacteria 1110
262 Ga0075435_100026742 3300007076 Bacteria 4506
263 Ga0075435_100074841 3300007076 Bacteria 2771
264 Ga0075435_100081661 3300007076 Bacteria 2655
265 Ga0075435_100295481 3300007076 Bacteria 1385
266 Ga0075435_100412351 3300007076 Bacteria 1163
267 Ga0105240_10023204 3300009093 Bacteria 8214
268 Ga0105240_10244863 3300009093 Bacteria 2077
269 Ga0105240_10599435 3300009093 Bacteria 1213
270 Ga0105240_10951325 3300009093 Bacteria 921
271 Ga0111539_10215835 3300009094 Bacteria 2235
272 Ga0111539_10302489 3300009094 Bacteria 1861
273 Ga0105245_10002929 3300009098 Bacteria 15319
274 Ga0105245_10017210 3300009098 Bacteria 6306
275 Ga0105245_10105754 3300009098 Bacteria 2610
276 Ga0105245_10202444 3300009098 Bacteria 1907
277 Ga0105245_10503595 3300009098 Bacteria 1227
278 Ga0105247_10071459 3300009101 Bacteria 2170
279 Ga0105247_10207792 3300009101 Bacteria 1319
280 Ga0105247_10287245 3300009101 Bacteria 1137
281 Ga0105247_10363096 3300009101 Bacteria 1022
282 Ga0114129_10001833 3300009147 Bacteria 28935
283 Ga0114129_10026476 3300009147 Bacteria 8212
284 Ga0114129_10040022 3300009147 Bacteria 6611
285 Ga0114129_10091948 3300009147 Bacteria 4203
286 Ga0114129_11154820 3300009147 Bacteria 967
287 Ga0114129_11251461 3300009147 Bacteria 922
288 Ga0114129_11379535 3300009147 Bacteria 870
289 Ga0105243_10061350 3300009148 Bacteria 3007
290 Ga0105243_10079189 3300009148 Bacteria 2678
291 Ga0105243_11062704 3300009148 Bacteria 816
292 Ga0105243_11256592 3300009148 Bacteria 756
293 Ga0105243_11711984 3300009148 Bacteria 658
294 Ga0105243_12497103 3300009148 Bacteria 556
295 Ga0105242_10062167 3300009176 Bacteria 3073
296 Ga0105242_10104966 3300009176 Bacteria 2399
297 Ga0105242_10317229 3300009176 Bacteria 1428
298 Ga0105242_10822083 3300009176 Bacteria 922
299 Ga0105248_10211288 3300009177 Bacteria 2186
300 Ga0105248_10463612 3300009177 Bacteria 1428
301 Ga0105248_10983387 3300009177 Bacteria 953
302 Ga0105248_11024837 3300009177 Bacteria 932
303 Ga0105237_10181882 3300009545 Bacteria 2103
304 Ga0105238_10064237 3300009551 Bacteria 3671
305 Ga0105238_11485484 3300009551 Bacteria 706
306 Ga0105249_10013128 3300009553 Bacteria 7310
307 Ga0105249_10236514 3300009553 Bacteria 1804
308 Ga0105249_10408552 3300009553 Bacteria 1389
309 Ga0105239_10016303 3300010375 Bacteria 8215
310 Ga0105239_10143995 3300010375 Bacteria 2657
311 Ga0105246_10001080 3300011119 Bacteria 15765
312 Ga0105246_10723191 3300011119 Bacteria 875
313 Ga0105246_10859001 3300011119 Bacteria 810
314 Ga0157371_10574908 3300013102 Bacteria 837
315 Ga0157371_10651523 3300013102 Bacteria 786
316 Ga0157370_10021287 3300013104 Bacteria 6464
317 Ga0157370_10604846 3300013104 Bacteria 1004
318 Ga0157369_10262083 3300013105 Bacteria 1803
319 Ga0157369_10972768 3300013105 Bacteria 869
320 Ga0157374_10086571 3300013296 Bacteria 2981
321 Ga0157374_10230397 3300013296 Bacteria 1820
322 Ga0157374_10869181 3300013296 Bacteria 919
323 Ga0157378_10053800 3300013297 Bacteria 3584
324 Ga0157378_10876270 3300013297 Bacteria 927
325 Ga0163162_10011696 3300013306 Bacteria 8558
326 Ga0163162_10093105 3300013306 Bacteria 3098
327 Ga0157372_10027041 3300013307 Bacteria 6245
328 Ga0157372_10054428 3300013307 Bacteria 4464
329 Ga0157372_10322562 3300013307 Bacteria 1798
330 Ga0157372_10352705 3300013307 Bacteria 1714
331 Ga0157375_10457624 3300013308 Bacteria 1441
332 Ga0157375_10554369 3300013308 Bacteria 1311
333 Ga0157375_10945253 3300013308 Bacteria 1004
334 Ga0163163_10018830 3300014325 Bacteria 6474
335 Ga0163163_10276084 3300014325 Bacteria 1732
336 Ga0157380_10073757 3300014326 Bacteria 2768
337 Ga0157377_10051266 3300014745 Bacteria 2327
338 Ga0157377_10301163 3300014745 Bacteria 1058
339 Ga0157379_10043645 3300014968 Bacteria 4003
340 Ga0157379_10239361 3300014968 Bacteria 1646
341 Ga0157379_10375102 3300014968 Bacteria 1305
342 Ga0157379_10469900 3300014968 Bacteria 1163
343 Ga0157379_10550291 3300014968 Bacteria 1074
344 Ga0157376_10255455 3300014969 Bacteria 1639
345 Ga0157376_10363875 3300014969 Bacteria 1388
346 Ga0157376_11676932 3300014969 Bacteria 671
347 Ga0182005_1057582 3300015265 Bacteria 1060
348 Ga0163161_10015187 3300017792 Bacteria 5366
349 Ga0163161_10135818 3300017792 Bacteria 1859
350 Ga0197907_10193487 3300020069 Bacteria 2855
351 Ga0206356_10016421 3300020070 Bacteria 742
352 Ga0206356_11724377 3300020070 Bacteria 2501
353 Ga0206355_1190914 3300020076 Bacteria 1122
354 Ga0206351_10217137 3300020077 Bacteria 2898
355 Ga0206352_10888235 3300020078 Bacteria 1387
356 Ga0206350_11009252 3300020080 Bacteria 3347
357 Ga0206354_10507425 3300020081 Bacteria 2012
358 Ga0206354_10872599 3300020081 Bacteria 3369
359 Ga0206353_11031566 3300020082 Bacteria 3852
360 Ga0206353_11153769 3300020082 Bacteria 1080
361 Ga0213875_10000312 3300021388 Bacteria 46369
362 Ga0213875_10094627 3300021388 Bacteria 1393
363 Ga0213875_10260724 3300021388 Bacteria 818
364 Ga0224712_10016888 3300022467 Bacteria 2409
365 Ga0224712_10378905 3300022467 Bacteria 672
366 Ga0228598_1009818 3300024227 Bacteria 1913
367 Ga0207692_10008449 3300025898 Bacteria 4259
368 Ga0207692_10014974 3300025898 Bacteria 3402
369 Ga0207692_10053087 3300025898 Bacteria 2063
370 Ga0207692_10096150 3300025898 Bacteria 1617
371 Ga0207642_10035776 3300025899 Bacteria 2125
372 Ga0207642_10115078 3300025899 Bacteria 1377
373 Ga0207710_10079136 3300025900 Bacteria 1522
374 Ga0207710_10377461 3300025900 Bacteria 725
375 Ga0207688_10006566 3300025901 Bacteria 6327
376 Ga0207688_10115790 3300025901 Bacteria 1560
377 Ga0207680_10026973 3300025903 Bacteria 3191
378 Ga0207680_10342344 3300025903 Bacteria 1049
379 Ga0207647_10196993 3300025904 Bacteria 1166
380 Ga0207647_10304675 3300025904 Bacteria 907
381 Ga0207685_10015217 3300025905 Bacteria 2432
382 Ga0207685_10024079 3300025905 Bacteria 2082
383 Ga0207685_10046686 3300025905 Bacteria 1649
384 Ga0207685_10164427 3300025905 Bacteria 1016
385 Ga0207699_10060547 3300025906 Bacteria 2274
386 Ga0207699_10071150 3300025906 Bacteria 2126
387 Ga0207699_10126295 3300025906 Bacteria 1661
388 Ga0207699_10205334 3300025906 Bacteria 1337
389 Ga0207699_10207017 3300025906 Bacteria 1332
390 Ga0207699_10571721 3300025906 Bacteria 821
391 Ga0207645_10169507 3300025907 Bacteria 1430
392 Ga0207645_10455080 3300025907 Bacteria 864
393 Ga0207684_10005898 3300025910 Bacteria 11220
394 Ga0207684_10011913 3300025910 Bacteria 7581
395 Ga0207684_10012239 3300025910 Bacteria 7468
396 Ga0207684_10016464 3300025910 Bacteria 6348
397 Ga0207684_10020833 3300025910 Bacteria 5602
398 Ga0207684_10101842 3300025910 Bacteria 2455
399 Ga0207684_10111877 3300025910 Bacteria 2337
400 Ga0207684_10195434 3300025910 Bacteria 1745
401 Ga0207684_10312798 3300025910 Bacteria 1354
402 Ga0207654_10049444 3300025911 Bacteria 2412
403 Ga0207654_10064032 3300025911 Bacteria 2160
404 Ga0207707_10203271 3300025912 Bacteria 1727
405 Ga0207707_10343871 3300025912 Bacteria 1286
406 Ga0207695_10169045 3300025913 Bacteria 2113
407 Ga0207671_10020275 3300025914 Bacteria 5064
408 Ga0207671_10297516 3300025914 Bacteria 1275
409 Ga0207671_10405881 3300025914 Bacteria 1084
410 Ga0207671_10433545 3300025914 Bacteria 1046
411 Ga0207693_10002203 3300025915 Bacteria 16995
412 Ga0207693_10010820 3300025915 Bacteria 7406
413 Ga0207693_10037347 3300025915 Bacteria 3828
414 Ga0207693_10064471 3300025915 Bacteria 2870
415 Ga0207693_10084809 3300025915 Bacteria 2482
416 Ga0207693_10194366 3300025915 Bacteria 1596
417 Ga0207693_10195170 3300025915 Bacteria 1593
418 Ga0207663_10002369 3300025916 Bacteria 9052
419 Ga0207663_10013744 3300025916 Bacteria 4411
420 Ga0207663_10031459 3300025916 Bacteria 3141
421 Ga0207663_10233442 3300025916 Bacteria 1345
422 Ga0207663_11096989 3300025916 Bacteria 640
423 Ga0207657_10009598 3300025919 Bacteria 9711
424 Ga0207657_10071365 3300025919 Bacteria 2941
425 Ga0207657_10289241 3300025919 Bacteria 1300
426 Ga0207652_10071175 3300025921 Bacteria 3021
427 Ga0207652_10650478 3300025921 Bacteria 943
428 Ga0207652_10656065 3300025921 Bacteria 938
429 Ga0207652_11145211 3300025921 Bacteria 679
430 Ga0207646_10000522 3300025922 Bacteria 51170
431 Ga0207646_10000995 3300025922 Bacteria 36401
432 Ga0207646_10031343 3300025922 Bacteria 4813
433 Ga0207646_10124805 3300025922 Bacteria 2314
434 Ga0207646_10301969 3300025922 Bacteria 1446
435 Ga0207646_10493209 3300025922 Bacteria 1104
436 Ga0207646_10538464 3300025922 Bacteria 1050
437 Ga0207646_10894712 3300025922 Bacteria 788
438 Ga0207681_10224454 3300025923 Bacteria 1455
439 Ga0207681_10376051 3300025923 Bacteria 1143
440 Ga0207687_10004449 3300025927 Bacteria 9346
441 Ga0207687_10008371 3300025927 Bacteria 6767
442 Ga0207687_10165298 3300025927 Bacteria 1702
443 Ga0207687_10342798 3300025927 Bacteria 1215
444 Ga0207700_10002650 3300025928 Bacteria 10305
445 Ga0207700_10004201 3300025928 Bacteria 8456
446 Ga0207700_10026046 3300025928 Bacteria 4072
447 Ga0207700_10182412 3300025928 Bacteria 1759
448 Ga0207700_10230822 3300025928 Bacteria 1573
449 Ga0207700_10348450 3300025928 Bacteria 1289
450 Ga0207700_10573731 3300025928 Bacteria 1003
451 Ga0207700_10694338 3300025928 Bacteria 908
452 Ga0207700_10792992 3300025928 Bacteria 847
453 Ga0207700_11092593 3300025928 Bacteria 713
454 Ga0207664_10001320 3300025929 Bacteria 16328
455 Ga0207664_10011877 3300025929 Bacteria 6213
456 Ga0207664_10141183 3300025929 Bacteria 2038
457 Ga0207664_10191464 3300025929 Bacteria 1761
458 Ga0207664_10420663 3300025929 Bacteria 1190
459 Ga0207690_10014526 3300025932 Bacteria 4756
460 Ga0207706_10151200 3300025933 Bacteria 2042
461 Ga0207686_10115979 3300025934 Bacteria 1814
462 Ga0207686_10221376 3300025934 Bacteria 1367
463 Ga0207709_10075878 3300025935 Bacteria 2150
464 Ga0207709_10202832 3300025935 Bacteria 1418
465 Ga0207670_10119242 3300025936 Bacteria 1915
466 Ga0207670_10491505 3300025936 Bacteria 995
467 Ga0207669_10066469 3300025937 Bacteria 2242
468 Ga0207704_10222921 3300025938 Bacteria 1396
469 Ga0207665_10000415 3300025939 Bacteria 29390
470 Ga0207665_10001572 3300025939 Bacteria 15407
471 Ga0207665_10003444 3300025939 Bacteria 10582
472 Ga0207665_10018055 3300025939 Bacteria 4635
473 Ga0207665_10020679 3300025939 Bacteria 4327
474 Ga0207665_10123370 3300025939 Bacteria 1832
475 Ga0207665_10378412 3300025939 Bacteria 1074
476 Ga0207691_10569634 3300025940 Bacteria 960
477 Ga0207711_10907722 3300025941 Bacteria 819
478 Ga0207661_10417609 3300025944 Bacteria 1218
479 Ga0207661_10943378 3300025944 Bacteria 795
480 Ga0207679_10267619 3300025945 Bacteria 1460
481 Ga0207667_10010261 3300025949 Bacteria 10963
482 Ga0207667_10576434 3300025949 Bacteria 1136
483 Ga0207712_10060148 3300025961 Bacteria 2692
484 Ga0207668_10092092 3300025972 Bacteria 2230
485 Ga0207640_10064652 3300025981 Bacteria 2437
486 Ga0207640_10085371 3300025981 Bacteria 2170
487 Ga0207640_10536817 3300025981 Bacteria 980
488 Ga0207658_10220971 3300025986 Bacteria 1594
489 Ga0207658_10489880 3300025986 Bacteria 1094
490 Ga0207677_10027607 3300026023 Bacteria 3579
491 Ga0207677_11259617 3300026023 Bacteria 678
492 Ga0207703_10824850 3300026035 Bacteria 886
493 Ga0207639_10124905 3300026041 Bacteria 2120
494 Ga0207639_10400390 3300026041 Bacteria 1236
495 Ga0207678_10007876 3300026067 Bacteria 9398
496 Ga0207708_10112122 3300026075 Bacteria 2118
497 Ga0207708_10449680 3300026075 Bacteria 1073
498 Ga0207702_10021410 3300026078 Bacteria 5353
499 Ga0207702_10027062 3300026078 Bacteria 4761
500 Ga0207702_10044033 3300026078 Bacteria 3750
501 Ga0207702_10173480 3300026078 Bacteria 1979
502 Ga0207702_10336735 3300026078 Bacteria 1441
503 Ga0207702_10618640 3300026078 Bacteria 1063
504 Ga0207702_11104023 3300026078 Bacteria 787
505 Ga0207641_10036817 3300026088 Bacteria 4084
506 Ga0207641_10261293 3300026088 Bacteria 1621
507 Ga0207641_10632223 3300026088 Bacteria 1050
508 Ga0207641_10731223 3300026088 Bacteria 976
509 Ga0207648_10053262 3300026089 Bacteria 3537
510 Ga0207648_10561562 3300026089 Bacteria 1049
511 Ga0207676_10784392 3300026095 Bacteria 929
512 Ga0207674_10108611 3300026116 Bacteria 2751
513 Ga0207674_10263904 3300026116 Bacteria 1669
514 Ga0207674_10387552 3300026116 Bacteria 1351
515 Ga0207675_100018442 3300026118 Bacteria 6507
516 Ga0207675_100099574 3300026118 Bacteria 2738
517 Ga0207683_10004722 3300026121 Bacteria 11738
518 Ga0207683_10045843 3300026121 Bacteria 3823
519 Ga0207683_10057495 3300026121 Bacteria 3414
520 Ga0207683_10229923 3300026121 Bacteria 1691
521 Ga0207683_10940986 3300026121 Bacteria 802
522 Ga0207698_10544688 3300026142 Bacteria 1136
523 Ga0209588_1073137 3300027671 Bacteria 1107
524 Ga0207428_10344598 3300027907 Bacteria 1097
525 Ga0268266_10089484 3300028379 Bacteria 2696
526 Ga0268266_10318248 3300028379 Bacteria 1456
527 Ga0268266_10862577 3300028379 Bacteria 875
528 Ga0268264_10098592 3300028381 Bacteria 2535
529 Ga0268264_11528019 3300028381 Bacteria 678
530 Ga0265762_1041943 3300030760 Bacteria 898
531 Ga0265760_10240216 3300031090 Bacteria 624
532 Ga0316576_10063281 3300031727 Bacteria 2715
533 Ga0307406_10050303 3300031901 Bacteria 2641
534 Ga0307406_11123814 3300031901 Bacteria 679
535 Ga0307407_10018527 3300031903 Bacteria 3523
536 Ga0307409_100058386 3300031995 Bacteria 2996
537 Ga0307409_101089000 3300031995 Bacteria 820
538 Ga0307416_100057017 3300032002 Bacteria 3157
539 Ga0307416_100303684 3300032002 Bacteria 1588
540 Ga0307411_10040742 3300032005 Bacteria 2949
541 Ga0373958_0001602 3300034819 Bacteria 3069
542 Ga0373958_0010243 3300034819 Bacteria 1560
543 Ga0373959_0011172 3300034820 Bacteria 1581
544 Ga0373938_0005931 3300034957 Bacteria 2093
545 Ga0373926_0003230 3300035083 Bacteria 5235
546 Ga0373926_0012632 3300035083 Bacteria 2856
547 Ga0373926_0029241 3300035083 Bacteria 1936
548 Ga0373926_0068791 3300035083 Bacteria 1298
549 Ga0373929_0043519 3300035085 Bacteria 1005
550 Ga0373934_0050625 3300035086 Bacteria 1645
551 Ga0373940_0004986 3300035088 Bacteria 2846
552 Ga0373944_0033216 3300035089 Bacteria 1562
553 Ga0373944_0253146 3300035089 Bacteria 651
554 Ga0373952_0029728 3300035092 Bacteria 1206
555 Ga0373952_0090300 3300035092 Bacteria 795
556 Ga0373923_0002069 3300035111 Bacteria 6064
557 Ga0373923_0017842 3300035111 Bacteria 2720
558 Ga0373923_0030728 3300035111 Bacteria 2162
559 Ga0373923_0031022 3300035111 Bacteria 2152
560 Ga0373923_0173087 3300035111 Bacteria 989
561 Ga0373923_0295681 3300035111 Bacteria 765
562 Ga0373932_0121214 3300035112 Bacteria 872
563 Ga0373936_0000363 3300035113 Bacteria 15394
564 Ga0373936_0003159 3300035113 Bacteria 6166
565 Ga0373936_0008487 3300035113 Bacteria 3869
566 Ga0373936_0043608 3300035113 Bacteria 1803
567 Ga0373936_0105224 3300035113 Bacteria 1194
568 Ga0373936_0197752 3300035113 Bacteria 886
569 Ga0373936_0297965 3300035113 Bacteria 727
570 Ga0373939_0023695 3300035114 Bacteria 1703
571 Ga0373941_0016833 3300035115 Bacteria 1994
572 Ga0373941_0194720 3300035115 Bacteria 768
573 Ga0373945_0002381 3300035116 Bacteria 5897
574 Ga0373945_0005406 3300035116 Bacteria 4087
575 Ga0373945_0012734 3300035116 Bacteria 2798
576 Ga0373945_0048873 3300035116 Bacteria 1551
577 Ga0373953_0006340 3300035117 Bacteria 3895
578 Ga0373953_0022119 3300035117 Bacteria 2394
579 Ga0373953_0023939 3300035117 Bacteria 2316
580 Ga0373954_0007188 3300035118 Bacteria 4861
581 Ga0373954_0039944 3300035118 Bacteria 2185
582 Ga0373954_0042016 3300035118 Bacteria 2132
583 Ga0373956_0039754 3300035119 Bacteria 2085
584 Ga0373956_0087132 3300035119 Bacteria 1437
585 Ga0373957_0013707 3300035120 Bacteria 2756
586 Ga0373957_0035093 3300035120 Bacteria 1861
587 Ga0373957_0041612 3300035120 Bacteria 1731
588 Ga0373957_0058955 3300035120 Bacteria 1484
589 Ga0373957_0127871 3300035120 Bacteria 1032
590 Ga0373957_0155371 3300035120 Bacteria 940
591 Ga0373960_0021382 3300035121 Bacteria 1720
592 Ga0373960_0187614 3300035121 Bacteria 725
593 Ga0373943_0000082 3300035170 Bacteria 33848
594 Ga0373943_0000981 3300035170 Bacteria 12658
595 Ga0373943_0173684 3300035170 Bacteria 1180
596 Ga0373943_0198498 3300035170 Bacteria 1109
597 Ga0373946_0001593 3300035171 Bacteria 7902
598 Ga0373946_0006874 3300035171 Bacteria 4141
599 Ga0373946_0055825 3300035171 Bacteria 1666
600 Ga0373946_0086528 3300035171 Bacteria 1381
601 Ga0373955_0034949 3300035172 Bacteria 2658
602 Ga0373955_0039792 3300035172 Bacteria 2511
603 Ga0373955_0102418 3300035172 Bacteria 1645
604 Ga0373955_0266935 3300035172 Bacteria 1028
605 Ga0373942_0019031 3300035207 Bacteria 1710
606 Ga0373961_0049256 3300035241 Bacteria 1244
607 Ga0316574_0008986 3300035398 Bacteria 5580
608 Ga0373924_0004423 3300035410 Bacteria 4906
609 Ga0373924_0035276 3300035410 Bacteria 2028
610 Ga0373924_0048091 3300035410 Bacteria 1761
611 Ga0373924_0071218 3300035410 Bacteria 1467
612 Ga0373924_0074756 3300035410 Bacteria 1433
613 Ga0373931_0001917 3300035691 Bacteria 9112
614 Ga0373931_0045974 3300035691 Bacteria 2306
615 Ga0373935_0000744 3300035692 Bacteria 17280
616 Ga0373935_0007338 3300035692 Bacteria 6593
617 Ga0373935_0014495 3300035692 Bacteria 4757
618 Ga0373935_0113204 3300035692 Bacteria 1803
619 Ga0373935_0142657 3300035692 Bacteria 1619
620 Ga0373935_0564236 3300035692 Bacteria 831
621 Ga0373927_0000670 3300035695 Bacteria 26064
622 Ga0373927_0006924 3300035695 Bacteria 7699
623 Ga0373927_0017377 3300035695 Bacteria 4734
624 Ga0373927_0837514 3300035695 Bacteria 607
625 Ga0373933_0004220 3300035724 Bacteria 7923
626 Ga0373933_0038743 3300035724 Bacteria 2801
627 Ga0373933_0194235 3300035724 Bacteria 1297
628 Ga0373933_0326309 3300035724 Bacteria 995
629 Ga0373947_0000619 3300035725 Bacteria 20965
630 Ga0373947_0001676 3300035725 Bacteria 13560
631 Ga0373947_0029323 3300035725 Bacteria 3228
632 Ga0373947_0097291 3300035725 Bacteria 1844
633 Ga0373947_0135282 3300035725 Bacteria 1576
634 Ga0373947_0200024 3300035725 Bacteria 1307
635 Ga0373947_0245605 3300035725 Bacteria 1182
636 Ga0373947_0364382 3300035725 Bacteria 971
637 Ga0373947_0373150 3300035725 Bacteria 959
638 Ga0373947_0700188 3300035725 Bacteria 691
639 Ga0373937_0012653 3300036401 Bacteria 7425
640 Ga0373937_0084779 3300036401 Bacteria 2931
641 Ga0373937_0226011 3300036401 Bacteria 1762
642 Ga0373937_0232446 3300036401 Bacteria 1736
643 Ga0373937_0379458 3300036401 Bacteria 1340
644 Ga0373937_0420458 3300036401 Bacteria 1268
645 Ga0373937_0463455 3300036401 Bacteria 1203
646 Ga0316582_0575986 3300036647 Bacteria 775
647 Ga0373925_0000013 3300037068 Bacteria 188673
648 Ga0373925_0002887 3300037068 Bacteria 13580
649 Ga0373925_0005796 3300037068 Bacteria 9178
650 Ga0373925_0023433 3300037068 Bacteria 4503
651 Ga0373925_0069601 3300037068 Bacteria 2658
652 Ga0373925_0171052 3300037068 Bacteria 1715
653 Ga0373925_0357664 3300037068 Bacteria 1186
654 Ga0373925_0964489 3300037068 Bacteria 702
655 Ga0395898_0007269 3300037466 Bacteria 11756
656 Ga0395905_0018704 3300037471 Bacteria 6571
657 Ga0436364_0590257 3300037853 Bacteria 2551
658 Ga0436364_0794523 3300037853 Bacteria 752
659 Ga0436364_1101267 3300037853 Bacteria 67281
660 Ga0395901_0024963 3300038443 Bacteria 6134
661 Ga0436362_1213167 3300039453 Bacteria 757
662 Ga0451841_0503580 3300041498 Bacteria 921
663 Ga0439455_0136410 3300042012 Bacteria 694
664 Ga0466963_0025233 3300044694 Bacteria 3789
665 Ga0466970_0157384 3300044765 Bacteria 1256
666 Ga0466958_0169034 3300045836 Bacteria 1384
667 Ga0466958_0188393 3300045836 Bacteria 1311
668 Ga0466967_0213298 3300045976 Bacteria 1832
669 Ga0466967_0227616 3300045976 Bacteria 1774
670 Ga0466967_0920227 3300045976 Bacteria 870
671 Ga0495592_0010608 3300046454 Bacteria 6949
672 Ga0495592_0015367 3300046454 Bacteria 5808
673 Ga0495592_0016899 3300046454 Bacteria 5540
674 Ga0495592_0075392 3300046454 Bacteria 2449
675 Ga0495592_0400554 3300046454 Bacteria 869
676 Ga0495603_0032365 3300046455 Bacteria 3146
677 Ga0495603_0129101 3300046455 Bacteria 1472
678 Ga0495590_0045509 3300046457 Bacteria 1531
679 Ga0495629_0008537 3300046459 Bacteria 7541
680 Ga0495629_0010816 3300046459 Bacteria 6638
681 Ga0495629_0023045 3300046459 Bacteria 4437
682 Ga0495629_0081240 3300046459 Bacteria 2262
683 Ga0495629_0274512 3300046459 Bacteria 1157
684 Ga0495641_0002945 3300046461 Bacteria 13114
685 Ga0495641_0006657 3300046461 Bacteria 7426
686 Ga0495641_0010459 3300046461 Bacteria 5373
687 Ga0495641_0041485 3300046461 Bacteria 2138
688 Ga0495651_0004872 3300046462 Bacteria 10267
689 Ga0495651_0044093 3300046462 Bacteria 3457
690 Ga0495651_0086420 3300046462 Bacteria 2359
691 Ga0495651_0117212 3300046462 Bacteria 1960
692 Ga0495651_0130097 3300046462 Bacteria 1838
693 Ga0495651_0632086 3300046462 Bacteria 672
694 Ga0495653_0002769 3300046463 Bacteria 13983
695 Ga0495653_0003629 3300046463 Bacteria 12445
696 Ga0495653_0016193 3300046463 Bacteria 6073
697 Ga0495653_0025855 3300046463 Bacteria 4710
698 Ga0495653_0057897 3300046463 Bacteria 2947
699 Ga0495653_0059658 3300046463 Bacteria 2894
700 Ga0495653_0060419 3300046463 Bacteria 2871
701 Ga0495653_0260945 3300046463 Bacteria 1145
702 Ga0495580_0013042 3300046472 Bacteria 6362
703 Ga0495580_0014128 3300046472 Bacteria 6070
704 Ga0495580_0098039 3300046472 Bacteria 2039
705 Ga0495582_0005354 3300046473 Bacteria 7163
706 Ga0495582_0049272 3300046473 Bacteria 2319
707 Ga0495582_0121891 3300046473 Bacteria 1469
708 Ga0495639_0005141 3300046475 Bacteria 5620
709 Ga0495639_0005478 3300046475 Bacteria 5466
710 Ga0495639_0170734 3300046475 Bacteria 1055
711 Ga0495639_0240850 3300046475 Bacteria 893
712 Ga0495639_0245420 3300046475 Bacteria 884
713 Ga0495662_0000412 3300046476 Bacteria 19214
714 Ga0495662_0002937 3300046476 Bacteria 8604
715 Ga0495662_0009808 3300046476 Bacteria 4704
716 Ga0495662_0018085 3300046476 Bacteria 3410
717 Ga0495662_0022911 3300046476 Bacteria 3014
718 Ga0495664_0001165 3300046477 Bacteria 13691
719 Ga0495664_0001890 3300046477 Bacteria 11135
720 Ga0495664_0003573 3300046477 Bacteria 8475
721 Ga0495664_0060626 3300046477 Bacteria 2252
722 Ga0495664_0068057 3300046477 Bacteria 2125
723 Ga0495664_0087897 3300046477 Bacteria 1868
724 Ga0495664_0166000 3300046477 Bacteria 1339
725 Ga0495664_0293088 3300046477 Bacteria 982
726 Ga0495664_0352053 3300046477 Bacteria 887
727 Ga0495664_0520289 3300046477 Bacteria 710
728 Ga0495594_0007359 3300046499 Bacteria 5661
729 Ga0495594_0058770 3300046499 Bacteria 2125
730 Ga0495594_0079479 3300046499 Bacteria 1831
731 Ga0495594_0466578 3300046499 Bacteria 718
732 Ga0495608_0002056 3300046511 Bacteria 14477
733 Ga0495608_0005716 3300046511 Bacteria 8876
734 Ga0495608_0007465 3300046511 Bacteria 7717
735 Ga0495608_0023494 3300046511 Bacteria 4225
736 Ga0495608_0032890 3300046511 Bacteria 3506
737 Ga0495608_0078230 3300046511 Bacteria 2152
738 Ga0495608_0089581 3300046511 Bacteria 1991
739 Ga0495608_0146801 3300046511 Bacteria 1504
740 Ga0495608_0513621 3300046511 Bacteria 725
741 Ga0495618_0002753 3300046514 Bacteria 11179
742 Ga0495618_0034684 3300046514 Bacteria 3165
743 Ga0495618_0071970 3300046514 Bacteria 2199
744 Ga0495618_0078659 3300046514 Bacteria 2102
745 Ga0495618_0215514 3300046514 Bacteria 1212
746 Ga0495620_0002530 3300046515 Bacteria 10585
747 Ga0495628_0006341 3300046516 Bacteria 10339
748 Ga0495628_0023189 3300046516 Bacteria 5096
749 Ga0495628_0273997 3300046516 Bacteria 1254
750 Ga0495628_0364092 3300046516 Bacteria 1061
751 Ga0495628_0398039 3300046516 Bacteria 1006
752 Ga0495628_0416432 3300046516 Bacteria 979
753 Ga0495628_0419460 3300046516 Bacteria 975
754 Ga0495630_0041245 3300046517 Bacteria 3446
755 Ga0495630_0131022 3300046517 Bacteria 1904
756 Ga0495630_0247316 3300046517 Bacteria 1362
757 Ga0495630_0278247 3300046517 Bacteria 1278
758 Ga0495630_0792064 3300046517 Bacteria 724
759 Ga0495643_0004928 3300046522 Bacteria 9169
760 Ga0495648_0001739 3300046524 Bacteria 21040
761 Ga0495648_0061056 3300046524 Bacteria 2240
762 Ga0495666_0047271 3300046526 Bacteria 2073
763 Ga0495666_0257422 3300046526 Bacteria 794
764 Ga0495642_0091215 3300046528 Bacteria 1290
765 Ga0495652_0010636 3300046529 Bacteria 8336
766 Ga0495652_0029759 3300046529 Bacteria 4794
767 Ga0495652_0068948 3300046529 Bacteria 2961
768 Ga0495652_0142687 3300046529 Bacteria 1882
769 Ga0495652_0243480 3300046529 Bacteria 1336
770 Ga0495652_0306394 3300046529 Bacteria 1152
771 Ga0495652_0636827 3300046529 Bacteria 723
772 Ga0495654_0027042 3300046530 Bacteria 2944
773 Ga0495665_0000527 3300046531 Bacteria 19367
774 Ga0495665_0001636 3300046531 Bacteria 11995
775 Ga0495665_0005757 3300046531 Bacteria 6689
776 Ga0495665_0027374 3300046531 Bacteria 3059
777 Ga0495665_0195361 3300046531 Bacteria 1050
778 Ga0495640_0017096 3300046533 Bacteria 5412
779 Ga0495640_0022869 3300046533 Bacteria 4565
780 Ga0495640_0029267 3300046533 Bacteria 3956
781 Ga0495640_0045341 3300046533 Bacteria 3051
782 Ga0495640_0059035 3300046533 Bacteria 2614
783 Ga0495640_0177384 3300046533 Bacteria 1359
784 Ga0495586_0003401 3300046535 Bacteria 8534
785 Ga0495586_0004628 3300046535 Bacteria 7355
786 Ga0495586_0036463 3300046535 Bacteria 2639
787 Ga0495587_0017623 3300046536 Bacteria 4435
788 Ga0495587_0055131 3300046536 Bacteria 2342
789 Ga0495587_0067454 3300046536 Bacteria 2085
790 Ga0495587_0091792 3300046536 Bacteria 1753
791 Ga0495587_0163884 3300046536 Bacteria 1264
792 Ga0495587_0365195 3300046536 Bacteria 803
793 Ga0495597_0004001 3300046542 Bacteria 8283
794 Ga0495645_0008911 3300046543 Bacteria 7008
795 Ga0495645_0013185 3300046543 Bacteria 5843
796 Ga0495645_0120487 3300046543 Bacteria 1847
797 Ga0495645_0170280 3300046543 Bacteria 1499
798 Ga0495667_0001822 3300046559 Bacteria 14145
799 Ga0495667_0007970 3300046559 Bacteria 7184
800 Ga0495667_0008462 3300046559 Bacteria 6984
801 Ga0495667_0015884 3300046559 Bacteria 5090
802 Ga0495667_0017050 3300046559 Bacteria 4904
803 Ga0495667_0028615 3300046559 Bacteria 3753
804 Ga0495667_0062294 3300046559 Bacteria 2444
805 Ga0495667_0064921 3300046559 Bacteria 2387
806 Ga0495668_0016829 3300046616 Bacteria 4248
807 Ga0495634_0004848 3300046642 Bacteria 10436
808 Ga0495634_0011711 3300046642 Bacteria 6378
809 Ga0495634_0014802 3300046642 Bacteria 5611
810 Ga0495634_0024908 3300046642 Bacteria 4194
811 Ga0495634_0026269 3300046642 Bacteria 4065
812 Ga0495634_0027695 3300046642 Bacteria 3941
813 Ga0495634_0121002 3300046642 Bacteria 1676
814 Ga0495611_0118508 3300046648 Bacteria 1234
815 Ga0495611_0247982 3300046648 Bacteria 825
816 Ga0495635_0002095 3300046663 Bacteria 13548
817 Ga0495635_0013993 3300046663 Bacteria 5613
818 Ga0495635_0029852 3300046663 Bacteria 3791
819 Ga0495635_0032664 3300046663 Bacteria 3610
820 Ga0495635_0163094 3300046663 Bacteria 1516
821 Ga0495635_0180065 3300046663 Bacteria 1437
822 Ga0495635_0271088 3300046663 Bacteria 1141
823 Ga0495588_0002905 3300046674 Bacteria 7391
824 Ga0495588_0032267 3300046674 Bacteria 2639
825 Ga0495588_0152399 3300046674 Bacteria 1222
826 Ga0495657_0005225 3300046675 Bacteria 10278
827 Ga0495657_0018927 3300046675 Bacteria 4976
828 Ga0495657_0020071 3300046675 Bacteria 4809
829 Ga0495657_0027035 3300046675 Bacteria 4055
830 Ga0495657_0035016 3300046675 Bacteria 3483
831 Ga0495657_0040974 3300046675 Bacteria 3172
832 Ga0495599_0006865 3300046678 Bacteria 6882
833 Ga0495599_0009805 3300046678 Bacteria 5862
834 Ga0495599_0013955 3300046678 Bacteria 4973
835 Ga0495599_0027472 3300046678 Bacteria 3567
836 Ga0495599_0030594 3300046678 Bacteria 3378
837 Ga0495599_0049813 3300046678 Bacteria 2625
838 Ga0495599_0316745 3300046678 Bacteria 939
839 Ga0495623_0031543 3300046679 Bacteria 3406
840 Ga0495623_0106721 3300046679 Bacteria 1701
841 Ga0495623_0282193 3300046679 Bacteria 923
842 Ga0495623_0327516 3300046679 Bacteria 839
843 Ga0495646_0004953 3300046680 Bacteria 8410
844 Ga0495646_0025844 3300046680 Bacteria 3690
845 Ga0495646_0030429 3300046680 Bacteria 3372
846 Ga0495647_0081811 3300046681 Bacteria 1310
847 Ga0495658_0003617 3300046683 Bacteria 7652
848 Ga0495658_0015647 3300046683 Bacteria 3893
849 Ga0495658_0069621 3300046683 Bacteria 2039
850 Ga0495658_0194716 3300046683 Bacteria 1261
851 Ga0495613_0004498 3300046689 Bacteria 10445
852 Ga0495613_0075223 3300046689 Bacteria 2459
853 Ga0495613_0093465 3300046689 Bacteria 2177
854 Ga0495613_0182824 3300046689 Bacteria 1484
855 Ga0495624_0008035 3300046690 Bacteria 7389
856 Ga0495624_0009276 3300046690 Bacteria 6818
857 Ga0495624_0011078 3300046690 Bacteria 6206
858 Ga0495624_0019615 3300046690 Bacteria 4509
859 Ga0495624_0145528 3300046690 Bacteria 1450
860 Ga0495671_0032908 3300046692 Bacteria 2644
861 Ga0495649_0037901 3300046694 Bacteria 2645
862 Ga0495589_0021643 3300046794 Bacteria 3285
863 Ga0495600_0004205 3300046809 Bacteria 8593
864 Ga0495600_0006618 3300046809 Bacteria 7060
865 Ga0495600_0031204 3300046809 Bacteria 3451
866 Ga0495600_0037979 3300046809 Bacteria 3132
867 Ga0495600_0053541 3300046809 Bacteria 2636
868 Ga0495600_0066381 3300046809 Bacteria 2358
869 Ga0495600_0138596 3300046809 Bacteria 1579
870 Ga0495600_0264666 3300046809 Bacteria 1092
871 Ga0495660_0023101 3300046810 Bacteria 3549
872 Ga0495581_0003802 3300047315 Bacteria 8687
873 Ga0495581_0005975 3300047315 Bacteria 7051
874 Ga0495581_0008002 3300047315 Bacteria 6125
875 Ga0495581_0010149 3300047315 Bacteria 5450
876 Ga0495581_0010625 3300047315 Bacteria 5322
877 Ga0495581_0247020 3300047315 Bacteria 1043
878 Ga0495581_0643928 3300047315 Bacteria 613
879 Ga0495581_0696696 3300047315 Bacteria 586
880 Ga0495604_0028129 3300047317 Bacteria 4472
881 Ga0495604_0033329 3300047317 Bacteria 4078
882 Ga0495604_0044165 3300047317 Bacteria 3484
883 Ga0495604_0107403 3300047317 Bacteria 2040
884 Ga0495604_0141785 3300047317 Bacteria 1716
885 Ga0495604_0305923 3300047317 Bacteria 1066
886 Ga0495674_0001939 3300047319 Bacteria 20412
887 Ga0495674_0005954 3300047319 Bacteria 11697
888 Ga0495674_0039427 3300047319 Bacteria 4234
889 Ga0495674_0047011 3300047319 Bacteria 3828
890 Ga0495674_0083509 3300047319 Bacteria 2738
891 Ga0495674_0240067 3300047319 Bacteria 1493
892 Ga0495674_0305147 3300047319 Bacteria 1299
893 Ga0495674_0398944 3300047319 Bacteria 1110
894 Ga0495674_0412763 3300047319 Bacteria 1088
895 Ga0495674_0580662 3300047319 Bacteria 889
896 Ga0495674_0977222 3300047319 Bacteria 650
897 Ga0495672_0001084 3300047320 Bacteria 27657
898 Ga0495676_0014233 3300047321 Bacteria 7122
899 Ga0495676_0029722 3300047321 Bacteria 4650
900 Ga0495676_0032348 3300047321 Bacteria 4416
901 Ga0495676_0104921 3300047321 Bacteria 2084
902 Ga0495676_0432874 3300047321 Bacteria 869
903 Ga0495680_0004959 3300047322 Bacteria 12594
904 Ga0495680_0040720 3300047322 Bacteria 3699
905 Ga0495680_0045281 3300047322 Bacteria 3474
906 Ga0495680_0052221 3300047322 Bacteria 3187
907 Ga0495680_0087409 3300047322 Bacteria 2344
908 Ga0495680_0129634 3300047322 Bacteria 1854
909 Ga0495680_0305774 3300047322 Bacteria 1115
910 Ga0495680_0486686 3300047322 Bacteria 839
911 Ga0495683_0073618 3300047323 Bacteria 1675
912 Ga0495687_017124 3300047443 Bacteria 3626
913 Ga0495675_0017646 3300047444 Bacteria 4525
914 Ga0495675_0018849 3300047444 Bacteria 4384
915 Ga0495675_0031676 3300047444 Bacteria 3375
916 Ga0495675_0063827 3300047444 Bacteria 2330
917 Ga0495675_0121648 3300047444 Bacteria 1625
918 Ga0495675_0187677 3300047444 Bacteria 1263
919 Ga0495675_0205479 3300047444 Bacteria 1197
920 Ga0495677_0011039 3300047445 Bacteria 3310
921 Ga0495677_0049407 3300047445 Bacteria 1546
922 Ga0495673_0001554 3300047469 Bacteria 17987
923 Ga0495684_0001710 3300047471 Bacteria 17662
924 Ga0495684_0001792 3300047471 Bacteria 17242
925 Ga0495684_0009255 3300047471 Bacteria 7607
926 Ga0495684_0015690 3300047471 Bacteria 5828
927 Ga0495684_0061160 3300047471 Bacteria 2865
928 Ga0495684_0088808 3300047471 Bacteria 2342
929 Ga0495684_0244909 3300047471 Bacteria 1306
930 Ga0495593_0002686 3300047673 Bacteria 10697
931 Ga0495593_0003268 3300047673 Bacteria 9720
932 Ga0495593_0032155 3300047673 Bacteria 2862
933 Ga0495593_0061312 3300047673 Bacteria 1967
934 Ga0495602_0042823 3300048088 Bacteria 4121
935 Ga0495602_0049682 3300048088 Bacteria 3754
936 Ga0495602_0071308 3300048088 Bacteria 2967
937 Ga0495602_0073794 3300048088 Bacteria 2902
938 Ga0495602_0131359 3300048088 Bacteria 1996
939 Ga0495602_0616566 3300048088 Bacteria 744
940 Ga0495614_0001922 3300048089 Bacteria 9108
941 Ga0495614_0018578 3300048089 Bacteria 3012
942 Ga0495614_0018654 3300048089 Bacteria 3004
943 Ga0496100_0031222 3300048903 Bacteria 3310
944 Ga0496100_0042032 3300048903 Bacteria 2917
945 Ga0496100_0055391 3300048903 Bacteria 2590
946 Ga0496100_0146155 3300048903 Bacteria 1681
947 Ga0496100_0901097 3300048903 Bacteria 694
948 Ga0496100_1293289 3300048903 Bacteria 575
949 Ga0496101_0007400 3300048904 Bacteria 7113
950 Ga0496101_0009428 3300048904 Bacteria 6417
951 Ga0496101_0016606 3300048904 Bacteria 4978
952 Ga0496101_0027452 3300048904 Bacteria 3966
953 Ga0496101_0078509 3300048904 Bacteria 2435
954 Ga0496102_0002361 3300048905 Bacteria 16111
955 Ga0496102_0059619 3300048905 Bacteria 3490
956 Ga0496102_0063830 3300048905 Bacteria 3373
957 Ga0496102_0314893 3300048905 Bacteria 1474
958 Ga0496102_0340472 3300048905 Bacteria 1412
959 Ga0496103_0000900 3300048906 Bacteria 21361
960 Ga0496103_0021988 3300048906 Bacteria 3839
961 Ga0496103_0060001 3300048906 Bacteria 2364
962 Ga0496103_0494979 3300048906 Bacteria 782
963 Ga0496103_0597210 3300048906 Bacteria 703
964 Ga0496104_0052222 3300048907 Bacteria 3860
965 Ga0496104_0127458 3300048907 Bacteria 2444
966 Ga0496104_0786087 3300048907 Bacteria 858
967 Ga0496105_0131535 3300048908 Bacteria 2063
968 Ga0496105_0142488 3300048908 Bacteria 1972
969 Ga0496105_0535885 3300048908 Bacteria 915
970 Ga0496106_0008276 3300048909 Bacteria 7695
971 Ga0496106_0014311 3300048909 Bacteria 5862
972 Ga0496106_0017839 3300048909 Bacteria 5248
973 Ga0496106_0197799 3300048909 Bacteria 1599
974 Ga0496106_0222264 3300048909 Bacteria 1506
975 Ga0496107_0031543 3300048910 Bacteria 3782
976 Ga0496107_0041358 3300048910 Bacteria 3309
977 Ga0496107_0042154 3300048910 Bacteria 3278
978 Ga0496107_0087504 3300048910 Bacteria 2274
979 Ga0496107_0459552 3300048910 Bacteria 945
980 Ga0496108_0001177 3300048911 Bacteria 20397
981 Ga0496108_0005259 3300048911 Bacteria 10452
982 Ga0496108_0037682 3300048911 Bacteria 4028
983 Ga0496109_0000999 3300048912 Bacteria 23362
984 Ga0496109_0004046 3300048912 Bacteria 12246
985 Ga0496109_0016077 3300048912 Bacteria 6538
986 Ga0496109_0598665 3300048912 Bacteria 1038
987 Ga0496110_0001024 3300048913 Bacteria 19667
988 Ga0496110_0027396 3300048913 Bacteria 4885
989 Ga0496110_0054339 3300048913 Bacteria 3522
990 Ga0496110_0112353 3300048913 Bacteria 2449
991 Ga0496110_0605308 3300048913 Bacteria 994
992 Ga0496111_0000822 3300048914 Bacteria 16685
993 Ga0496111_0031219 3300048914 Bacteria 3794
994 Ga0496111_0350133 3300048914 Bacteria 1093
995 Ga0496112_0005524 3300048915 Bacteria 10951
996 Ga0496112_0025280 3300048915 Bacteria 5701
997 Ga0496112_0077765 3300048915 Bacteria 3281
998 Ga0496112_0286452 3300048915 Bacteria 1594
999 Ga0496112_0964220 3300048915 Bacteria 773
1000 Ga0496112_1208963 3300048915 Bacteria 672
1001 Ga0496113_0026268 3300048916 Bacteria 4161
1002 Ga0496113_0200431 3300048916 Bacteria 1586
1003 Ga0496113_1039547 3300048916 Bacteria 644
1004 Ga0496114_0012826 3300048917 Bacteria 6711
1005 Ga0496114_0052454 3300048917 Bacteria 3398
1006 Ga0496114_0287010 3300048917 Bacteria 1451
1007 Ga0496114_0405272 3300048917 Bacteria 1207
1008 Ga0496115_0011617 3300048918 Bacteria 6607
1009 Ga0496115_0215929 3300048918 Bacteria 1583
1010 Ga0496115_0241103 3300048918 Bacteria 1490
1011 Ga0496115_0251814 3300048918 Bacteria 1454
1012 Ga0496115_0481314 3300048918 Bacteria 999
1013 Ga0496115_0740418 3300048918 Bacteria 769
1014 Ga0496126_0018870 3300048929 Bacteria 6815
1015 Ga0501032_0040837 3300049569 Bacteria 3152
1016 Ga0501034_1338215 3300049571 Bacteria 592
1017 Ga0501038_0014496 3300049574 Bacteria 7184
1018 Ga0501038_0226986 3300049574 Bacteria 1488
1019 Ga0501040_0116215 3300049576 Bacteria 1874
1020 Ga0501042_0145193 3300049578 Bacteria 1710
1021 Ga0501047_0070677 3300049581 Bacteria 3361
1022 Ga0501048_0016245 3300049582 Bacteria 5488
1023 Ga0501076_0065560 3300049592 Bacteria 2896
1024 Ga0501077_0066460 3300049593 Bacteria 2287
1025 Ga0501079_0091892 3300049741 Bacteria 2351
1026 Ga0501079_0965205 3300049741 Bacteria 671
1027 Ga0501080_0227225 3300049742 Bacteria 1706
1028 Ga0501081_0168560 3300049743 Bacteria 1580
1029 Ga0501035_0021515 3300049822 Bacteria 5929
1030 Ga0501044_0133704 3300049823 Bacteria 2473
1031 nmdc:mga07m45_38484_c1 3300050496 Bacteria 2669
1032 nmdc:mga05p37_1162329_c1 3300050507 Bacteria 801
1033 nmdc:mga05p37_19328_c1 3300050507 Bacteria 8241
1034 nmdc:mga05p37_78124_c1 3300050507 Bacteria 4075
1035 nmdc:mga09592_198152_c1 3300050508 Bacteria 1739
1036 nmdc:mga09592_451649_c1 3300050508 Bacteria 1109
1037 nmdc:mga06r32_361007_c1 3300050510 Bacteria 1437
1038 nmdc:mga06r32_517088_c1 3300050510 Bacteria 1170
1039 nmdc:mga06r32_913693_c1 3300050510 Bacteria 834
1040 nmdc:mga0n895_1090152_c1 3300050512 Bacteria 776
1041 nmdc:mga0n895_64166_c1 3300050512 Bacteria 3633
1042 nmdc:mga0n895_76922_c1 3300050512 Bacteria 3319
1043 nmdc:mga0n895_80677_c1 3300050512 Bacteria 3242
1044 nmdc:mga0rr50_289793_c1 3300050513 Bacteria 1368
1045 nmdc:mga0rr50_376532_c1 3300050513 Bacteria 1196
1046 nmdc:mga0rr50_42045_c1 3300050513 Bacteria 3335
1047 nmdc:mga0rr50_650450_c1 3300050513 Bacteria 899
1048 nmdc:mga0rr50_901_c1 3300050513 Bacteria 16066
1049 nmdc:mga0rr50_90468_c1 3300050513 Bacteria 2382
1050 nmdc:mga08x19_21480_c1 3300050514 Bacteria 3986
1051 nmdc:mga08x19_555077_c1 3300050514 Bacteria 813
1052 nmdc:mga08x19_620743_c1 3300050514 Bacteria 766
1053 nmdc:mga08x19_66942_c1 3300050514 Bacteria 2336
1054 nmdc:mga08x19_743781_c1 3300050514 Bacteria 696
1055 nmdc:mga08x19_92046_c1 3300050514 Bacteria 2002
1056 nmdc:mga0a205_147319_c1 3300050515 Bacteria 2254
1057 Ga0495601_0023284 3300053077 Bacteria 3805
1058 Ga0495601_0031070 3300053077 Bacteria 3318
1059 Ga0495601_0046115 3300053077 Bacteria 2743
1060 Ga0495601_0050486 3300053077 Bacteria 2623
1061 Ga0495612_0003397 3300053078 Bacteria 6596
1062 Ga0495612_0012345 3300053078 Bacteria 3443
1063 Ga0495612_0016147 3300053078 Bacteria 2991
1064 Ga0495612_0189731 3300053078 Bacteria 904
1065 Ga0495595_0003315 3300053084 Bacteria 6386
1066 Ga0495595_0006299 3300053084 Bacteria 4832
1067 Ga0495595_0035229 3300053084 Bacteria 2267
1068 Ga0495595_0052398 3300053084 Bacteria 1893
1069 Ga0495619_0014137 3300053085 Bacteria 5040
1070 Ga0495619_0022070 3300053085 Bacteria 4069
1071 Ga0495619_0188481 3300053085 Bacteria 1427
1072 Ga0495619_0575481 3300053085 Bacteria 771
1073 Ga0495619_0661282 3300053085 Bacteria 712
1074 Ga0501082_0114752 3300060353 Bacteria 2332
1075 2616698833 2616644814 Bacteria 11555299
1076 2776372014 2775506925 Bacteria 7237746
1077 2863072744 2863067949 Bacteria 8541735
1078 Ga0207699_10027900
1079 JGI24737J22298_10160246
1080 JGI24735J21928_10093421
1081 JGI25405J52794_10035640
1082 Ga0070683_100307317
1083 Ga0070683_100497232
1084 Ga0070683_100741731
1085 Ga0070690_100065426
1086 Ga0070690_100870557
1087 Ga0070670_100524492
1088 Ga0070670_100768070
1089 Ga0068869_100906888
1090 Ga0070666_10275128
1091 Ga0070682_100122746
1092 Ga0068868_100016481
1093 Ga0068868_100038154
1094 Ga0068868_100050853
1095 Ga0068868_100802099
1096 Ga0070660_100027711
1097 Ga0070660_100039597
1098 Ga0070660_100061081
1099 Ga0070660_100278383
1100 Ga0070689_100550756
1101 Ga0070691_10039982
1102 Ga0070691_10062670
1103 Ga0070691_10089050
1104 Ga0070691_10228752
1105 Ga0070687_100357250
1106 Ga0070661_101215401
1107 Ga0070692_10026793
1108 Ga0070692_10212074
1109 Ga0070692_10500182
1110 Ga0070668_100604672
1111 Ga0070669_100303473
1112 Ga0070671_100489358
1113 Ga0070671_100949736
1114 Ga0070671_101116593
1115 Ga0070674_100051847
1116 Ga0070673_101692510
1117 Ga0070688_100233666
1118 Ga0070688_100306472
1119 Ga0070659_100033283
1120 Ga0070659_100194188
1121 Ga0070667_101420759
1122 Ga0070709_10002265
1123 Ga0070709_10019775
1124 Ga0070709_10167921
1125 Ga0070709_10179577
1126 Ga0070709_10686549
1127 Ga0070714_100115390
1128 Ga0070714_100256802
1129 Ga0070714_100260198
1130 Ga0070714_100354509
1131 Ga0070714_100466077
1132 Ga0070714_100615307
1133 Ga0070714_100843212
1134 Ga0070714_100978775
1135 Ga0070713_100023504
1136 Ga0070713_100040276
1137 Ga0070713_100065915
1138 Ga0070713_100083999
1139 Ga0070713_100114161
1140 Ga0070713_100210599
1141 Ga0070713_100336574
1142 Ga0070713_100819919
1143 Ga0070713_100964657
1144 Ga0070710_10000062
1145 Ga0070710_10001471
1146 Ga0070710_10085055
1147 Ga0070710_10181653
1148 Ga0070710_10183221
1149 Ga0070710_10271182
1150 Ga0070710_10280668
1151 Ga0070710_10443148
1152 Ga0070701_10386290
1153 Ga0070701_10619525
1154 Ga0070701_10753897
1155 Ga0070711_100005424
1156 Ga0070711_100008495
1157 Ga0070711_100016448
1158 Ga0070711_100016904
1159 Ga0070711_100073573
1160 Ga0070711_100419923
1161 Ga0070700_100041681
1162 Ga0070700_100340297
1163 Ga0070694_100087949
1164 Ga0070694_100216858
1165 Ga0070708_100005426
1166 Ga0070708_100016992
1167 Ga0070708_100480890
1168 Ga0070663_100196445
1169 Ga0070663_100464970
1170 Ga0070678_100137178
1171 Ga0070678_100178806
1172 Ga0070678_100370996
1173 Ga0070662_100230604
1174 Ga0070681_10317335
1175 Ga0068867_100084429
1176 Ga0068867_100695110
1177 Ga0070685_10114512
1178 Ga0070685_10659487
1179 Ga0070706_100002279
1180 Ga0070706_100002738
1181 Ga0070706_100008799
1182 Ga0070706_100010481
1183 Ga0070706_100054380
1184 Ga0070706_100103563
1185 Ga0070706_100135523
1186 Ga0070706_100398727
1187 Ga0070706_100413919
1188 Ga0070706_100500708
1189 Ga0070706_100860426
1190 Ga0070707_100000766
1191 Ga0070707_100005165
1192 Ga0070707_100006185
1193 Ga0070707_100011348
1194 Ga0070707_100020722
1195 Ga0070707_100085411
1196 Ga0070707_100335877
1197 Ga0070707_100377055
1198 Ga0070707_100396758
1199 Ga0070707_101018551
1200 Ga0070698_100000052
1201 Ga0070698_100000240
1202 Ga0070698_100001129
1203 Ga0070698_100003354
1204 Ga0070698_100005243
1205 Ga0070698_100013120
1206 Ga0070698_100055330
1207 Ga0070698_100212488
1208 Ga0070699_100253103
1209 Ga0070699_101257490
1210 Ga0070679_100012946
1211 Ga0070679_100114074
1212 Ga0070679_100663271
1213 Ga0070684_100043947
1214 Ga0070684_100195894
1215 Ga0070684_100680421
1216 Ga0070684_100799064
1217 Ga0070684_101097988
1218 Ga0070697_100007609
1219 Ga0068853_100004797
1220 Ga0068853_100594607
1221 Ga0070672_101059232
1222 Ga0070686_100083169
1223 Ga0070686_100084243
1224 Ga0070695_100011751
1225 Ga0070696_100207430
1226 Ga0070696_100621978
1227 Ga0070693_100229791
1228 Ga0070665_100024902
1229 Ga0070665_100129287
1230 Ga0070665_100159587
1231 Ga0070704_100009198
1232 Ga0068855_100062078
1233 Ga0068855_100064949
1234 Ga0068855_100986362
1235 Ga0070664_100403696
1236 Ga0068857_100142928
1237 Ga0068857_100175450
1238 Ga0068857_100205191
1239 Ga0068854_100002781
1240 Ga0068854_100232659
1241 Ga0068854_100522646
1242 Ga0068856_100116981
1243 Ga0068856_100201091
1244 Ga0068856_100217338
1245 Ga0068856_100336074
1246 Ga0068856_100371172
1247 Ga0068856_100409676
1248 Ga0068856_100711659
1249 Ga0070702_100035399
1250 Ga0070702_100037322
1251 Ga0070702_100088248
1252 Ga0068852_100639401
1253 Ga0068859_100057132
1254 Ga0068859_100065371
1255 Ga0068859_100426432
1256 Ga0068859_100692745
1257 Ga0068864_100041744
1258 Ga0068864_100072061
1259 Ga0068864_100279276
1260 Ga0068864_100343175
1261 Ga0068866_10063641
1262 Ga0068866_10197049
1263 Ga0068851_10026810
1264 Ga0068863_100045859
1265 Ga0068863_100046775
1266 Ga0068863_100418425
1267 Ga0068863_100472858
1268 Ga0068863_100915285
1269 Ga0068863_101903271
1270 Ga0068858_100211923
1271 Ga0068858_100486811
1272 Ga0068860_100020629
1273 Ga0068860_100131329
1274 Ga0068860_100379837
1275 Ga0081455_10001937
1276 Ga0081455_10016218
1277 Ga0081538_10002084
1278 Ga0081538_10004035
1279 Ga0081540_1003740
1280 Ga0081540_1005630
1281 Ga0081540_1023540
1282 Ga0070717_10023809
1283 Ga0070717_10083818
1284 Ga0070717_10110358
1285 Ga0070717_10116251
1286 Ga0070717_10118858
1287 Ga0070717_10170150
1288 Ga0070717_10241112
1289 Ga0070717_10583525
1290 Ga0070717_10745248
1291 Ga0075365_10466746
1292 Ga0075432_10055200
1293 Ga0070715_10006440
1294 Ga0070715_10008224
1295 Ga0070715_10023449
1296 Ga0070715_10068850
1297 Ga0070715_10071947
1298 Ga0070715_10522790
1299 Ga0070716_100043934
1300 Ga0070716_100065349
1301 Ga0070716_100104672
1302 Ga0070716_100288058
1303 Ga0070716_100297222
1304 Ga0070712_100012380
1305 Ga0070712_100168892
1306 Ga0070712_100199023
1307 Ga0070712_100271233
1308 Ga0070712_100464804
1309 Ga0070712_100475036
1310 Ga0070712_100717420
1311 Ga0097621_100211628
1312 Ga0097621_100879294
1313 Ga0068871_100015846
1314 Ga0068871_100350500
1315 Ga0075431_100007823
1316 Ga0075431_100971727
1317 Ga0075433_10047959
1318 Ga0075433_10065399
1319 Ga0075433_10066227
1320 Ga0075433_10142550
1321 Ga0075434_100001286
1322 Ga0075434_100005698
1323 Ga0075434_100072103
1324 Ga0075434_100074251
1325 Ga0075434_100139705
1326 Ga0075434_100722957
1327 Ga0075434_101271474
1328 Ga0068865_100346889
1329 Ga0068865_100426423
1330 Ga0075436_100076354
1331 Ga0075436_100089709
1332 Ga0075436_100123136
1333 Ga0075436_100185475
1334 Ga0075436_100674392
1335 Ga0097620_100057135
1336 Ga0097620_100065372
1337 Ga0097620_100426414
1338 Ga0097620_100692773
1339 Ga0075435_100026742
1340 Ga0075435_100074841
1341 Ga0075435_100081661
1342 Ga0075435_100295481
1343 Ga0075435_100412351
1344 Ga0105240_10023204
1345 Ga0105240_10244863
1346 Ga0105240_10599435
1347 Ga0105240_10951325
1348 Ga0111539_10215835
1349 Ga0111539_10302489
1350 Ga0105245_10002929
1351 Ga0105245_10017210
1352 Ga0105245_10105754
1353 Ga0105245_10202444
1354 Ga0105245_10503595
1355 Ga0105247_10071459
1356 Ga0105247_10207792
1357 Ga0105247_10287245
1358 Ga0105247_10363096
1359 Ga0114129_10001833
1360 Ga0114129_10026476
1361 Ga0114129_10040022
1362 Ga0114129_10091948
1363 Ga0114129_11154820
1364 Ga0114129_11251461
1365 Ga0114129_11379535
1366 Ga0105243_10061350
1367 Ga0105243_10079189
1368 Ga0105243_11062704
1369 Ga0105243_11256592
1370 Ga0105243_11711984
1371 Ga0105243_12497103
1372 Ga0105242_10062167
1373 Ga0105242_10104966
1374 Ga0105242_10317229
1375 Ga0105242_10822083
1376 Ga0105248_10211288
1377 Ga0105248_10463612
1378 Ga0105248_10983387
1379 Ga0105248_11024837
1380 Ga0105237_10181882
1381 Ga0105238_10064237
1382 Ga0105238_11485484
1383 Ga0105249_10013128
1384 Ga0105249_10236514
1385 Ga0105249_10408552
1386 Ga0105239_10016303
1387 Ga0105239_10143995
1388 Ga0105246_10001080
1389 Ga0105246_10723191
1390 Ga0105246_10859001
1391 Ga0157371_10574908
1392 Ga0157371_10651523
1393 Ga0157370_10021287
1394 Ga0157370_10604846
1395 Ga0157369_10262083
1396 Ga0157369_10972768
1397 Ga0157374_10086571
1398 Ga0157374_10230397
1399 Ga0157374_10869181
1400 Ga0157378_10053800
1401 Ga0157378_10876270
1402 Ga0163162_10011696
1403 Ga0163162_10093105
1404 Ga0157372_10027041
1405 Ga0157372_10054428
1406 Ga0157372_10322562
1407 Ga0157372_10352705
1408 Ga0157375_10457624
1409 Ga0157375_10554369
1410 Ga0157375_10945253
1411 Ga0163163_10018830
1412 Ga0163163_10276084
1413 Ga0157380_10073757
1414 Ga0157377_10051266
1415 Ga0157377_10301163
1416 Ga0157379_10043645
1417 Ga0157379_10239361
1418 Ga0157379_10375102
1419 Ga0157379_10469900
1420 Ga0157379_10550291
1421 Ga0157376_10255455
1422 Ga0157376_10363875
1423 Ga0157376_11676932
1424 Ga0182005_1057582
1425 Ga0163161_10015187
1426 Ga0163161_10135818
1427 Ga0197907_10193487
1428 Ga0206356_10016421
1429 Ga0206356_11724377
1430 Ga0206355_1190914
1431 Ga0206351_10217137
1432 Ga0206352_10888235
1433 Ga0206350_11009252
1434 Ga0206354_10507425
1435 Ga0206354_10872599
1436 Ga0206353_11031566
1437 Ga0206353_11153769
1438 Ga0213875_10000312
1439 Ga0213875_10094627
1440 Ga0213875_10260724
1441 Ga0224712_10016888
1442 Ga0224712_10378905
1443 Ga0228598_1009818
1444 Ga0207692_10008449
1445 Ga0207692_10014974
1446 Ga0207692_10053087
1447 Ga0207692_10096150
1448 Ga0207642_10035776
1449 Ga0207642_10115078
1450 Ga0207710_10079136
1451 Ga0207710_10377461
1452 Ga0207688_10006566
1453 Ga0207688_10115790
1454 Ga0207680_10026973
1455 Ga0207680_10342344
1456 Ga0207647_10196993
1457 Ga0207647_10304675
1458 Ga0207685_10015217
1459 Ga0207685_10024079
1460 Ga0207685_10046686
1461 Ga0207685_10164427
1462 Ga0207699_10060547
1463 Ga0207699_10071150
1464 Ga0207699_10126295
1465 Ga0207699_10205334
1466 Ga0207699_10207017
1467 Ga0207699_10571721
1468 Ga0207645_10169507
1469 Ga0207645_10455080
1470 Ga0207684_10005898
1471 Ga0207684_10011913
1472 Ga0207684_10012239
1473 Ga0207684_10016464
1474 Ga0207684_10020833
1475 Ga0207684_10101842
1476 Ga0207684_10111877
1477 Ga0207684_10195434
1478 Ga0207684_10312798
1479 Ga0207654_10049444
1480 Ga0207654_10064032
1481 Ga0207707_10203271
1482 Ga0207707_10343871
1483 Ga0207695_10169045
1484 Ga0207671_10020275
1485 Ga0207671_10297516
1486 Ga0207671_10405881
1487 Ga0207671_10433545
1488 Ga0207693_10002203
1489 Ga0207693_10010820
1490 Ga0207693_10037347
1491 Ga0207693_10064471
1492 Ga0207693_10084809
1493 Ga0207693_10194366
1494 Ga0207693_10195170
1495 Ga0207663_10002369
1496 Ga0207663_10013744
1497 Ga0207663_10031459
1498 Ga0207663_10233442
1499 Ga0207663_11096989
1500 Ga0207657_10009598
1501 Ga0207657_10071365
1502 Ga0207657_10289241
1503 Ga0207652_10071175
1504 Ga0207652_10650478
1505 Ga0207652_10656065
1506 Ga0207652_11145211
1507 Ga0207646_10000522
1508 Ga0207646_10000995
1509 Ga0207646_10031343
1510 Ga0207646_10124805
1511 Ga0207646_10301969
1512 Ga0207646_10493209
1513 Ga0207646_10538464
1514 Ga0207646_10894712
1515 Ga0207681_10224454
1516 Ga0207681_10376051
1517 Ga0207687_10004449
1518 Ga0207687_10008371
1519 Ga0207687_10165298
1520 Ga0207687_10342798
1521 Ga0207700_10002650
1522 Ga0207700_10004201
1523 Ga0207700_10026046
1524 Ga0207700_10182412
1525 Ga0207700_10230822
1526 Ga0207700_10348450
1527 Ga0207700_10573731
1528 Ga0207700_10694338
1529 Ga0207700_10792992
1530 Ga0207700_11092593
1531 Ga0207664_10001320
1532 Ga0207664_10011877
1533 Ga0207664_10141183
1534 Ga0207664_10191464
1535 Ga0207664_10420663
1536 Ga0207690_10014526
1537 Ga0207706_10151200
1538 Ga0207686_10115979
1539 Ga0207686_10221376
1540 Ga0207709_10075878
1541 Ga0207709_10202832
1542 Ga0207670_10119242
1543 Ga0207670_10491505
1544 Ga0207669_10066469
1545 Ga0207704_10222921
1546 Ga0207665_10000415
1547 Ga0207665_10001572
1548 Ga0207665_10003444
1549 Ga0207665_10018055
1550 Ga0207665_10020679
1551 Ga0207665_10123370
1552 Ga0207665_10378412
1553 Ga0207691_10569634
1554 Ga0207711_10907722
1555 Ga0207661_10417609
1556 Ga0207661_10943378
1557 Ga0207679_10267619
1558 Ga0207667_10010261
1559 Ga0207667_10576434
1560 Ga0207712_10060148
1561 Ga0207668_10092092
1562 Ga0207640_10064652
1563 Ga0207640_10085371
1564 Ga0207640_10536817
1565 Ga0207658_10220971
1566 Ga0207658_10489880
1567 Ga0207677_10027607
1568 Ga0207677_11259617
1569 Ga0207703_10824850
1570 Ga0207639_10124905
1571 Ga0207639_10400390
1572 Ga0207678_10007876
1573 Ga0207708_10112122
1574 Ga0207708_10449680
1575 Ga0207702_10021410
1576 Ga0207702_10027062
1577 Ga0207702_10044033
1578 Ga0207702_10173480
1579 Ga0207702_10336735
1580 Ga0207702_10618640
1581 Ga0207702_11104023
1582 Ga0207641_10036817
1583 Ga0207641_10261293
1584 Ga0207641_10632223
1585 Ga0207641_10731223
1586 Ga0207648_10053262
1587 Ga0207648_10561562
1588 Ga0207676_10784392
1589 Ga0207674_10108611
1590 Ga0207674_10263904
1591 Ga0207674_10387552
1592 Ga0207675_100018442
1593 Ga0207675_100099574
1594 Ga0207683_10004722
1595 Ga0207683_10045843
1596 Ga0207683_10057495
1597 Ga0207683_10229923
1598 Ga0207683_10940986
1599 Ga0207698_10544688
1600 Ga0209588_1073137
1601 Ga0207428_10344598
1602 Ga0268266_10089484
1603 Ga0268266_10318248
1604 Ga0268266_10862577
1605 Ga0268264_10098592
1606 Ga0268264_11528019
1607 Ga0265762_1041943
1608 Ga0265760_10240216
1609 Ga0316576_10063281
1610 Ga0307406_10050303
1611 Ga0307406_11123814
1612 Ga0307407_10018527
1613 Ga0307409_100058386
1614 Ga0307409_101089000
1615 Ga0307416_100057017
1616 Ga0307416_100303684
1617 Ga0307411_10040742
1618 Ga0373958_0001602
1619 Ga0373958_0010243
1620 Ga0373959_0011172
1621 Ga0373938_0005931
1622 Ga0373926_0003230
1623 Ga0373926_0012632
1624 Ga0373926_0029241
1625 Ga0373926_0068791
1626 Ga0373929_0043519
1627 Ga0373934_0050625
1628 Ga0373940_0004986
1629 Ga0373944_0033216
1630 Ga0373944_0253146
1631 Ga0373952_0029728
1632 Ga0373952_0090300
1633 Ga0373923_0002069
1634 Ga0373923_0017842
1635 Ga0373923_0030728
1636 Ga0373923_0031022
1637 Ga0373923_0173087
1638 Ga0373923_0295681
1639 Ga0373932_0121214
1640 Ga0373936_0000363
1641 Ga0373936_0003159
1642 Ga0373936_0008487
1643 Ga0373936_0043608
1644 Ga0373936_0105224
1645 Ga0373936_0197752
1646 Ga0373936_0297965
1647 Ga0373939_0023695
1648 Ga0373941_0016833
1649 Ga0373941_0194720
1650 Ga0373945_0002381
1651 Ga0373945_0005406
1652 Ga0373945_0012734
1653 Ga0373945_0048873
1654 Ga0373953_0006340
1655 Ga0373953_0022119
1656 Ga0373953_0023939
1657 Ga0373954_0007188
1658 Ga0373954_0039944
1659 Ga0373954_0042016
1660 Ga0373956_0039754
1661 Ga0373956_0087132
1662 Ga0373957_0013707
1663 Ga0373957_0035093
1664 Ga0373957_0041612
1665 Ga0373957_0058955
1666 Ga0373957_0127871
1667 Ga0373957_0155371
1668 Ga0373960_0021382
1669 Ga0373960_0187614
1670 Ga0373943_0000082
1671 Ga0373943_0000981
1672 Ga0373943_0173684
1673 Ga0373943_0198498
1674 Ga0373946_0001593
1675 Ga0373946_0006874
1676 Ga0373946_0055825
1677 Ga0373946_0086528
1678 Ga0373955_0034949
1679 Ga0373955_0039792
1680 Ga0373955_0102418
1681 Ga0373955_0266935
1682 Ga0373942_0019031
1683 Ga0373961_0049256
1684 Ga0316574_0008986
1685 Ga0373924_0004423
1686 Ga0373924_0035276
1687 Ga0373924_0048091
1688 Ga0373924_0071218
1689 Ga0373924_0074756
1690 Ga0373931_0001917
1691 Ga0373931_0045974
1692 Ga0373935_0000744
1693 Ga0373935_0007338
1694 Ga0373935_0014495
1695 Ga0373935_0113204
1696 Ga0373935_0142657
1697 Ga0373935_0564236
1698 Ga0373927_0000670
1699 Ga0373927_0006924
1700 Ga0373927_0017377
1701 Ga0373927_0837514
1702 Ga0373933_0004220
1703 Ga0373933_0038743
1704 Ga0373933_0194235
1705 Ga0373933_0326309
1706 Ga0373947_0000619
1707 Ga0373947_0001676
1708 Ga0373947_0029323
1709 Ga0373947_0097291
1710 Ga0373947_0135282
1711 Ga0373947_0200024
1712 Ga0373947_0245605
1713 Ga0373947_0364382
1714 Ga0373947_0373150
1715 Ga0373947_0700188
1716 Ga0373937_0012653
1717 Ga0373937_0084779
1718 Ga0373937_0226011
1719 Ga0373937_0232446
1720 Ga0373937_0379458
1721 Ga0373937_0420458
1722 Ga0373937_0463455
1723 Ga0316582_0575986
1724 Ga0373925_0000013
1725 Ga0373925_0002887
1726 Ga0373925_0005796
1727 Ga0373925_0023433
1728 Ga0373925_0069601
1729 Ga0373925_0171052
1730 Ga0373925_0357664
1731 Ga0373925_0964489
1732 Ga0395898_0007269
1733 Ga0395905_0018704
1734 Ga0436364_0590257
1735 Ga0436364_0794523
1736 Ga0436364_1101267
1737 Ga0395901_0024963
1738 Ga0436362_1213167
1739 Ga0451841_0503580
1740 Ga0439455_0136410
1741 Ga0466963_0025233
1742 Ga0466970_0157384
1743 Ga0466958_0169034
1744 Ga0466958_0188393
1745 Ga0466967_0213298
1746 Ga0466967_0227616
1747 Ga0466967_0920227
1748 Ga0495592_0010608
1749 Ga0495592_0015367
1750 Ga0495592_0016899
1751 Ga0495592_0075392
1752 Ga0495592_0400554
1753 Ga0495603_0032365
1754 Ga0495603_0129101
1755 Ga0495590_0045509
1756 Ga0495629_0008537
1757 Ga0495629_0010816
1758 Ga0495629_0023045
1759 Ga0495629_0081240
1760 Ga0495629_0274512
1761 Ga0495641_0002945
1762 Ga0495641_0006657
1763 Ga0495641_0010459
1764 Ga0495641_0041485
1765 Ga0495651_0004872
1766 Ga0495651_0044093
1767 Ga0495651_0086420
1768 Ga0495651_0117212
1769 Ga0495651_0130097
1770 Ga0495651_0632086
1771 Ga0495653_0002769
1772 Ga0495653_0003629
1773 Ga0495653_0016193
1774 Ga0495653_0025855
1775 Ga0495653_0057897
1776 Ga0495653_0059658
1777 Ga0495653_0060419
1778 Ga0495653_0260945
1779 Ga0495580_0013042
1780 Ga0495580_0014128
1781 Ga0495580_0098039
1782 Ga0495582_0005354
1783 Ga0495582_0049272
1784 Ga0495582_0121891
1785 Ga0495639_0005141
1786 Ga0495639_0005478
1787 Ga0495639_0170734
1788 Ga0495639_0240850
1789 Ga0495639_0245420
1790 Ga0495662_0000412
1791 Ga0495662_0002937
1792 Ga0495662_0009808
1793 Ga0495662_0018085
1794 Ga0495662_0022911
1795 Ga0495664_0001165
1796 Ga0495664_0001890
1797 Ga0495664_0003573
1798 Ga0495664_0060626
1799 Ga0495664_0068057
1800 Ga0495664_0087897
1801 Ga0495664_0166000
1802 Ga0495664_0293088
1803 Ga0495664_0352053
1804 Ga0495664_0520289
1805 Ga0495594_0007359
1806 Ga0495594_0058770
1807 Ga0495594_0079479
1808 Ga0495594_0466578
1809 Ga0495608_0002056
1810 Ga0495608_0005716
1811 Ga0495608_0007465
1812 Ga0495608_0023494
1813 Ga0495608_0032890
1814 Ga0495608_0078230
1815 Ga0495608_0089581
1816 Ga0495608_0146801
1817 Ga0495608_0513621
1818 Ga0495618_0002753
1819 Ga0495618_0034684
1820 Ga0495618_0071970
1821 Ga0495618_0078659
1822 Ga0495618_0215514
1823 Ga0495620_0002530
1824 Ga0495628_0006341
1825 Ga0495628_0023189
1826 Ga0495628_0273997
1827 Ga0495628_0364092
1828 Ga0495628_0398039
1829 Ga0495628_0416432
1830 Ga0495628_0419460
1831 Ga0495630_0041245
1832 Ga0495630_0131022
1833 Ga0495630_0247316
1834 Ga0495630_0278247
1835 Ga0495630_0792064
1836 Ga0495643_0004928
1837 Ga0495648_0001739
1838 Ga0495648_0061056
1839 Ga0495666_0047271
1840 Ga0495666_0257422
1841 Ga0495642_0091215
1842 Ga0495652_0010636
1843 Ga0495652_0029759
1844 Ga0495652_0068948
1845 Ga0495652_0142687
1846 Ga0495652_0243480
1847 Ga0495652_0306394
1848 Ga0495652_0636827
1849 Ga0495654_0027042
1850 Ga0495665_0000527
1851 Ga0495665_0001636
1852 Ga0495665_0005757
1853 Ga0495665_0027374
1854 Ga0495665_0195361
1855 Ga0495640_0017096
1856 Ga0495640_0022869
1857 Ga0495640_0029267
1858 Ga0495640_0045341
1859 Ga0495640_0059035
1860 Ga0495640_0177384
1861 Ga0495586_0003401
1862 Ga0495586_0004628
1863 Ga0495586_0036463
1864 Ga0495587_0017623
1865 Ga0495587_0055131
1866 Ga0495587_0067454
1867 Ga0495587_0091792
1868 Ga0495587_0163884
1869 Ga0495587_0365195
1870 Ga0495597_0004001
1871 Ga0495645_0008911
1872 Ga0495645_0013185
1873 Ga0495645_0120487
1874 Ga0495645_0170280
1875 Ga0495667_0001822
1876 Ga0495667_0007970
1877 Ga0495667_0008462
1878 Ga0495667_0015884
1879 Ga0495667_0017050
1880 Ga0495667_0028615
1881 Ga0495667_0062294
1882 Ga0495667_0064921
1883 Ga0495668_0016829
1884 Ga0495634_0004848
1885 Ga0495634_0011711
1886 Ga0495634_0014802
1887 Ga0495634_0024908
1888 Ga0495634_0026269
1889 Ga0495634_0027695
1890 Ga0495634_0121002
1891 Ga0495611_0118508
1892 Ga0495611_0247982
1893 Ga0495635_0002095
1894 Ga0495635_0013993
1895 Ga0495635_0029852
1896 Ga0495635_0032664
1897 Ga0495635_0163094
1898 Ga0495635_0180065
1899 Ga0495635_0271088
1900 Ga0495588_0002905
1901 Ga0495588_0032267
1902 Ga0495588_0152399
1903 Ga0495657_0005225
1904 Ga0495657_0018927
1905 Ga0495657_0020071
1906 Ga0495657_0027035
1907 Ga0495657_0035016
1908 Ga0495657_0040974
1909 Ga0495599_0006865
1910 Ga0495599_0009805
1911 Ga0495599_0013955
1912 Ga0495599_0027472
1913 Ga0495599_0030594
1914 Ga0495599_0049813
1915 Ga0495599_0316745
1916 Ga0495623_0031543
1917 Ga0495623_0106721
1918 Ga0495623_0282193
1919 Ga0495623_0327516
1920 Ga0495646_0004953
1921 Ga0495646_0025844
1922 Ga0495646_0030429
1923 Ga0495647_0081811
1924 Ga0495658_0003617
1925 Ga0495658_0015647
1926 Ga0495658_0069621
1927 Ga0495658_0194716
1928 Ga0495613_0004498
1929 Ga0495613_0075223
1930 Ga0495613_0093465
1931 Ga0495613_0182824
1932 Ga0495624_0008035
1933 Ga0495624_0009276
1934 Ga0495624_0011078
1935 Ga0495624_0019615
1936 Ga0495624_0145528
1937 Ga0495671_0032908
1938 Ga0495649_0037901
1939 Ga0495589_0021643
1940 Ga0495600_0004205
1941 Ga0495600_0006618
1942 Ga0495600_0031204
1943 Ga0495600_0037979
1944 Ga0495600_0053541
1945 Ga0495600_0066381
1946 Ga0495600_0138596
1947 Ga0495600_0264666
1948 Ga0495660_0023101
1949 Ga0495581_0003802
1950 Ga0495581_0005975
1951 Ga0495581_0008002
1952 Ga0495581_0010149
1953 Ga0495581_0010625
1954 Ga0495581_0247020
1955 Ga0495581_0643928
1956 Ga0495581_0696696
1957 Ga0495604_0028129
1958 Ga0495604_0033329
1959 Ga0495604_0044165
1960 Ga0495604_0107403
1961 Ga0495604_0141785
1962 Ga0495604_0305923
1963 Ga0495674_0001939
1964 Ga0495674_0005954
1965 Ga0495674_0039427
1966 Ga0495674_0047011
1967 Ga0495674_0083509
1968 Ga0495674_0240067
1969 Ga0495674_0305147
1970 Ga0495674_0398944
1971 Ga0495674_0412763
1972 Ga0495674_0580662
1973 Ga0495674_0977222
1974 Ga0495672_0001084
1975 Ga0495676_0014233
1976 Ga0495676_0029722
1977 Ga0495676_0032348
1978 Ga0495676_0104921
1979 Ga0495676_0432874
1980 Ga0495680_0004959
1981 Ga0495680_0040720
1982 Ga0495680_0045281
1983 Ga0495680_0052221
1984 Ga0495680_0087409
1985 Ga0495680_0129634
1986 Ga0495680_0305774
1987 Ga0495680_0486686
1988 Ga0495683_0073618
1989 Ga0495687_017124
1990 Ga0495675_0017646
1991 Ga0495675_0018849
1992 Ga0495675_0031676
1993 Ga0495675_0063827
1994 Ga0495675_0121648
1995 Ga0495675_0187677
1996 Ga0495675_0205479
1997 Ga0495677_0011039
1998 Ga0495677_0049407
1999 Ga0495673_0001554
2000 Ga0495684_0001710
2001 Ga0495684_0001792
2002 Ga0495684_0009255
2003 Ga0495684_0015690
2004 Ga0495684_0061160
2005 Ga0495684_0088808
2006 Ga0495684_0244909
2007 Ga0495593_0002686
2008 Ga0495593_0003268
2009 Ga0495593_0032155
2010 Ga0495593_0061312
2011 Ga0495602_0042823
2012 Ga0495602_0049682
2013 Ga0495602_0071308
2014 Ga0495602_0073794
2015 Ga0495602_0131359
2016 Ga0495602_0616566
2017 Ga0495614_0001922
2018 Ga0495614_0018578
2019 Ga0495614_0018654
2020 Ga0496100_0031222
2021 Ga0496100_0042032
2022 Ga0496100_0055391
2023 Ga0496100_0146155
2024 Ga0496100_0901097
2025 Ga0496100_1293289
2026 Ga0496101_0007400
2027 Ga0496101_0009428
2028 Ga0496101_0016606
2029 Ga0496101_0027452
2030 Ga0496101_0078509
2031 Ga0496102_0002361
2032 Ga0496102_0059619
2033 Ga0496102_0063830
2034 Ga0496102_0314893
2035 Ga0496102_0340472
2036 Ga0496103_0000900
2037 Ga0496103_0021988
2038 Ga0496103_0060001
2039 Ga0496103_0494979
2040 Ga0496103_0597210
2041 Ga0496104_0052222
2042 Ga0496104_0127458
2043 Ga0496104_0786087
2044 Ga0496105_0131535
2045 Ga0496105_0142488
2046 Ga0496105_0535885
2047 Ga0496106_0008276
2048 Ga0496106_0014311
2049 Ga0496106_0017839
2050 Ga0496106_0197799
2051 Ga0496106_0222264
2052 Ga0496107_0031543
2053 Ga0496107_0041358
2054 Ga0496107_0042154
2055 Ga0496107_0087504
2056 Ga0496107_0459552
2057 Ga0496108_0001177
2058 Ga0496108_0005259
2059 Ga0496108_0037682
2060 Ga0496109_0000999
2061 Ga0496109_0004046
2062 Ga0496109_0016077
2063 Ga0496109_0598665
2064 Ga0496110_0001024
2065 Ga0496110_0027396
2066 Ga0496110_0054339
2067 Ga0496110_0112353
2068 Ga0496110_0605308
2069 Ga0496111_0000822
2070 Ga0496111_0031219
2071 Ga0496111_0350133
2072 Ga0496112_0005524
2073 Ga0496112_0025280
2074 Ga0496112_0077765
2075 Ga0496112_0286452
2076 Ga0496112_0964220
2077 Ga0496112_1208963
2078 Ga0496113_0026268
2079 Ga0496113_0200431
2080 Ga0496113_1039547
2081 Ga0496114_0012826
2082 Ga0496114_0052454
2083 Ga0496114_0287010
2084 Ga0496114_0405272
2085 Ga0496115_0011617
2086 Ga0496115_0215929
2087 Ga0496115_0241103
2088 Ga0496115_0251814
2089 Ga0496115_0481314
2090 Ga0496115_0740418
2091 Ga0496126_0018870
2092 Ga0501032_0040837
2093 Ga0501034_1338215
2094 Ga0501038_0014496
2095 Ga0501038_0226986
2096 Ga0501040_0116215
2097 Ga0501042_0145193
2098 Ga0501047_0070677
2099 Ga0501048_0016245
2100 Ga0501076_0065560
2101 Ga0501077_0066460
2102 Ga0501079_0091892
2103 Ga0501079_0965205
2104 Ga0501080_0227225
2105 Ga0501081_0168560
2106 Ga0501035_0021515
2107 Ga0501044_0133704
2108 nmdc:mga07m45_38484_c1
2109 nmdc:mga05p37_1162329_c1
2110 nmdc:mga05p37_19328_c1
2111 nmdc:mga05p37_78124_c1
2112 nmdc:mga09592_198152_c1
2113 nmdc:mga09592_451649_c1
2114 nmdc:mga06r32_361007_c1
2115 nmdc:mga06r32_517088_c1
2116 nmdc:mga06r32_913693_c1
2117 nmdc:mga0n895_1090152_c1
2118 nmdc:mga0n895_64166_c1
2119 nmdc:mga0n895_76922_c1
2120 nmdc:mga0n895_80677_c1
2121 nmdc:mga0rr50_289793_c1
2122 nmdc:mga0rr50_376532_c1
2123 nmdc:mga0rr50_42045_c1
2124 nmdc:mga0rr50_650450_c1
2125 nmdc:mga0rr50_901_c1
2126 nmdc:mga0rr50_90468_c1
2127 nmdc:mga08x19_21480_c1
2128 nmdc:mga08x19_555077_c1
2129 nmdc:mga08x19_620743_c1
2130 nmdc:mga08x19_66942_c1
2131 nmdc:mga08x19_743781_c1
2132 nmdc:mga08x19_92046_c1
2133 nmdc:mga0a205_147319_c1
2134 Ga0495601_0023284
2135 Ga0495601_0031070
2136 Ga0495601_0046115
2137 Ga0495601_0050486
2138 Ga0495612_0003397
2139 Ga0495612_0012345
2140 Ga0495612_0016147
2141 Ga0495612_0189731
2142 Ga0495595_0003315
2143 Ga0495595_0006299
2144 Ga0495595_0035229
2145 Ga0495595_0052398
2146 Ga0495619_0014137
2147 Ga0495619_0022070
2148 Ga0495619_0188481
2149 Ga0495619_0575481
2150 Ga0495619_0661282
2151 Ga0501082_0114752
2152 2616698833
2153 2776372014
2154 2863072744

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

73

146

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9264 1 153
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9251 1 153
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9226 2 152
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9206 1 153
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9195 1 156
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9217 1 75 3.10.20.30
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9074 78 152 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9074 77 152 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9023 1 75 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8956 1 73 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A5B0AH17-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9488 1 154 GO:0016491
GO:0046872
GO:0051536
GO:0071949
AF-A0A3D0D3K8-F1-model_v4 (2Fe-2S)-binding protein 0.9454 1 153 GO:0016020
GO:0016491
GO:0046872
GO:0051537
AF-A0A3P4AWJ2-F1-model_v4 Nicotinate dehydrogenase subunit A (EC 1.17.2.1) 0.9454 1 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A3D0D829-F1-model_v4 (2Fe-2S)-binding protein 0.9444 1 150 GO:0016020
GO:0016491
GO:0046872
GO:0051537
AF-F0J567-F1-model_v4 Oxidoreductase iron-sulfur binding subunit 0.9437 1 153 GO:0016491
GO:0046872
GO:0051537

Map