F489600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1077 | 347 | 2154 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300025906|Ga0207699_10027900|Ga0207699_100279002 |
| Length | 199 |
| Sequence | MKITVTVNAADYTRVVEPRLLLIHFLRDDLRLTGSHWGCDTSNCGACVVWLNETPIKSCTVLAVMADGQRITTVEGLAAAHRLDPVQEAFAACHGLQCGFCTPGMMMTARWLLDSNPDPTEEEVREAISGQVCRCTGYENIVRSVLWAAKHEGGAAGAVPGLRPGEGAMGESLPHRGVSGGLCPPVARSAPVAKSARVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 119 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 125 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 192 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 194 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 195 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 231 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 232 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 346 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 347 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 1.39 |
| Isolates | 0.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.19 |
| Nodule | 0 |
| Rhizoplane | 6.59 |
| Rhizosphere | 92.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207699_10027900 | 3300025906 | Bacteria | 3131 |
| 2 | JGI24737J22298_10160246 | 3300001990 | Bacteria | 664 |
| 3 | JGI24735J21928_10093421 | 3300002067 | Bacteria | 863 |
| 4 | JGI25405J52794_10035640 | 3300003911 | Bacteria | 1042 |
| 5 | Ga0070683_100307317 | 3300005329 | Bacteria | 1509 |
| 6 | Ga0070683_100497232 | 3300005329 | Bacteria | 1165 |
| 7 | Ga0070683_100741731 | 3300005329 | Bacteria | 941 |
| 8 | Ga0070690_100065426 | 3300005330 | Bacteria | 2351 |
| 9 | Ga0070690_100870557 | 3300005330 | Bacteria | 703 |
| 10 | Ga0070670_100524492 | 3300005331 | Bacteria | 1055 |
| 11 | Ga0070670_100768070 | 3300005331 | Bacteria | 869 |
| 12 | Ga0068869_100906888 | 3300005334 | Bacteria | 763 |
| 13 | Ga0070666_10275128 | 3300005335 | Bacteria | 1196 |
| 14 | Ga0070682_100122746 | 3300005337 | Bacteria | 1746 |
| 15 | Ga0068868_100016481 | 3300005338 | Bacteria | 5489 |
| 16 | Ga0068868_100038154 | 3300005338 | Bacteria | 3728 |
| 17 | Ga0068868_100050853 | 3300005338 | Bacteria | 3256 |
| 18 | Ga0068868_100802099 | 3300005338 | Bacteria | 849 |
| 19 | Ga0070660_100027711 | 3300005339 | Bacteria | 4230 |
| 20 | Ga0070660_100039597 | 3300005339 | Bacteria | 3583 |
| 21 | Ga0070660_100061081 | 3300005339 | Bacteria | 2925 |
| 22 | Ga0070660_100278383 | 3300005339 | Bacteria | 1369 |
| 23 | Ga0070689_100550756 | 3300005340 | Bacteria | 994 |
| 24 | Ga0070691_10039982 | 3300005341 | Bacteria | 2216 |
| 25 | Ga0070691_10062670 | 3300005341 | Bacteria | 1791 |
| 26 | Ga0070691_10089050 | 3300005341 | Bacteria | 1520 |
| 27 | Ga0070691_10228752 | 3300005341 | Bacteria | 989 |
| 28 | Ga0070687_100357250 | 3300005343 | Bacteria | 945 |
| 29 | Ga0070661_101215401 | 3300005344 | Bacteria | 631 |
| 30 | Ga0070692_10026793 | 3300005345 | Bacteria | 2852 |
| 31 | Ga0070692_10212074 | 3300005345 | Bacteria | 1140 |
| 32 | Ga0070692_10500182 | 3300005345 | Bacteria | 787 |
| 33 | Ga0070668_100604672 | 3300005347 | Bacteria | 959 |
| 34 | Ga0070669_100303473 | 3300005353 | Bacteria | 1285 |
| 35 | Ga0070671_100489358 | 3300005355 | Bacteria | 1057 |
| 36 | Ga0070671_100949736 | 3300005355 | Bacteria | 752 |
| 37 | Ga0070671_101116593 | 3300005355 | Bacteria | 693 |
| 38 | Ga0070674_100051847 | 3300005356 | Bacteria | 2829 |
| 39 | Ga0070673_101692510 | 3300005364 | Bacteria | 598 |
| 40 | Ga0070688_100233666 | 3300005365 | Bacteria | 1302 |
| 41 | Ga0070688_100306472 | 3300005365 | Bacteria | 1149 |
| 42 | Ga0070659_100033283 | 3300005366 | Bacteria | 4002 |
| 43 | Ga0070659_100194188 | 3300005366 | Bacteria | 1669 |
| 44 | Ga0070667_101420759 | 3300005367 | Bacteria | 651 |
| 45 | Ga0070709_10002265 | 3300005434 | Bacteria | 10430 |
| 46 | Ga0070709_10019775 | 3300005434 | Bacteria | 3899 |
| 47 | Ga0070709_10167921 | 3300005434 | Bacteria | 1531 |
| 48 | Ga0070709_10179577 | 3300005434 | Bacteria | 1485 |
| 49 | Ga0070709_10686549 | 3300005434 | Bacteria | 795 |
| 50 | Ga0070714_100115390 | 3300005435 | Bacteria | 2383 |
| 51 | Ga0070714_100256802 | 3300005435 | Bacteria | 1617 |
| 52 | Ga0070714_100260198 | 3300005435 | Bacteria | 1607 |
| 53 | Ga0070714_100354509 | 3300005435 | Bacteria | 1378 |
| 54 | Ga0070714_100466077 | 3300005435 | Bacteria | 1202 |
| 55 | Ga0070714_100615307 | 3300005435 | Bacteria | 1044 |
| 56 | Ga0070714_100843212 | 3300005435 | Bacteria | 889 |
| 57 | Ga0070714_100978775 | 3300005435 | Bacteria | 823 |
| 58 | Ga0070713_100023504 | 3300005436 | Bacteria | 4784 |
| 59 | Ga0070713_100040276 | 3300005436 | Bacteria | 3798 |
| 60 | Ga0070713_100065915 | 3300005436 | Bacteria | 3044 |
| 61 | Ga0070713_100083999 | 3300005436 | Bacteria | 2723 |
| 62 | Ga0070713_100114161 | 3300005436 | Bacteria | 2359 |
| 63 | Ga0070713_100210599 | 3300005436 | Bacteria | 1760 |
| 64 | Ga0070713_100336574 | 3300005436 | Bacteria | 1397 |
| 65 | Ga0070713_100819919 | 3300005436 | Bacteria | 892 |
| 66 | Ga0070713_100964657 | 3300005436 | Bacteria | 822 |
| 67 | Ga0070710_10000062 | 3300005437 | Bacteria | 49803 |
| 68 | Ga0070710_10001471 | 3300005437 | Bacteria | 11090 |
| 69 | Ga0070710_10085055 | 3300005437 | Bacteria | 1854 |
| 70 | Ga0070710_10181653 | 3300005437 | Bacteria | 1317 |
| 71 | Ga0070710_10183221 | 3300005437 | Bacteria | 1312 |
| 72 | Ga0070710_10271182 | 3300005437 | Bacteria | 1097 |
| 73 | Ga0070710_10280668 | 3300005437 | Bacteria | 1081 |
| 74 | Ga0070710_10443148 | 3300005437 | Bacteria | 879 |
| 75 | Ga0070701_10386290 | 3300005438 | Bacteria | 883 |
| 76 | Ga0070701_10619525 | 3300005438 | Bacteria | 719 |
| 77 | Ga0070701_10753897 | 3300005438 | Bacteria | 660 |
| 78 | Ga0070711_100005424 | 3300005439 | Bacteria | 7623 |
| 79 | Ga0070711_100008495 | 3300005439 | Bacteria | 6291 |
| 80 | Ga0070711_100016448 | 3300005439 | Bacteria | 4699 |
| 81 | Ga0070711_100016904 | 3300005439 | Bacteria | 4638 |
| 82 | Ga0070711_100073573 | 3300005439 | Bacteria | 2415 |
| 83 | Ga0070711_100419923 | 3300005439 | Bacteria | 1090 |
| 84 | Ga0070700_100041681 | 3300005441 | Bacteria | 2815 |
| 85 | Ga0070700_100340297 | 3300005441 | Bacteria | 1109 |
| 86 | Ga0070694_100087949 | 3300005444 | Bacteria | 2174 |
| 87 | Ga0070694_100216858 | 3300005444 | Bacteria | 1434 |
| 88 | Ga0070708_100005426 | 3300005445 | Bacteria | 10110 |
| 89 | Ga0070708_100016992 | 3300005445 | Bacteria | 6055 |
| 90 | Ga0070708_100480890 | 3300005445 | Bacteria | 1172 |
| 91 | Ga0070663_100196445 | 3300005455 | Bacteria | 1572 |
| 92 | Ga0070663_100464970 | 3300005455 | Bacteria | 1045 |
| 93 | Ga0070678_100137178 | 3300005456 | Bacteria | 1952 |
| 94 | Ga0070678_100178806 | 3300005456 | Bacteria | 1735 |
| 95 | Ga0070678_100370996 | 3300005456 | Bacteria | 1236 |
| 96 | Ga0070662_100230604 | 3300005457 | Bacteria | 1481 |
| 97 | Ga0070681_10317335 | 3300005458 | Bacteria | 1468 |
| 98 | Ga0068867_100084429 | 3300005459 | Bacteria | 2399 |
| 99 | Ga0068867_100695110 | 3300005459 | Bacteria | 897 |
| 100 | Ga0070685_10114512 | 3300005466 | Bacteria | 1666 |
| 101 | Ga0070685_10659487 | 3300005466 | Bacteria | 759 |
| 102 | Ga0070706_100002279 | 3300005467 | Bacteria | 19411 |
| 103 | Ga0070706_100002738 | 3300005467 | Bacteria | 17618 |
| 104 | Ga0070706_100008799 | 3300005467 | Bacteria | 9408 |
| 105 | Ga0070706_100010481 | 3300005467 | Bacteria | 8604 |
| 106 | Ga0070706_100054380 | 3300005467 | Bacteria | 3695 |
| 107 | Ga0070706_100103563 | 3300005467 | Bacteria | 2646 |
| 108 | Ga0070706_100135523 | 3300005467 | Bacteria | 2298 |
| 109 | Ga0070706_100398727 | 3300005467 | Bacteria | 1281 |
| 110 | Ga0070706_100413919 | 3300005467 | Bacteria | 1255 |
| 111 | Ga0070706_100500708 | 3300005467 | Bacteria | 1130 |
| 112 | Ga0070706_100860426 | 3300005467 | Bacteria | 838 |
| 113 | Ga0070707_100000766 | 3300005468 | Bacteria | 31770 |
| 114 | Ga0070707_100005165 | 3300005468 | Bacteria | 12231 |
| 115 | Ga0070707_100006185 | 3300005468 | Bacteria | 11148 |
| 116 | Ga0070707_100011348 | 3300005468 | Bacteria | 8305 |
| 117 | Ga0070707_100020722 | 3300005468 | Bacteria | 6205 |
| 118 | Ga0070707_100085411 | 3300005468 | Bacteria | 3050 |
| 119 | Ga0070707_100335877 | 3300005468 | Bacteria | 1468 |
| 120 | Ga0070707_100377055 | 3300005468 | Bacteria | 1378 |
| 121 | Ga0070707_100396758 | 3300005468 | Bacteria | 1339 |
| 122 | Ga0070707_101018551 | 3300005468 | Bacteria | 793 |
| 123 | Ga0070698_100000052 | 3300005471 | Bacteria | 82128 |
| 124 | Ga0070698_100000240 | 3300005471 | Bacteria | 54607 |
| 125 | Ga0070698_100001129 | 3300005471 | Bacteria | 29516 |
| 126 | Ga0070698_100003354 | 3300005471 | Bacteria | 17626 |
| 127 | Ga0070698_100005243 | 3300005471 | Bacteria | 14179 |
| 128 | Ga0070698_100013120 | 3300005471 | Bacteria | 8768 |
| 129 | Ga0070698_100055330 | 3300005471 | Bacteria | 4025 |
| 130 | Ga0070698_100212488 | 3300005471 | Bacteria | 1869 |
| 131 | Ga0070699_100253103 | 3300005518 | Bacteria | 1574 |
| 132 | Ga0070699_101257490 | 3300005518 | Bacteria | 679 |
| 133 | Ga0070679_100012946 | 3300005530 | Bacteria | 7990 |
| 134 | Ga0070679_100114074 | 3300005530 | Bacteria | 2687 |
| 135 | Ga0070679_100663271 | 3300005530 | Bacteria | 986 |
| 136 | Ga0070684_100043947 | 3300005535 | Bacteria | 3861 |
| 137 | Ga0070684_100195894 | 3300005535 | Bacteria | 1840 |
| 138 | Ga0070684_100680421 | 3300005535 | Bacteria | 959 |
| 139 | Ga0070684_100799064 | 3300005535 | Bacteria | 882 |
| 140 | Ga0070684_101097988 | 3300005535 | Bacteria | 747 |
| 141 | Ga0070697_100007609 | 3300005536 | Bacteria | 8432 |
| 142 | Ga0068853_100004797 | 3300005539 | Bacteria | 10518 |
| 143 | Ga0068853_100594607 | 3300005539 | Bacteria | 1050 |
| 144 | Ga0070672_101059232 | 3300005543 | Bacteria | 720 |
| 145 | Ga0070686_100083169 | 3300005544 | Bacteria | 2124 |
| 146 | Ga0070686_100084243 | 3300005544 | Bacteria | 2112 |
| 147 | Ga0070695_100011751 | 3300005545 | Bacteria | 5242 |
| 148 | Ga0070696_100207430 | 3300005546 | Bacteria | 1465 |
| 149 | Ga0070696_100621978 | 3300005546 | Bacteria | 873 |
| 150 | Ga0070693_100229791 | 3300005547 | Bacteria | 1220 |
| 151 | Ga0070665_100024902 | 3300005548 | Bacteria | 6031 |
| 152 | Ga0070665_100129287 | 3300005548 | Bacteria | 2528 |
| 153 | Ga0070665_100159587 | 3300005548 | Bacteria | 2257 |
| 154 | Ga0070704_100009198 | 3300005549 | Bacteria | 5959 |
| 155 | Ga0068855_100062078 | 3300005563 | Bacteria | 4364 |
| 156 | Ga0068855_100064949 | 3300005563 | Bacteria | 4255 |
| 157 | Ga0068855_100986362 | 3300005563 | Bacteria | 886 |
| 158 | Ga0070664_100403696 | 3300005564 | Bacteria | 1250 |
| 159 | Ga0068857_100142928 | 3300005577 | Bacteria | 2164 |
| 160 | Ga0068857_100175450 | 3300005577 | Bacteria | 1950 |
| 161 | Ga0068857_100205191 | 3300005577 | Bacteria | 1798 |
| 162 | Ga0068854_100002781 | 3300005578 | Bacteria | 10867 |
| 163 | Ga0068854_100232659 | 3300005578 | Bacteria | 1463 |
| 164 | Ga0068854_100522646 | 3300005578 | Bacteria | 1003 |
| 165 | Ga0068856_100116981 | 3300005614 | Bacteria | 2666 |
| 166 | Ga0068856_100201091 | 3300005614 | Bacteria | 2007 |
| 167 | Ga0068856_100217338 | 3300005614 | Bacteria | 1926 |
| 168 | Ga0068856_100336074 | 3300005614 | Bacteria | 1529 |
| 169 | Ga0068856_100371172 | 3300005614 | Bacteria | 1450 |
| 170 | Ga0068856_100409676 | 3300005614 | Bacteria | 1375 |
| 171 | Ga0068856_100711659 | 3300005614 | Bacteria | 1024 |
| 172 | Ga0070702_100035399 | 3300005615 | Bacteria | 2758 |
| 173 | Ga0070702_100037322 | 3300005615 | Bacteria | 2698 |
| 174 | Ga0070702_100088248 | 3300005615 | Bacteria | 1875 |
| 175 | Ga0068852_100639401 | 3300005616 | Bacteria | 1071 |
| 176 | Ga0068859_100057132 | 3300005617 | Bacteria | 3931 |
| 177 | Ga0068859_100065371 | 3300005617 | Bacteria | 3671 |
| 178 | Ga0068859_100426432 | 3300005617 | Bacteria | 1423 |
| 179 | Ga0068859_100692745 | 3300005617 | Bacteria | 1110 |
| 180 | Ga0068864_100041744 | 3300005618 | Bacteria | 3923 |
| 181 | Ga0068864_100072061 | 3300005618 | Bacteria | 3010 |
| 182 | Ga0068864_100279276 | 3300005618 | Bacteria | 1558 |
| 183 | Ga0068864_100343175 | 3300005618 | Bacteria | 1408 |
| 184 | Ga0068866_10063641 | 3300005718 | Bacteria | 1923 |
| 185 | Ga0068866_10197049 | 3300005718 | Bacteria | 1201 |
| 186 | Ga0068851_10026810 | 3300005834 | Bacteria | 2835 |
| 187 | Ga0068863_100045859 | 3300005841 | Bacteria | 4148 |
| 188 | Ga0068863_100046775 | 3300005841 | Bacteria | 4107 |
| 189 | Ga0068863_100418425 | 3300005841 | Bacteria | 1312 |
| 190 | Ga0068863_100472858 | 3300005841 | Bacteria | 1232 |
| 191 | Ga0068863_100915285 | 3300005841 | Bacteria | 878 |
| 192 | Ga0068863_101903271 | 3300005841 | Bacteria | 605 |
| 193 | Ga0068858_100211923 | 3300005842 | Bacteria | 1833 |
| 194 | Ga0068858_100486811 | 3300005842 | Bacteria | 1191 |
| 195 | Ga0068860_100020629 | 3300005843 | Bacteria | 6384 |
| 196 | Ga0068860_100131329 | 3300005843 | Bacteria | 2403 |
| 197 | Ga0068860_100379837 | 3300005843 | Bacteria | 1395 |
| 198 | Ga0081455_10001937 | 3300005937 | Bacteria | 24871 |
| 199 | Ga0081455_10016218 | 3300005937 | Bacteria | 7200 |
| 200 | Ga0081538_10002084 | 3300005981 | Bacteria | 19923 |
| 201 | Ga0081538_10004035 | 3300005981 | Bacteria | 13659 |
| 202 | Ga0081540_1003740 | 3300005983 | Bacteria | 11922 |
| 203 | Ga0081540_1005630 | 3300005983 | Bacteria | 9330 |
| 204 | Ga0081540_1023540 | 3300005983 | Bacteria | 3598 |
| 205 | Ga0070717_10023809 | 3300006028 | Bacteria | 4857 |
| 206 | Ga0070717_10083818 | 3300006028 | Bacteria | 2681 |
| 207 | Ga0070717_10110358 | 3300006028 | Bacteria | 2346 |
| 208 | Ga0070717_10116251 | 3300006028 | Bacteria | 2287 |
| 209 | Ga0070717_10118858 | 3300006028 | Bacteria | 2262 |
| 210 | Ga0070717_10170150 | 3300006028 | Bacteria | 1894 |
| 211 | Ga0070717_10241112 | 3300006028 | Bacteria | 1594 |
| 212 | Ga0070717_10583525 | 3300006028 | Bacteria | 1013 |
| 213 | Ga0070717_10745248 | 3300006028 | Bacteria | 890 |
| 214 | Ga0075365_10466746 | 3300006038 | Bacteria | 892 |
| 215 | Ga0075432_10055200 | 3300006058 | Bacteria | 1407 |
| 216 | Ga0070715_10006440 | 3300006163 | Bacteria | 3994 |
| 217 | Ga0070715_10008224 | 3300006163 | Bacteria | 3627 |
| 218 | Ga0070715_10023449 | 3300006163 | Bacteria | 2418 |
| 219 | Ga0070715_10068850 | 3300006163 | Bacteria | 1575 |
| 220 | Ga0070715_10071947 | 3300006163 | Bacteria | 1547 |
| 221 | Ga0070715_10522790 | 3300006163 | Bacteria | 683 |
| 222 | Ga0070716_100043934 | 3300006173 | Bacteria | 2501 |
| 223 | Ga0070716_100065349 | 3300006173 | Bacteria | 2118 |
| 224 | Ga0070716_100104672 | 3300006173 | Bacteria | 1742 |
| 225 | Ga0070716_100288058 | 3300006173 | Bacteria | 1137 |
| 226 | Ga0070716_100297222 | 3300006173 | Bacteria | 1121 |
| 227 | Ga0070712_100012380 | 3300006175 | Bacteria | 5422 |
| 228 | Ga0070712_100168892 | 3300006175 | Bacteria | 1695 |
| 229 | Ga0070712_100199023 | 3300006175 | Bacteria | 1572 |
| 230 | Ga0070712_100271233 | 3300006175 | Bacteria | 1363 |
| 231 | Ga0070712_100464804 | 3300006175 | Bacteria | 1055 |
| 232 | Ga0070712_100475036 | 3300006175 | Bacteria | 1044 |
| 233 | Ga0070712_100717420 | 3300006175 | Bacteria | 854 |
| 234 | Ga0097621_100211628 | 3300006237 | Bacteria | 1687 |
| 235 | Ga0097621_100879294 | 3300006237 | Bacteria | 834 |
| 236 | Ga0068871_100015846 | 3300006358 | Bacteria | 5657 |
| 237 | Ga0068871_100350500 | 3300006358 | Bacteria | 1306 |
| 238 | Ga0075431_100007823 | 3300006847 | Bacteria | 10649 |
| 239 | Ga0075431_100971727 | 3300006847 | Bacteria | 817 |
| 240 | Ga0075433_10047959 | 3300006852 | Bacteria | 3715 |
| 241 | Ga0075433_10065399 | 3300006852 | Bacteria | 3190 |
| 242 | Ga0075433_10066227 | 3300006852 | Bacteria | 3169 |
| 243 | Ga0075433_10142550 | 3300006852 | Bacteria | 2130 |
| 244 | Ga0075434_100001286 | 3300006871 | Bacteria | 20926 |
| 245 | Ga0075434_100005698 | 3300006871 | Bacteria | 11373 |
| 246 | Ga0075434_100072103 | 3300006871 | Bacteria | 3446 |
| 247 | Ga0075434_100074251 | 3300006871 | Bacteria | 3394 |
| 248 | Ga0075434_100139705 | 3300006871 | Bacteria | 2442 |
| 249 | Ga0075434_100722957 | 3300006871 | Bacteria | 1013 |
| 250 | Ga0075434_101271474 | 3300006871 | Bacteria | 747 |
| 251 | Ga0068865_100346889 | 3300006881 | Bacteria | 1201 |
| 252 | Ga0068865_100426423 | 3300006881 | Bacteria | 1092 |
| 253 | Ga0075436_100076354 | 3300006914 | Bacteria | 2320 |
| 254 | Ga0075436_100089709 | 3300006914 | Bacteria | 2136 |
| 255 | Ga0075436_100123136 | 3300006914 | Bacteria | 1816 |
| 256 | Ga0075436_100185475 | 3300006914 | Bacteria | 1471 |
| 257 | Ga0075436_100674392 | 3300006914 | Bacteria | 765 |
| 258 | Ga0097620_100057135 | 3300006931 | Bacteria | 3931 |
| 259 | Ga0097620_100065372 | 3300006931 | Bacteria | 3671 |
| 260 | Ga0097620_100426414 | 3300006931 | Bacteria | 1423 |
| 261 | Ga0097620_100692773 | 3300006931 | Bacteria | 1110 |
| 262 | Ga0075435_100026742 | 3300007076 | Bacteria | 4506 |
| 263 | Ga0075435_100074841 | 3300007076 | Bacteria | 2771 |
| 264 | Ga0075435_100081661 | 3300007076 | Bacteria | 2655 |
| 265 | Ga0075435_100295481 | 3300007076 | Bacteria | 1385 |
| 266 | Ga0075435_100412351 | 3300007076 | Bacteria | 1163 |
| 267 | Ga0105240_10023204 | 3300009093 | Bacteria | 8214 |
| 268 | Ga0105240_10244863 | 3300009093 | Bacteria | 2077 |
| 269 | Ga0105240_10599435 | 3300009093 | Bacteria | 1213 |
| 270 | Ga0105240_10951325 | 3300009093 | Bacteria | 921 |
| 271 | Ga0111539_10215835 | 3300009094 | Bacteria | 2235 |
| 272 | Ga0111539_10302489 | 3300009094 | Bacteria | 1861 |
| 273 | Ga0105245_10002929 | 3300009098 | Bacteria | 15319 |
| 274 | Ga0105245_10017210 | 3300009098 | Bacteria | 6306 |
| 275 | Ga0105245_10105754 | 3300009098 | Bacteria | 2610 |
| 276 | Ga0105245_10202444 | 3300009098 | Bacteria | 1907 |
| 277 | Ga0105245_10503595 | 3300009098 | Bacteria | 1227 |
| 278 | Ga0105247_10071459 | 3300009101 | Bacteria | 2170 |
| 279 | Ga0105247_10207792 | 3300009101 | Bacteria | 1319 |
| 280 | Ga0105247_10287245 | 3300009101 | Bacteria | 1137 |
| 281 | Ga0105247_10363096 | 3300009101 | Bacteria | 1022 |
| 282 | Ga0114129_10001833 | 3300009147 | Bacteria | 28935 |
| 283 | Ga0114129_10026476 | 3300009147 | Bacteria | 8212 |
| 284 | Ga0114129_10040022 | 3300009147 | Bacteria | 6611 |
| 285 | Ga0114129_10091948 | 3300009147 | Bacteria | 4203 |
| 286 | Ga0114129_11154820 | 3300009147 | Bacteria | 967 |
| 287 | Ga0114129_11251461 | 3300009147 | Bacteria | 922 |
| 288 | Ga0114129_11379535 | 3300009147 | Bacteria | 870 |
| 289 | Ga0105243_10061350 | 3300009148 | Bacteria | 3007 |
| 290 | Ga0105243_10079189 | 3300009148 | Bacteria | 2678 |
| 291 | Ga0105243_11062704 | 3300009148 | Bacteria | 816 |
| 292 | Ga0105243_11256592 | 3300009148 | Bacteria | 756 |
| 293 | Ga0105243_11711984 | 3300009148 | Bacteria | 658 |
| 294 | Ga0105243_12497103 | 3300009148 | Bacteria | 556 |
| 295 | Ga0105242_10062167 | 3300009176 | Bacteria | 3073 |
| 296 | Ga0105242_10104966 | 3300009176 | Bacteria | 2399 |
| 297 | Ga0105242_10317229 | 3300009176 | Bacteria | 1428 |
| 298 | Ga0105242_10822083 | 3300009176 | Bacteria | 922 |
| 299 | Ga0105248_10211288 | 3300009177 | Bacteria | 2186 |
| 300 | Ga0105248_10463612 | 3300009177 | Bacteria | 1428 |
| 301 | Ga0105248_10983387 | 3300009177 | Bacteria | 953 |
| 302 | Ga0105248_11024837 | 3300009177 | Bacteria | 932 |
| 303 | Ga0105237_10181882 | 3300009545 | Bacteria | 2103 |
| 304 | Ga0105238_10064237 | 3300009551 | Bacteria | 3671 |
| 305 | Ga0105238_11485484 | 3300009551 | Bacteria | 706 |
| 306 | Ga0105249_10013128 | 3300009553 | Bacteria | 7310 |
| 307 | Ga0105249_10236514 | 3300009553 | Bacteria | 1804 |
| 308 | Ga0105249_10408552 | 3300009553 | Bacteria | 1389 |
| 309 | Ga0105239_10016303 | 3300010375 | Bacteria | 8215 |
| 310 | Ga0105239_10143995 | 3300010375 | Bacteria | 2657 |
| 311 | Ga0105246_10001080 | 3300011119 | Bacteria | 15765 |
| 312 | Ga0105246_10723191 | 3300011119 | Bacteria | 875 |
| 313 | Ga0105246_10859001 | 3300011119 | Bacteria | 810 |
| 314 | Ga0157371_10574908 | 3300013102 | Bacteria | 837 |
| 315 | Ga0157371_10651523 | 3300013102 | Bacteria | 786 |
| 316 | Ga0157370_10021287 | 3300013104 | Bacteria | 6464 |
| 317 | Ga0157370_10604846 | 3300013104 | Bacteria | 1004 |
| 318 | Ga0157369_10262083 | 3300013105 | Bacteria | 1803 |
| 319 | Ga0157369_10972768 | 3300013105 | Bacteria | 869 |
| 320 | Ga0157374_10086571 | 3300013296 | Bacteria | 2981 |
| 321 | Ga0157374_10230397 | 3300013296 | Bacteria | 1820 |
| 322 | Ga0157374_10869181 | 3300013296 | Bacteria | 919 |
| 323 | Ga0157378_10053800 | 3300013297 | Bacteria | 3584 |
| 324 | Ga0157378_10876270 | 3300013297 | Bacteria | 927 |
| 325 | Ga0163162_10011696 | 3300013306 | Bacteria | 8558 |
| 326 | Ga0163162_10093105 | 3300013306 | Bacteria | 3098 |
| 327 | Ga0157372_10027041 | 3300013307 | Bacteria | 6245 |
| 328 | Ga0157372_10054428 | 3300013307 | Bacteria | 4464 |
| 329 | Ga0157372_10322562 | 3300013307 | Bacteria | 1798 |
| 330 | Ga0157372_10352705 | 3300013307 | Bacteria | 1714 |
| 331 | Ga0157375_10457624 | 3300013308 | Bacteria | 1441 |
| 332 | Ga0157375_10554369 | 3300013308 | Bacteria | 1311 |
| 333 | Ga0157375_10945253 | 3300013308 | Bacteria | 1004 |
| 334 | Ga0163163_10018830 | 3300014325 | Bacteria | 6474 |
| 335 | Ga0163163_10276084 | 3300014325 | Bacteria | 1732 |
| 336 | Ga0157380_10073757 | 3300014326 | Bacteria | 2768 |
| 337 | Ga0157377_10051266 | 3300014745 | Bacteria | 2327 |
| 338 | Ga0157377_10301163 | 3300014745 | Bacteria | 1058 |
| 339 | Ga0157379_10043645 | 3300014968 | Bacteria | 4003 |
| 340 | Ga0157379_10239361 | 3300014968 | Bacteria | 1646 |
| 341 | Ga0157379_10375102 | 3300014968 | Bacteria | 1305 |
| 342 | Ga0157379_10469900 | 3300014968 | Bacteria | 1163 |
| 343 | Ga0157379_10550291 | 3300014968 | Bacteria | 1074 |
| 344 | Ga0157376_10255455 | 3300014969 | Bacteria | 1639 |
| 345 | Ga0157376_10363875 | 3300014969 | Bacteria | 1388 |
| 346 | Ga0157376_11676932 | 3300014969 | Bacteria | 671 |
| 347 | Ga0182005_1057582 | 3300015265 | Bacteria | 1060 |
| 348 | Ga0163161_10015187 | 3300017792 | Bacteria | 5366 |
| 349 | Ga0163161_10135818 | 3300017792 | Bacteria | 1859 |
| 350 | Ga0197907_10193487 | 3300020069 | Bacteria | 2855 |
| 351 | Ga0206356_10016421 | 3300020070 | Bacteria | 742 |
| 352 | Ga0206356_11724377 | 3300020070 | Bacteria | 2501 |
| 353 | Ga0206355_1190914 | 3300020076 | Bacteria | 1122 |
| 354 | Ga0206351_10217137 | 3300020077 | Bacteria | 2898 |
| 355 | Ga0206352_10888235 | 3300020078 | Bacteria | 1387 |
| 356 | Ga0206350_11009252 | 3300020080 | Bacteria | 3347 |
| 357 | Ga0206354_10507425 | 3300020081 | Bacteria | 2012 |
| 358 | Ga0206354_10872599 | 3300020081 | Bacteria | 3369 |
| 359 | Ga0206353_11031566 | 3300020082 | Bacteria | 3852 |
| 360 | Ga0206353_11153769 | 3300020082 | Bacteria | 1080 |
| 361 | Ga0213875_10000312 | 3300021388 | Bacteria | 46369 |
| 362 | Ga0213875_10094627 | 3300021388 | Bacteria | 1393 |
| 363 | Ga0213875_10260724 | 3300021388 | Bacteria | 818 |
| 364 | Ga0224712_10016888 | 3300022467 | Bacteria | 2409 |
| 365 | Ga0224712_10378905 | 3300022467 | Bacteria | 672 |
| 366 | Ga0228598_1009818 | 3300024227 | Bacteria | 1913 |
| 367 | Ga0207692_10008449 | 3300025898 | Bacteria | 4259 |
| 368 | Ga0207692_10014974 | 3300025898 | Bacteria | 3402 |
| 369 | Ga0207692_10053087 | 3300025898 | Bacteria | 2063 |
| 370 | Ga0207692_10096150 | 3300025898 | Bacteria | 1617 |
| 371 | Ga0207642_10035776 | 3300025899 | Bacteria | 2125 |
| 372 | Ga0207642_10115078 | 3300025899 | Bacteria | 1377 |
| 373 | Ga0207710_10079136 | 3300025900 | Bacteria | 1522 |
| 374 | Ga0207710_10377461 | 3300025900 | Bacteria | 725 |
| 375 | Ga0207688_10006566 | 3300025901 | Bacteria | 6327 |
| 376 | Ga0207688_10115790 | 3300025901 | Bacteria | 1560 |
| 377 | Ga0207680_10026973 | 3300025903 | Bacteria | 3191 |
| 378 | Ga0207680_10342344 | 3300025903 | Bacteria | 1049 |
| 379 | Ga0207647_10196993 | 3300025904 | Bacteria | 1166 |
| 380 | Ga0207647_10304675 | 3300025904 | Bacteria | 907 |
| 381 | Ga0207685_10015217 | 3300025905 | Bacteria | 2432 |
| 382 | Ga0207685_10024079 | 3300025905 | Bacteria | 2082 |
| 383 | Ga0207685_10046686 | 3300025905 | Bacteria | 1649 |
| 384 | Ga0207685_10164427 | 3300025905 | Bacteria | 1016 |
| 385 | Ga0207699_10060547 | 3300025906 | Bacteria | 2274 |
| 386 | Ga0207699_10071150 | 3300025906 | Bacteria | 2126 |
| 387 | Ga0207699_10126295 | 3300025906 | Bacteria | 1661 |
| 388 | Ga0207699_10205334 | 3300025906 | Bacteria | 1337 |
| 389 | Ga0207699_10207017 | 3300025906 | Bacteria | 1332 |
| 390 | Ga0207699_10571721 | 3300025906 | Bacteria | 821 |
| 391 | Ga0207645_10169507 | 3300025907 | Bacteria | 1430 |
| 392 | Ga0207645_10455080 | 3300025907 | Bacteria | 864 |
| 393 | Ga0207684_10005898 | 3300025910 | Bacteria | 11220 |
| 394 | Ga0207684_10011913 | 3300025910 | Bacteria | 7581 |
| 395 | Ga0207684_10012239 | 3300025910 | Bacteria | 7468 |
| 396 | Ga0207684_10016464 | 3300025910 | Bacteria | 6348 |
| 397 | Ga0207684_10020833 | 3300025910 | Bacteria | 5602 |
| 398 | Ga0207684_10101842 | 3300025910 | Bacteria | 2455 |
| 399 | Ga0207684_10111877 | 3300025910 | Bacteria | 2337 |
| 400 | Ga0207684_10195434 | 3300025910 | Bacteria | 1745 |
| 401 | Ga0207684_10312798 | 3300025910 | Bacteria | 1354 |
| 402 | Ga0207654_10049444 | 3300025911 | Bacteria | 2412 |
| 403 | Ga0207654_10064032 | 3300025911 | Bacteria | 2160 |
| 404 | Ga0207707_10203271 | 3300025912 | Bacteria | 1727 |
| 405 | Ga0207707_10343871 | 3300025912 | Bacteria | 1286 |
| 406 | Ga0207695_10169045 | 3300025913 | Bacteria | 2113 |
| 407 | Ga0207671_10020275 | 3300025914 | Bacteria | 5064 |
| 408 | Ga0207671_10297516 | 3300025914 | Bacteria | 1275 |
| 409 | Ga0207671_10405881 | 3300025914 | Bacteria | 1084 |
| 410 | Ga0207671_10433545 | 3300025914 | Bacteria | 1046 |
| 411 | Ga0207693_10002203 | 3300025915 | Bacteria | 16995 |
| 412 | Ga0207693_10010820 | 3300025915 | Bacteria | 7406 |
| 413 | Ga0207693_10037347 | 3300025915 | Bacteria | 3828 |
| 414 | Ga0207693_10064471 | 3300025915 | Bacteria | 2870 |
| 415 | Ga0207693_10084809 | 3300025915 | Bacteria | 2482 |
| 416 | Ga0207693_10194366 | 3300025915 | Bacteria | 1596 |
| 417 | Ga0207693_10195170 | 3300025915 | Bacteria | 1593 |
| 418 | Ga0207663_10002369 | 3300025916 | Bacteria | 9052 |
| 419 | Ga0207663_10013744 | 3300025916 | Bacteria | 4411 |
| 420 | Ga0207663_10031459 | 3300025916 | Bacteria | 3141 |
| 421 | Ga0207663_10233442 | 3300025916 | Bacteria | 1345 |
| 422 | Ga0207663_11096989 | 3300025916 | Bacteria | 640 |
| 423 | Ga0207657_10009598 | 3300025919 | Bacteria | 9711 |
| 424 | Ga0207657_10071365 | 3300025919 | Bacteria | 2941 |
| 425 | Ga0207657_10289241 | 3300025919 | Bacteria | 1300 |
| 426 | Ga0207652_10071175 | 3300025921 | Bacteria | 3021 |
| 427 | Ga0207652_10650478 | 3300025921 | Bacteria | 943 |
| 428 | Ga0207652_10656065 | 3300025921 | Bacteria | 938 |
| 429 | Ga0207652_11145211 | 3300025921 | Bacteria | 679 |
| 430 | Ga0207646_10000522 | 3300025922 | Bacteria | 51170 |
| 431 | Ga0207646_10000995 | 3300025922 | Bacteria | 36401 |
| 432 | Ga0207646_10031343 | 3300025922 | Bacteria | 4813 |
| 433 | Ga0207646_10124805 | 3300025922 | Bacteria | 2314 |
| 434 | Ga0207646_10301969 | 3300025922 | Bacteria | 1446 |
| 435 | Ga0207646_10493209 | 3300025922 | Bacteria | 1104 |
| 436 | Ga0207646_10538464 | 3300025922 | Bacteria | 1050 |
| 437 | Ga0207646_10894712 | 3300025922 | Bacteria | 788 |
| 438 | Ga0207681_10224454 | 3300025923 | Bacteria | 1455 |
| 439 | Ga0207681_10376051 | 3300025923 | Bacteria | 1143 |
| 440 | Ga0207687_10004449 | 3300025927 | Bacteria | 9346 |
| 441 | Ga0207687_10008371 | 3300025927 | Bacteria | 6767 |
| 442 | Ga0207687_10165298 | 3300025927 | Bacteria | 1702 |
| 443 | Ga0207687_10342798 | 3300025927 | Bacteria | 1215 |
| 444 | Ga0207700_10002650 | 3300025928 | Bacteria | 10305 |
| 445 | Ga0207700_10004201 | 3300025928 | Bacteria | 8456 |
| 446 | Ga0207700_10026046 | 3300025928 | Bacteria | 4072 |
| 447 | Ga0207700_10182412 | 3300025928 | Bacteria | 1759 |
| 448 | Ga0207700_10230822 | 3300025928 | Bacteria | 1573 |
| 449 | Ga0207700_10348450 | 3300025928 | Bacteria | 1289 |
| 450 | Ga0207700_10573731 | 3300025928 | Bacteria | 1003 |
| 451 | Ga0207700_10694338 | 3300025928 | Bacteria | 908 |
| 452 | Ga0207700_10792992 | 3300025928 | Bacteria | 847 |
| 453 | Ga0207700_11092593 | 3300025928 | Bacteria | 713 |
| 454 | Ga0207664_10001320 | 3300025929 | Bacteria | 16328 |
| 455 | Ga0207664_10011877 | 3300025929 | Bacteria | 6213 |
| 456 | Ga0207664_10141183 | 3300025929 | Bacteria | 2038 |
| 457 | Ga0207664_10191464 | 3300025929 | Bacteria | 1761 |
| 458 | Ga0207664_10420663 | 3300025929 | Bacteria | 1190 |
| 459 | Ga0207690_10014526 | 3300025932 | Bacteria | 4756 |
| 460 | Ga0207706_10151200 | 3300025933 | Bacteria | 2042 |
| 461 | Ga0207686_10115979 | 3300025934 | Bacteria | 1814 |
| 462 | Ga0207686_10221376 | 3300025934 | Bacteria | 1367 |
| 463 | Ga0207709_10075878 | 3300025935 | Bacteria | 2150 |
| 464 | Ga0207709_10202832 | 3300025935 | Bacteria | 1418 |
| 465 | Ga0207670_10119242 | 3300025936 | Bacteria | 1915 |
| 466 | Ga0207670_10491505 | 3300025936 | Bacteria | 995 |
| 467 | Ga0207669_10066469 | 3300025937 | Bacteria | 2242 |
| 468 | Ga0207704_10222921 | 3300025938 | Bacteria | 1396 |
| 469 | Ga0207665_10000415 | 3300025939 | Bacteria | 29390 |
| 470 | Ga0207665_10001572 | 3300025939 | Bacteria | 15407 |
| 471 | Ga0207665_10003444 | 3300025939 | Bacteria | 10582 |
| 472 | Ga0207665_10018055 | 3300025939 | Bacteria | 4635 |
| 473 | Ga0207665_10020679 | 3300025939 | Bacteria | 4327 |
| 474 | Ga0207665_10123370 | 3300025939 | Bacteria | 1832 |
| 475 | Ga0207665_10378412 | 3300025939 | Bacteria | 1074 |
| 476 | Ga0207691_10569634 | 3300025940 | Bacteria | 960 |
| 477 | Ga0207711_10907722 | 3300025941 | Bacteria | 819 |
| 478 | Ga0207661_10417609 | 3300025944 | Bacteria | 1218 |
| 479 | Ga0207661_10943378 | 3300025944 | Bacteria | 795 |
| 480 | Ga0207679_10267619 | 3300025945 | Bacteria | 1460 |
| 481 | Ga0207667_10010261 | 3300025949 | Bacteria | 10963 |
| 482 | Ga0207667_10576434 | 3300025949 | Bacteria | 1136 |
| 483 | Ga0207712_10060148 | 3300025961 | Bacteria | 2692 |
| 484 | Ga0207668_10092092 | 3300025972 | Bacteria | 2230 |
| 485 | Ga0207640_10064652 | 3300025981 | Bacteria | 2437 |
| 486 | Ga0207640_10085371 | 3300025981 | Bacteria | 2170 |
| 487 | Ga0207640_10536817 | 3300025981 | Bacteria | 980 |
| 488 | Ga0207658_10220971 | 3300025986 | Bacteria | 1594 |
| 489 | Ga0207658_10489880 | 3300025986 | Bacteria | 1094 |
| 490 | Ga0207677_10027607 | 3300026023 | Bacteria | 3579 |
| 491 | Ga0207677_11259617 | 3300026023 | Bacteria | 678 |
| 492 | Ga0207703_10824850 | 3300026035 | Bacteria | 886 |
| 493 | Ga0207639_10124905 | 3300026041 | Bacteria | 2120 |
| 494 | Ga0207639_10400390 | 3300026041 | Bacteria | 1236 |
| 495 | Ga0207678_10007876 | 3300026067 | Bacteria | 9398 |
| 496 | Ga0207708_10112122 | 3300026075 | Bacteria | 2118 |
| 497 | Ga0207708_10449680 | 3300026075 | Bacteria | 1073 |
| 498 | Ga0207702_10021410 | 3300026078 | Bacteria | 5353 |
| 499 | Ga0207702_10027062 | 3300026078 | Bacteria | 4761 |
| 500 | Ga0207702_10044033 | 3300026078 | Bacteria | 3750 |
| 501 | Ga0207702_10173480 | 3300026078 | Bacteria | 1979 |
| 502 | Ga0207702_10336735 | 3300026078 | Bacteria | 1441 |
| 503 | Ga0207702_10618640 | 3300026078 | Bacteria | 1063 |
| 504 | Ga0207702_11104023 | 3300026078 | Bacteria | 787 |
| 505 | Ga0207641_10036817 | 3300026088 | Bacteria | 4084 |
| 506 | Ga0207641_10261293 | 3300026088 | Bacteria | 1621 |
| 507 | Ga0207641_10632223 | 3300026088 | Bacteria | 1050 |
| 508 | Ga0207641_10731223 | 3300026088 | Bacteria | 976 |
| 509 | Ga0207648_10053262 | 3300026089 | Bacteria | 3537 |
| 510 | Ga0207648_10561562 | 3300026089 | Bacteria | 1049 |
| 511 | Ga0207676_10784392 | 3300026095 | Bacteria | 929 |
| 512 | Ga0207674_10108611 | 3300026116 | Bacteria | 2751 |
| 513 | Ga0207674_10263904 | 3300026116 | Bacteria | 1669 |
| 514 | Ga0207674_10387552 | 3300026116 | Bacteria | 1351 |
| 515 | Ga0207675_100018442 | 3300026118 | Bacteria | 6507 |
| 516 | Ga0207675_100099574 | 3300026118 | Bacteria | 2738 |
| 517 | Ga0207683_10004722 | 3300026121 | Bacteria | 11738 |
| 518 | Ga0207683_10045843 | 3300026121 | Bacteria | 3823 |
| 519 | Ga0207683_10057495 | 3300026121 | Bacteria | 3414 |
| 520 | Ga0207683_10229923 | 3300026121 | Bacteria | 1691 |
| 521 | Ga0207683_10940986 | 3300026121 | Bacteria | 802 |
| 522 | Ga0207698_10544688 | 3300026142 | Bacteria | 1136 |
| 523 | Ga0209588_1073137 | 3300027671 | Bacteria | 1107 |
| 524 | Ga0207428_10344598 | 3300027907 | Bacteria | 1097 |
| 525 | Ga0268266_10089484 | 3300028379 | Bacteria | 2696 |
| 526 | Ga0268266_10318248 | 3300028379 | Bacteria | 1456 |
| 527 | Ga0268266_10862577 | 3300028379 | Bacteria | 875 |
| 528 | Ga0268264_10098592 | 3300028381 | Bacteria | 2535 |
| 529 | Ga0268264_11528019 | 3300028381 | Bacteria | 678 |
| 530 | Ga0265762_1041943 | 3300030760 | Bacteria | 898 |
| 531 | Ga0265760_10240216 | 3300031090 | Bacteria | 624 |
| 532 | Ga0316576_10063281 | 3300031727 | Bacteria | 2715 |
| 533 | Ga0307406_10050303 | 3300031901 | Bacteria | 2641 |
| 534 | Ga0307406_11123814 | 3300031901 | Bacteria | 679 |
| 535 | Ga0307407_10018527 | 3300031903 | Bacteria | 3523 |
| 536 | Ga0307409_100058386 | 3300031995 | Bacteria | 2996 |
| 537 | Ga0307409_101089000 | 3300031995 | Bacteria | 820 |
| 538 | Ga0307416_100057017 | 3300032002 | Bacteria | 3157 |
| 539 | Ga0307416_100303684 | 3300032002 | Bacteria | 1588 |
| 540 | Ga0307411_10040742 | 3300032005 | Bacteria | 2949 |
| 541 | Ga0373958_0001602 | 3300034819 | Bacteria | 3069 |
| 542 | Ga0373958_0010243 | 3300034819 | Bacteria | 1560 |
| 543 | Ga0373959_0011172 | 3300034820 | Bacteria | 1581 |
| 544 | Ga0373938_0005931 | 3300034957 | Bacteria | 2093 |
| 545 | Ga0373926_0003230 | 3300035083 | Bacteria | 5235 |
| 546 | Ga0373926_0012632 | 3300035083 | Bacteria | 2856 |
| 547 | Ga0373926_0029241 | 3300035083 | Bacteria | 1936 |
| 548 | Ga0373926_0068791 | 3300035083 | Bacteria | 1298 |
| 549 | Ga0373929_0043519 | 3300035085 | Bacteria | 1005 |
| 550 | Ga0373934_0050625 | 3300035086 | Bacteria | 1645 |
| 551 | Ga0373940_0004986 | 3300035088 | Bacteria | 2846 |
| 552 | Ga0373944_0033216 | 3300035089 | Bacteria | 1562 |
| 553 | Ga0373944_0253146 | 3300035089 | Bacteria | 651 |
| 554 | Ga0373952_0029728 | 3300035092 | Bacteria | 1206 |
| 555 | Ga0373952_0090300 | 3300035092 | Bacteria | 795 |
| 556 | Ga0373923_0002069 | 3300035111 | Bacteria | 6064 |
| 557 | Ga0373923_0017842 | 3300035111 | Bacteria | 2720 |
| 558 | Ga0373923_0030728 | 3300035111 | Bacteria | 2162 |
| 559 | Ga0373923_0031022 | 3300035111 | Bacteria | 2152 |
| 560 | Ga0373923_0173087 | 3300035111 | Bacteria | 989 |
| 561 | Ga0373923_0295681 | 3300035111 | Bacteria | 765 |
| 562 | Ga0373932_0121214 | 3300035112 | Bacteria | 872 |
| 563 | Ga0373936_0000363 | 3300035113 | Bacteria | 15394 |
| 564 | Ga0373936_0003159 | 3300035113 | Bacteria | 6166 |
| 565 | Ga0373936_0008487 | 3300035113 | Bacteria | 3869 |
| 566 | Ga0373936_0043608 | 3300035113 | Bacteria | 1803 |
| 567 | Ga0373936_0105224 | 3300035113 | Bacteria | 1194 |
| 568 | Ga0373936_0197752 | 3300035113 | Bacteria | 886 |
| 569 | Ga0373936_0297965 | 3300035113 | Bacteria | 727 |
| 570 | Ga0373939_0023695 | 3300035114 | Bacteria | 1703 |
| 571 | Ga0373941_0016833 | 3300035115 | Bacteria | 1994 |
| 572 | Ga0373941_0194720 | 3300035115 | Bacteria | 768 |
| 573 | Ga0373945_0002381 | 3300035116 | Bacteria | 5897 |
| 574 | Ga0373945_0005406 | 3300035116 | Bacteria | 4087 |
| 575 | Ga0373945_0012734 | 3300035116 | Bacteria | 2798 |
| 576 | Ga0373945_0048873 | 3300035116 | Bacteria | 1551 |
| 577 | Ga0373953_0006340 | 3300035117 | Bacteria | 3895 |
| 578 | Ga0373953_0022119 | 3300035117 | Bacteria | 2394 |
| 579 | Ga0373953_0023939 | 3300035117 | Bacteria | 2316 |
| 580 | Ga0373954_0007188 | 3300035118 | Bacteria | 4861 |
| 581 | Ga0373954_0039944 | 3300035118 | Bacteria | 2185 |
| 582 | Ga0373954_0042016 | 3300035118 | Bacteria | 2132 |
| 583 | Ga0373956_0039754 | 3300035119 | Bacteria | 2085 |
| 584 | Ga0373956_0087132 | 3300035119 | Bacteria | 1437 |
| 585 | Ga0373957_0013707 | 3300035120 | Bacteria | 2756 |
| 586 | Ga0373957_0035093 | 3300035120 | Bacteria | 1861 |
| 587 | Ga0373957_0041612 | 3300035120 | Bacteria | 1731 |
| 588 | Ga0373957_0058955 | 3300035120 | Bacteria | 1484 |
| 589 | Ga0373957_0127871 | 3300035120 | Bacteria | 1032 |
| 590 | Ga0373957_0155371 | 3300035120 | Bacteria | 940 |
| 591 | Ga0373960_0021382 | 3300035121 | Bacteria | 1720 |
| 592 | Ga0373960_0187614 | 3300035121 | Bacteria | 725 |
| 593 | Ga0373943_0000082 | 3300035170 | Bacteria | 33848 |
| 594 | Ga0373943_0000981 | 3300035170 | Bacteria | 12658 |
| 595 | Ga0373943_0173684 | 3300035170 | Bacteria | 1180 |
| 596 | Ga0373943_0198498 | 3300035170 | Bacteria | 1109 |
| 597 | Ga0373946_0001593 | 3300035171 | Bacteria | 7902 |
| 598 | Ga0373946_0006874 | 3300035171 | Bacteria | 4141 |
| 599 | Ga0373946_0055825 | 3300035171 | Bacteria | 1666 |
| 600 | Ga0373946_0086528 | 3300035171 | Bacteria | 1381 |
| 601 | Ga0373955_0034949 | 3300035172 | Bacteria | 2658 |
| 602 | Ga0373955_0039792 | 3300035172 | Bacteria | 2511 |
| 603 | Ga0373955_0102418 | 3300035172 | Bacteria | 1645 |
| 604 | Ga0373955_0266935 | 3300035172 | Bacteria | 1028 |
| 605 | Ga0373942_0019031 | 3300035207 | Bacteria | 1710 |
| 606 | Ga0373961_0049256 | 3300035241 | Bacteria | 1244 |
| 607 | Ga0316574_0008986 | 3300035398 | Bacteria | 5580 |
| 608 | Ga0373924_0004423 | 3300035410 | Bacteria | 4906 |
| 609 | Ga0373924_0035276 | 3300035410 | Bacteria | 2028 |
| 610 | Ga0373924_0048091 | 3300035410 | Bacteria | 1761 |
| 611 | Ga0373924_0071218 | 3300035410 | Bacteria | 1467 |
| 612 | Ga0373924_0074756 | 3300035410 | Bacteria | 1433 |
| 613 | Ga0373931_0001917 | 3300035691 | Bacteria | 9112 |
| 614 | Ga0373931_0045974 | 3300035691 | Bacteria | 2306 |
| 615 | Ga0373935_0000744 | 3300035692 | Bacteria | 17280 |
| 616 | Ga0373935_0007338 | 3300035692 | Bacteria | 6593 |
| 617 | Ga0373935_0014495 | 3300035692 | Bacteria | 4757 |
| 618 | Ga0373935_0113204 | 3300035692 | Bacteria | 1803 |
| 619 | Ga0373935_0142657 | 3300035692 | Bacteria | 1619 |
| 620 | Ga0373935_0564236 | 3300035692 | Bacteria | 831 |
| 621 | Ga0373927_0000670 | 3300035695 | Bacteria | 26064 |
| 622 | Ga0373927_0006924 | 3300035695 | Bacteria | 7699 |
| 623 | Ga0373927_0017377 | 3300035695 | Bacteria | 4734 |
| 624 | Ga0373927_0837514 | 3300035695 | Bacteria | 607 |
| 625 | Ga0373933_0004220 | 3300035724 | Bacteria | 7923 |
| 626 | Ga0373933_0038743 | 3300035724 | Bacteria | 2801 |
| 627 | Ga0373933_0194235 | 3300035724 | Bacteria | 1297 |
| 628 | Ga0373933_0326309 | 3300035724 | Bacteria | 995 |
| 629 | Ga0373947_0000619 | 3300035725 | Bacteria | 20965 |
| 630 | Ga0373947_0001676 | 3300035725 | Bacteria | 13560 |
| 631 | Ga0373947_0029323 | 3300035725 | Bacteria | 3228 |
| 632 | Ga0373947_0097291 | 3300035725 | Bacteria | 1844 |
| 633 | Ga0373947_0135282 | 3300035725 | Bacteria | 1576 |
| 634 | Ga0373947_0200024 | 3300035725 | Bacteria | 1307 |
| 635 | Ga0373947_0245605 | 3300035725 | Bacteria | 1182 |
| 636 | Ga0373947_0364382 | 3300035725 | Bacteria | 971 |
| 637 | Ga0373947_0373150 | 3300035725 | Bacteria | 959 |
| 638 | Ga0373947_0700188 | 3300035725 | Bacteria | 691 |
| 639 | Ga0373937_0012653 | 3300036401 | Bacteria | 7425 |
| 640 | Ga0373937_0084779 | 3300036401 | Bacteria | 2931 |
| 641 | Ga0373937_0226011 | 3300036401 | Bacteria | 1762 |
| 642 | Ga0373937_0232446 | 3300036401 | Bacteria | 1736 |
| 643 | Ga0373937_0379458 | 3300036401 | Bacteria | 1340 |
| 644 | Ga0373937_0420458 | 3300036401 | Bacteria | 1268 |
| 645 | Ga0373937_0463455 | 3300036401 | Bacteria | 1203 |
| 646 | Ga0316582_0575986 | 3300036647 | Bacteria | 775 |
| 647 | Ga0373925_0000013 | 3300037068 | Bacteria | 188673 |
| 648 | Ga0373925_0002887 | 3300037068 | Bacteria | 13580 |
| 649 | Ga0373925_0005796 | 3300037068 | Bacteria | 9178 |
| 650 | Ga0373925_0023433 | 3300037068 | Bacteria | 4503 |
| 651 | Ga0373925_0069601 | 3300037068 | Bacteria | 2658 |
| 652 | Ga0373925_0171052 | 3300037068 | Bacteria | 1715 |
| 653 | Ga0373925_0357664 | 3300037068 | Bacteria | 1186 |
| 654 | Ga0373925_0964489 | 3300037068 | Bacteria | 702 |
| 655 | Ga0395898_0007269 | 3300037466 | Bacteria | 11756 |
| 656 | Ga0395905_0018704 | 3300037471 | Bacteria | 6571 |
| 657 | Ga0436364_0590257 | 3300037853 | Bacteria | 2551 |
| 658 | Ga0436364_0794523 | 3300037853 | Bacteria | 752 |
| 659 | Ga0436364_1101267 | 3300037853 | Bacteria | 67281 |
| 660 | Ga0395901_0024963 | 3300038443 | Bacteria | 6134 |
| 661 | Ga0436362_1213167 | 3300039453 | Bacteria | 757 |
| 662 | Ga0451841_0503580 | 3300041498 | Bacteria | 921 |
| 663 | Ga0439455_0136410 | 3300042012 | Bacteria | 694 |
| 664 | Ga0466963_0025233 | 3300044694 | Bacteria | 3789 |
| 665 | Ga0466970_0157384 | 3300044765 | Bacteria | 1256 |
| 666 | Ga0466958_0169034 | 3300045836 | Bacteria | 1384 |
| 667 | Ga0466958_0188393 | 3300045836 | Bacteria | 1311 |
| 668 | Ga0466967_0213298 | 3300045976 | Bacteria | 1832 |
| 669 | Ga0466967_0227616 | 3300045976 | Bacteria | 1774 |
| 670 | Ga0466967_0920227 | 3300045976 | Bacteria | 870 |
| 671 | Ga0495592_0010608 | 3300046454 | Bacteria | 6949 |
| 672 | Ga0495592_0015367 | 3300046454 | Bacteria | 5808 |
| 673 | Ga0495592_0016899 | 3300046454 | Bacteria | 5540 |
| 674 | Ga0495592_0075392 | 3300046454 | Bacteria | 2449 |
| 675 | Ga0495592_0400554 | 3300046454 | Bacteria | 869 |
| 676 | Ga0495603_0032365 | 3300046455 | Bacteria | 3146 |
| 677 | Ga0495603_0129101 | 3300046455 | Bacteria | 1472 |
| 678 | Ga0495590_0045509 | 3300046457 | Bacteria | 1531 |
| 679 | Ga0495629_0008537 | 3300046459 | Bacteria | 7541 |
| 680 | Ga0495629_0010816 | 3300046459 | Bacteria | 6638 |
| 681 | Ga0495629_0023045 | 3300046459 | Bacteria | 4437 |
| 682 | Ga0495629_0081240 | 3300046459 | Bacteria | 2262 |
| 683 | Ga0495629_0274512 | 3300046459 | Bacteria | 1157 |
| 684 | Ga0495641_0002945 | 3300046461 | Bacteria | 13114 |
| 685 | Ga0495641_0006657 | 3300046461 | Bacteria | 7426 |
| 686 | Ga0495641_0010459 | 3300046461 | Bacteria | 5373 |
| 687 | Ga0495641_0041485 | 3300046461 | Bacteria | 2138 |
| 688 | Ga0495651_0004872 | 3300046462 | Bacteria | 10267 |
| 689 | Ga0495651_0044093 | 3300046462 | Bacteria | 3457 |
| 690 | Ga0495651_0086420 | 3300046462 | Bacteria | 2359 |
| 691 | Ga0495651_0117212 | 3300046462 | Bacteria | 1960 |
| 692 | Ga0495651_0130097 | 3300046462 | Bacteria | 1838 |
| 693 | Ga0495651_0632086 | 3300046462 | Bacteria | 672 |
| 694 | Ga0495653_0002769 | 3300046463 | Bacteria | 13983 |
| 695 | Ga0495653_0003629 | 3300046463 | Bacteria | 12445 |
| 696 | Ga0495653_0016193 | 3300046463 | Bacteria | 6073 |
| 697 | Ga0495653_0025855 | 3300046463 | Bacteria | 4710 |
| 698 | Ga0495653_0057897 | 3300046463 | Bacteria | 2947 |
| 699 | Ga0495653_0059658 | 3300046463 | Bacteria | 2894 |
| 700 | Ga0495653_0060419 | 3300046463 | Bacteria | 2871 |
| 701 | Ga0495653_0260945 | 3300046463 | Bacteria | 1145 |
| 702 | Ga0495580_0013042 | 3300046472 | Bacteria | 6362 |
| 703 | Ga0495580_0014128 | 3300046472 | Bacteria | 6070 |
| 704 | Ga0495580_0098039 | 3300046472 | Bacteria | 2039 |
| 705 | Ga0495582_0005354 | 3300046473 | Bacteria | 7163 |
| 706 | Ga0495582_0049272 | 3300046473 | Bacteria | 2319 |
| 707 | Ga0495582_0121891 | 3300046473 | Bacteria | 1469 |
| 708 | Ga0495639_0005141 | 3300046475 | Bacteria | 5620 |
| 709 | Ga0495639_0005478 | 3300046475 | Bacteria | 5466 |
| 710 | Ga0495639_0170734 | 3300046475 | Bacteria | 1055 |
| 711 | Ga0495639_0240850 | 3300046475 | Bacteria | 893 |
| 712 | Ga0495639_0245420 | 3300046475 | Bacteria | 884 |
| 713 | Ga0495662_0000412 | 3300046476 | Bacteria | 19214 |
| 714 | Ga0495662_0002937 | 3300046476 | Bacteria | 8604 |
| 715 | Ga0495662_0009808 | 3300046476 | Bacteria | 4704 |
| 716 | Ga0495662_0018085 | 3300046476 | Bacteria | 3410 |
| 717 | Ga0495662_0022911 | 3300046476 | Bacteria | 3014 |
| 718 | Ga0495664_0001165 | 3300046477 | Bacteria | 13691 |
| 719 | Ga0495664_0001890 | 3300046477 | Bacteria | 11135 |
| 720 | Ga0495664_0003573 | 3300046477 | Bacteria | 8475 |
| 721 | Ga0495664_0060626 | 3300046477 | Bacteria | 2252 |
| 722 | Ga0495664_0068057 | 3300046477 | Bacteria | 2125 |
| 723 | Ga0495664_0087897 | 3300046477 | Bacteria | 1868 |
| 724 | Ga0495664_0166000 | 3300046477 | Bacteria | 1339 |
| 725 | Ga0495664_0293088 | 3300046477 | Bacteria | 982 |
| 726 | Ga0495664_0352053 | 3300046477 | Bacteria | 887 |
| 727 | Ga0495664_0520289 | 3300046477 | Bacteria | 710 |
| 728 | Ga0495594_0007359 | 3300046499 | Bacteria | 5661 |
| 729 | Ga0495594_0058770 | 3300046499 | Bacteria | 2125 |
| 730 | Ga0495594_0079479 | 3300046499 | Bacteria | 1831 |
| 731 | Ga0495594_0466578 | 3300046499 | Bacteria | 718 |
| 732 | Ga0495608_0002056 | 3300046511 | Bacteria | 14477 |
| 733 | Ga0495608_0005716 | 3300046511 | Bacteria | 8876 |
| 734 | Ga0495608_0007465 | 3300046511 | Bacteria | 7717 |
| 735 | Ga0495608_0023494 | 3300046511 | Bacteria | 4225 |
| 736 | Ga0495608_0032890 | 3300046511 | Bacteria | 3506 |
| 737 | Ga0495608_0078230 | 3300046511 | Bacteria | 2152 |
| 738 | Ga0495608_0089581 | 3300046511 | Bacteria | 1991 |
| 739 | Ga0495608_0146801 | 3300046511 | Bacteria | 1504 |
| 740 | Ga0495608_0513621 | 3300046511 | Bacteria | 725 |
| 741 | Ga0495618_0002753 | 3300046514 | Bacteria | 11179 |
| 742 | Ga0495618_0034684 | 3300046514 | Bacteria | 3165 |
| 743 | Ga0495618_0071970 | 3300046514 | Bacteria | 2199 |
| 744 | Ga0495618_0078659 | 3300046514 | Bacteria | 2102 |
| 745 | Ga0495618_0215514 | 3300046514 | Bacteria | 1212 |
| 746 | Ga0495620_0002530 | 3300046515 | Bacteria | 10585 |
| 747 | Ga0495628_0006341 | 3300046516 | Bacteria | 10339 |
| 748 | Ga0495628_0023189 | 3300046516 | Bacteria | 5096 |
| 749 | Ga0495628_0273997 | 3300046516 | Bacteria | 1254 |
| 750 | Ga0495628_0364092 | 3300046516 | Bacteria | 1061 |
| 751 | Ga0495628_0398039 | 3300046516 | Bacteria | 1006 |
| 752 | Ga0495628_0416432 | 3300046516 | Bacteria | 979 |
| 753 | Ga0495628_0419460 | 3300046516 | Bacteria | 975 |
| 754 | Ga0495630_0041245 | 3300046517 | Bacteria | 3446 |
| 755 | Ga0495630_0131022 | 3300046517 | Bacteria | 1904 |
| 756 | Ga0495630_0247316 | 3300046517 | Bacteria | 1362 |
| 757 | Ga0495630_0278247 | 3300046517 | Bacteria | 1278 |
| 758 | Ga0495630_0792064 | 3300046517 | Bacteria | 724 |
| 759 | Ga0495643_0004928 | 3300046522 | Bacteria | 9169 |
| 760 | Ga0495648_0001739 | 3300046524 | Bacteria | 21040 |
| 761 | Ga0495648_0061056 | 3300046524 | Bacteria | 2240 |
| 762 | Ga0495666_0047271 | 3300046526 | Bacteria | 2073 |
| 763 | Ga0495666_0257422 | 3300046526 | Bacteria | 794 |
| 764 | Ga0495642_0091215 | 3300046528 | Bacteria | 1290 |
| 765 | Ga0495652_0010636 | 3300046529 | Bacteria | 8336 |
| 766 | Ga0495652_0029759 | 3300046529 | Bacteria | 4794 |
| 767 | Ga0495652_0068948 | 3300046529 | Bacteria | 2961 |
| 768 | Ga0495652_0142687 | 3300046529 | Bacteria | 1882 |
| 769 | Ga0495652_0243480 | 3300046529 | Bacteria | 1336 |
| 770 | Ga0495652_0306394 | 3300046529 | Bacteria | 1152 |
| 771 | Ga0495652_0636827 | 3300046529 | Bacteria | 723 |
| 772 | Ga0495654_0027042 | 3300046530 | Bacteria | 2944 |
| 773 | Ga0495665_0000527 | 3300046531 | Bacteria | 19367 |
| 774 | Ga0495665_0001636 | 3300046531 | Bacteria | 11995 |
| 775 | Ga0495665_0005757 | 3300046531 | Bacteria | 6689 |
| 776 | Ga0495665_0027374 | 3300046531 | Bacteria | 3059 |
| 777 | Ga0495665_0195361 | 3300046531 | Bacteria | 1050 |
| 778 | Ga0495640_0017096 | 3300046533 | Bacteria | 5412 |
| 779 | Ga0495640_0022869 | 3300046533 | Bacteria | 4565 |
| 780 | Ga0495640_0029267 | 3300046533 | Bacteria | 3956 |
| 781 | Ga0495640_0045341 | 3300046533 | Bacteria | 3051 |
| 782 | Ga0495640_0059035 | 3300046533 | Bacteria | 2614 |
| 783 | Ga0495640_0177384 | 3300046533 | Bacteria | 1359 |
| 784 | Ga0495586_0003401 | 3300046535 | Bacteria | 8534 |
| 785 | Ga0495586_0004628 | 3300046535 | Bacteria | 7355 |
| 786 | Ga0495586_0036463 | 3300046535 | Bacteria | 2639 |
| 787 | Ga0495587_0017623 | 3300046536 | Bacteria | 4435 |
| 788 | Ga0495587_0055131 | 3300046536 | Bacteria | 2342 |
| 789 | Ga0495587_0067454 | 3300046536 | Bacteria | 2085 |
| 790 | Ga0495587_0091792 | 3300046536 | Bacteria | 1753 |
| 791 | Ga0495587_0163884 | 3300046536 | Bacteria | 1264 |
| 792 | Ga0495587_0365195 | 3300046536 | Bacteria | 803 |
| 793 | Ga0495597_0004001 | 3300046542 | Bacteria | 8283 |
| 794 | Ga0495645_0008911 | 3300046543 | Bacteria | 7008 |
| 795 | Ga0495645_0013185 | 3300046543 | Bacteria | 5843 |
| 796 | Ga0495645_0120487 | 3300046543 | Bacteria | 1847 |
| 797 | Ga0495645_0170280 | 3300046543 | Bacteria | 1499 |
| 798 | Ga0495667_0001822 | 3300046559 | Bacteria | 14145 |
| 799 | Ga0495667_0007970 | 3300046559 | Bacteria | 7184 |
| 800 | Ga0495667_0008462 | 3300046559 | Bacteria | 6984 |
| 801 | Ga0495667_0015884 | 3300046559 | Bacteria | 5090 |
| 802 | Ga0495667_0017050 | 3300046559 | Bacteria | 4904 |
| 803 | Ga0495667_0028615 | 3300046559 | Bacteria | 3753 |
| 804 | Ga0495667_0062294 | 3300046559 | Bacteria | 2444 |
| 805 | Ga0495667_0064921 | 3300046559 | Bacteria | 2387 |
| 806 | Ga0495668_0016829 | 3300046616 | Bacteria | 4248 |
| 807 | Ga0495634_0004848 | 3300046642 | Bacteria | 10436 |
| 808 | Ga0495634_0011711 | 3300046642 | Bacteria | 6378 |
| 809 | Ga0495634_0014802 | 3300046642 | Bacteria | 5611 |
| 810 | Ga0495634_0024908 | 3300046642 | Bacteria | 4194 |
| 811 | Ga0495634_0026269 | 3300046642 | Bacteria | 4065 |
| 812 | Ga0495634_0027695 | 3300046642 | Bacteria | 3941 |
| 813 | Ga0495634_0121002 | 3300046642 | Bacteria | 1676 |
| 814 | Ga0495611_0118508 | 3300046648 | Bacteria | 1234 |
| 815 | Ga0495611_0247982 | 3300046648 | Bacteria | 825 |
| 816 | Ga0495635_0002095 | 3300046663 | Bacteria | 13548 |
| 817 | Ga0495635_0013993 | 3300046663 | Bacteria | 5613 |
| 818 | Ga0495635_0029852 | 3300046663 | Bacteria | 3791 |
| 819 | Ga0495635_0032664 | 3300046663 | Bacteria | 3610 |
| 820 | Ga0495635_0163094 | 3300046663 | Bacteria | 1516 |
| 821 | Ga0495635_0180065 | 3300046663 | Bacteria | 1437 |
| 822 | Ga0495635_0271088 | 3300046663 | Bacteria | 1141 |
| 823 | Ga0495588_0002905 | 3300046674 | Bacteria | 7391 |
| 824 | Ga0495588_0032267 | 3300046674 | Bacteria | 2639 |
| 825 | Ga0495588_0152399 | 3300046674 | Bacteria | 1222 |
| 826 | Ga0495657_0005225 | 3300046675 | Bacteria | 10278 |
| 827 | Ga0495657_0018927 | 3300046675 | Bacteria | 4976 |
| 828 | Ga0495657_0020071 | 3300046675 | Bacteria | 4809 |
| 829 | Ga0495657_0027035 | 3300046675 | Bacteria | 4055 |
| 830 | Ga0495657_0035016 | 3300046675 | Bacteria | 3483 |
| 831 | Ga0495657_0040974 | 3300046675 | Bacteria | 3172 |
| 832 | Ga0495599_0006865 | 3300046678 | Bacteria | 6882 |
| 833 | Ga0495599_0009805 | 3300046678 | Bacteria | 5862 |
| 834 | Ga0495599_0013955 | 3300046678 | Bacteria | 4973 |
| 835 | Ga0495599_0027472 | 3300046678 | Bacteria | 3567 |
| 836 | Ga0495599_0030594 | 3300046678 | Bacteria | 3378 |
| 837 | Ga0495599_0049813 | 3300046678 | Bacteria | 2625 |
| 838 | Ga0495599_0316745 | 3300046678 | Bacteria | 939 |
| 839 | Ga0495623_0031543 | 3300046679 | Bacteria | 3406 |
| 840 | Ga0495623_0106721 | 3300046679 | Bacteria | 1701 |
| 841 | Ga0495623_0282193 | 3300046679 | Bacteria | 923 |
| 842 | Ga0495623_0327516 | 3300046679 | Bacteria | 839 |
| 843 | Ga0495646_0004953 | 3300046680 | Bacteria | 8410 |
| 844 | Ga0495646_0025844 | 3300046680 | Bacteria | 3690 |
| 845 | Ga0495646_0030429 | 3300046680 | Bacteria | 3372 |
| 846 | Ga0495647_0081811 | 3300046681 | Bacteria | 1310 |
| 847 | Ga0495658_0003617 | 3300046683 | Bacteria | 7652 |
| 848 | Ga0495658_0015647 | 3300046683 | Bacteria | 3893 |
| 849 | Ga0495658_0069621 | 3300046683 | Bacteria | 2039 |
| 850 | Ga0495658_0194716 | 3300046683 | Bacteria | 1261 |
| 851 | Ga0495613_0004498 | 3300046689 | Bacteria | 10445 |
| 852 | Ga0495613_0075223 | 3300046689 | Bacteria | 2459 |
| 853 | Ga0495613_0093465 | 3300046689 | Bacteria | 2177 |
| 854 | Ga0495613_0182824 | 3300046689 | Bacteria | 1484 |
| 855 | Ga0495624_0008035 | 3300046690 | Bacteria | 7389 |
| 856 | Ga0495624_0009276 | 3300046690 | Bacteria | 6818 |
| 857 | Ga0495624_0011078 | 3300046690 | Bacteria | 6206 |
| 858 | Ga0495624_0019615 | 3300046690 | Bacteria | 4509 |
| 859 | Ga0495624_0145528 | 3300046690 | Bacteria | 1450 |
| 860 | Ga0495671_0032908 | 3300046692 | Bacteria | 2644 |
| 861 | Ga0495649_0037901 | 3300046694 | Bacteria | 2645 |
| 862 | Ga0495589_0021643 | 3300046794 | Bacteria | 3285 |
| 863 | Ga0495600_0004205 | 3300046809 | Bacteria | 8593 |
| 864 | Ga0495600_0006618 | 3300046809 | Bacteria | 7060 |
| 865 | Ga0495600_0031204 | 3300046809 | Bacteria | 3451 |
| 866 | Ga0495600_0037979 | 3300046809 | Bacteria | 3132 |
| 867 | Ga0495600_0053541 | 3300046809 | Bacteria | 2636 |
| 868 | Ga0495600_0066381 | 3300046809 | Bacteria | 2358 |
| 869 | Ga0495600_0138596 | 3300046809 | Bacteria | 1579 |
| 870 | Ga0495600_0264666 | 3300046809 | Bacteria | 1092 |
| 871 | Ga0495660_0023101 | 3300046810 | Bacteria | 3549 |
| 872 | Ga0495581_0003802 | 3300047315 | Bacteria | 8687 |
| 873 | Ga0495581_0005975 | 3300047315 | Bacteria | 7051 |
| 874 | Ga0495581_0008002 | 3300047315 | Bacteria | 6125 |
| 875 | Ga0495581_0010149 | 3300047315 | Bacteria | 5450 |
| 876 | Ga0495581_0010625 | 3300047315 | Bacteria | 5322 |
| 877 | Ga0495581_0247020 | 3300047315 | Bacteria | 1043 |
| 878 | Ga0495581_0643928 | 3300047315 | Bacteria | 613 |
| 879 | Ga0495581_0696696 | 3300047315 | Bacteria | 586 |
| 880 | Ga0495604_0028129 | 3300047317 | Bacteria | 4472 |
| 881 | Ga0495604_0033329 | 3300047317 | Bacteria | 4078 |
| 882 | Ga0495604_0044165 | 3300047317 | Bacteria | 3484 |
| 883 | Ga0495604_0107403 | 3300047317 | Bacteria | 2040 |
| 884 | Ga0495604_0141785 | 3300047317 | Bacteria | 1716 |
| 885 | Ga0495604_0305923 | 3300047317 | Bacteria | 1066 |
| 886 | Ga0495674_0001939 | 3300047319 | Bacteria | 20412 |
| 887 | Ga0495674_0005954 | 3300047319 | Bacteria | 11697 |
| 888 | Ga0495674_0039427 | 3300047319 | Bacteria | 4234 |
| 889 | Ga0495674_0047011 | 3300047319 | Bacteria | 3828 |
| 890 | Ga0495674_0083509 | 3300047319 | Bacteria | 2738 |
| 891 | Ga0495674_0240067 | 3300047319 | Bacteria | 1493 |
| 892 | Ga0495674_0305147 | 3300047319 | Bacteria | 1299 |
| 893 | Ga0495674_0398944 | 3300047319 | Bacteria | 1110 |
| 894 | Ga0495674_0412763 | 3300047319 | Bacteria | 1088 |
| 895 | Ga0495674_0580662 | 3300047319 | Bacteria | 889 |
| 896 | Ga0495674_0977222 | 3300047319 | Bacteria | 650 |
| 897 | Ga0495672_0001084 | 3300047320 | Bacteria | 27657 |
| 898 | Ga0495676_0014233 | 3300047321 | Bacteria | 7122 |
| 899 | Ga0495676_0029722 | 3300047321 | Bacteria | 4650 |
| 900 | Ga0495676_0032348 | 3300047321 | Bacteria | 4416 |
| 901 | Ga0495676_0104921 | 3300047321 | Bacteria | 2084 |
| 902 | Ga0495676_0432874 | 3300047321 | Bacteria | 869 |
| 903 | Ga0495680_0004959 | 3300047322 | Bacteria | 12594 |
| 904 | Ga0495680_0040720 | 3300047322 | Bacteria | 3699 |
| 905 | Ga0495680_0045281 | 3300047322 | Bacteria | 3474 |
| 906 | Ga0495680_0052221 | 3300047322 | Bacteria | 3187 |
| 907 | Ga0495680_0087409 | 3300047322 | Bacteria | 2344 |
| 908 | Ga0495680_0129634 | 3300047322 | Bacteria | 1854 |
| 909 | Ga0495680_0305774 | 3300047322 | Bacteria | 1115 |
| 910 | Ga0495680_0486686 | 3300047322 | Bacteria | 839 |
| 911 | Ga0495683_0073618 | 3300047323 | Bacteria | 1675 |
| 912 | Ga0495687_017124 | 3300047443 | Bacteria | 3626 |
| 913 | Ga0495675_0017646 | 3300047444 | Bacteria | 4525 |
| 914 | Ga0495675_0018849 | 3300047444 | Bacteria | 4384 |
| 915 | Ga0495675_0031676 | 3300047444 | Bacteria | 3375 |
| 916 | Ga0495675_0063827 | 3300047444 | Bacteria | 2330 |
| 917 | Ga0495675_0121648 | 3300047444 | Bacteria | 1625 |
| 918 | Ga0495675_0187677 | 3300047444 | Bacteria | 1263 |
| 919 | Ga0495675_0205479 | 3300047444 | Bacteria | 1197 |
| 920 | Ga0495677_0011039 | 3300047445 | Bacteria | 3310 |
| 921 | Ga0495677_0049407 | 3300047445 | Bacteria | 1546 |
| 922 | Ga0495673_0001554 | 3300047469 | Bacteria | 17987 |
| 923 | Ga0495684_0001710 | 3300047471 | Bacteria | 17662 |
| 924 | Ga0495684_0001792 | 3300047471 | Bacteria | 17242 |
| 925 | Ga0495684_0009255 | 3300047471 | Bacteria | 7607 |
| 926 | Ga0495684_0015690 | 3300047471 | Bacteria | 5828 |
| 927 | Ga0495684_0061160 | 3300047471 | Bacteria | 2865 |
| 928 | Ga0495684_0088808 | 3300047471 | Bacteria | 2342 |
| 929 | Ga0495684_0244909 | 3300047471 | Bacteria | 1306 |
| 930 | Ga0495593_0002686 | 3300047673 | Bacteria | 10697 |
| 931 | Ga0495593_0003268 | 3300047673 | Bacteria | 9720 |
| 932 | Ga0495593_0032155 | 3300047673 | Bacteria | 2862 |
| 933 | Ga0495593_0061312 | 3300047673 | Bacteria | 1967 |
| 934 | Ga0495602_0042823 | 3300048088 | Bacteria | 4121 |
| 935 | Ga0495602_0049682 | 3300048088 | Bacteria | 3754 |
| 936 | Ga0495602_0071308 | 3300048088 | Bacteria | 2967 |
| 937 | Ga0495602_0073794 | 3300048088 | Bacteria | 2902 |
| 938 | Ga0495602_0131359 | 3300048088 | Bacteria | 1996 |
| 939 | Ga0495602_0616566 | 3300048088 | Bacteria | 744 |
| 940 | Ga0495614_0001922 | 3300048089 | Bacteria | 9108 |
| 941 | Ga0495614_0018578 | 3300048089 | Bacteria | 3012 |
| 942 | Ga0495614_0018654 | 3300048089 | Bacteria | 3004 |
| 943 | Ga0496100_0031222 | 3300048903 | Bacteria | 3310 |
| 944 | Ga0496100_0042032 | 3300048903 | Bacteria | 2917 |
| 945 | Ga0496100_0055391 | 3300048903 | Bacteria | 2590 |
| 946 | Ga0496100_0146155 | 3300048903 | Bacteria | 1681 |
| 947 | Ga0496100_0901097 | 3300048903 | Bacteria | 694 |
| 948 | Ga0496100_1293289 | 3300048903 | Bacteria | 575 |
| 949 | Ga0496101_0007400 | 3300048904 | Bacteria | 7113 |
| 950 | Ga0496101_0009428 | 3300048904 | Bacteria | 6417 |
| 951 | Ga0496101_0016606 | 3300048904 | Bacteria | 4978 |
| 952 | Ga0496101_0027452 | 3300048904 | Bacteria | 3966 |
| 953 | Ga0496101_0078509 | 3300048904 | Bacteria | 2435 |
| 954 | Ga0496102_0002361 | 3300048905 | Bacteria | 16111 |
| 955 | Ga0496102_0059619 | 3300048905 | Bacteria | 3490 |
| 956 | Ga0496102_0063830 | 3300048905 | Bacteria | 3373 |
| 957 | Ga0496102_0314893 | 3300048905 | Bacteria | 1474 |
| 958 | Ga0496102_0340472 | 3300048905 | Bacteria | 1412 |
| 959 | Ga0496103_0000900 | 3300048906 | Bacteria | 21361 |
| 960 | Ga0496103_0021988 | 3300048906 | Bacteria | 3839 |
| 961 | Ga0496103_0060001 | 3300048906 | Bacteria | 2364 |
| 962 | Ga0496103_0494979 | 3300048906 | Bacteria | 782 |
| 963 | Ga0496103_0597210 | 3300048906 | Bacteria | 703 |
| 964 | Ga0496104_0052222 | 3300048907 | Bacteria | 3860 |
| 965 | Ga0496104_0127458 | 3300048907 | Bacteria | 2444 |
| 966 | Ga0496104_0786087 | 3300048907 | Bacteria | 858 |
| 967 | Ga0496105_0131535 | 3300048908 | Bacteria | 2063 |
| 968 | Ga0496105_0142488 | 3300048908 | Bacteria | 1972 |
| 969 | Ga0496105_0535885 | 3300048908 | Bacteria | 915 |
| 970 | Ga0496106_0008276 | 3300048909 | Bacteria | 7695 |
| 971 | Ga0496106_0014311 | 3300048909 | Bacteria | 5862 |
| 972 | Ga0496106_0017839 | 3300048909 | Bacteria | 5248 |
| 973 | Ga0496106_0197799 | 3300048909 | Bacteria | 1599 |
| 974 | Ga0496106_0222264 | 3300048909 | Bacteria | 1506 |
| 975 | Ga0496107_0031543 | 3300048910 | Bacteria | 3782 |
| 976 | Ga0496107_0041358 | 3300048910 | Bacteria | 3309 |
| 977 | Ga0496107_0042154 | 3300048910 | Bacteria | 3278 |
| 978 | Ga0496107_0087504 | 3300048910 | Bacteria | 2274 |
| 979 | Ga0496107_0459552 | 3300048910 | Bacteria | 945 |
| 980 | Ga0496108_0001177 | 3300048911 | Bacteria | 20397 |
| 981 | Ga0496108_0005259 | 3300048911 | Bacteria | 10452 |
| 982 | Ga0496108_0037682 | 3300048911 | Bacteria | 4028 |
| 983 | Ga0496109_0000999 | 3300048912 | Bacteria | 23362 |
| 984 | Ga0496109_0004046 | 3300048912 | Bacteria | 12246 |
| 985 | Ga0496109_0016077 | 3300048912 | Bacteria | 6538 |
| 986 | Ga0496109_0598665 | 3300048912 | Bacteria | 1038 |
| 987 | Ga0496110_0001024 | 3300048913 | Bacteria | 19667 |
| 988 | Ga0496110_0027396 | 3300048913 | Bacteria | 4885 |
| 989 | Ga0496110_0054339 | 3300048913 | Bacteria | 3522 |
| 990 | Ga0496110_0112353 | 3300048913 | Bacteria | 2449 |
| 991 | Ga0496110_0605308 | 3300048913 | Bacteria | 994 |
| 992 | Ga0496111_0000822 | 3300048914 | Bacteria | 16685 |
| 993 | Ga0496111_0031219 | 3300048914 | Bacteria | 3794 |
| 994 | Ga0496111_0350133 | 3300048914 | Bacteria | 1093 |
| 995 | Ga0496112_0005524 | 3300048915 | Bacteria | 10951 |
| 996 | Ga0496112_0025280 | 3300048915 | Bacteria | 5701 |
| 997 | Ga0496112_0077765 | 3300048915 | Bacteria | 3281 |
| 998 | Ga0496112_0286452 | 3300048915 | Bacteria | 1594 |
| 999 | Ga0496112_0964220 | 3300048915 | Bacteria | 773 |
| 1000 | Ga0496112_1208963 | 3300048915 | Bacteria | 672 |
| 1001 | Ga0496113_0026268 | 3300048916 | Bacteria | 4161 |
| 1002 | Ga0496113_0200431 | 3300048916 | Bacteria | 1586 |
| 1003 | Ga0496113_1039547 | 3300048916 | Bacteria | 644 |
| 1004 | Ga0496114_0012826 | 3300048917 | Bacteria | 6711 |
| 1005 | Ga0496114_0052454 | 3300048917 | Bacteria | 3398 |
| 1006 | Ga0496114_0287010 | 3300048917 | Bacteria | 1451 |
| 1007 | Ga0496114_0405272 | 3300048917 | Bacteria | 1207 |
| 1008 | Ga0496115_0011617 | 3300048918 | Bacteria | 6607 |
| 1009 | Ga0496115_0215929 | 3300048918 | Bacteria | 1583 |
| 1010 | Ga0496115_0241103 | 3300048918 | Bacteria | 1490 |
| 1011 | Ga0496115_0251814 | 3300048918 | Bacteria | 1454 |
| 1012 | Ga0496115_0481314 | 3300048918 | Bacteria | 999 |
| 1013 | Ga0496115_0740418 | 3300048918 | Bacteria | 769 |
| 1014 | Ga0496126_0018870 | 3300048929 | Bacteria | 6815 |
| 1015 | Ga0501032_0040837 | 3300049569 | Bacteria | 3152 |
| 1016 | Ga0501034_1338215 | 3300049571 | Bacteria | 592 |
| 1017 | Ga0501038_0014496 | 3300049574 | Bacteria | 7184 |
| 1018 | Ga0501038_0226986 | 3300049574 | Bacteria | 1488 |
| 1019 | Ga0501040_0116215 | 3300049576 | Bacteria | 1874 |
| 1020 | Ga0501042_0145193 | 3300049578 | Bacteria | 1710 |
| 1021 | Ga0501047_0070677 | 3300049581 | Bacteria | 3361 |
| 1022 | Ga0501048_0016245 | 3300049582 | Bacteria | 5488 |
| 1023 | Ga0501076_0065560 | 3300049592 | Bacteria | 2896 |
| 1024 | Ga0501077_0066460 | 3300049593 | Bacteria | 2287 |
| 1025 | Ga0501079_0091892 | 3300049741 | Bacteria | 2351 |
| 1026 | Ga0501079_0965205 | 3300049741 | Bacteria | 671 |
| 1027 | Ga0501080_0227225 | 3300049742 | Bacteria | 1706 |
| 1028 | Ga0501081_0168560 | 3300049743 | Bacteria | 1580 |
| 1029 | Ga0501035_0021515 | 3300049822 | Bacteria | 5929 |
| 1030 | Ga0501044_0133704 | 3300049823 | Bacteria | 2473 |
| 1031 | nmdc:mga07m45_38484_c1 | 3300050496 | Bacteria | 2669 |
| 1032 | nmdc:mga05p37_1162329_c1 | 3300050507 | Bacteria | 801 |
| 1033 | nmdc:mga05p37_19328_c1 | 3300050507 | Bacteria | 8241 |
| 1034 | nmdc:mga05p37_78124_c1 | 3300050507 | Bacteria | 4075 |
| 1035 | nmdc:mga09592_198152_c1 | 3300050508 | Bacteria | 1739 |
| 1036 | nmdc:mga09592_451649_c1 | 3300050508 | Bacteria | 1109 |
| 1037 | nmdc:mga06r32_361007_c1 | 3300050510 | Bacteria | 1437 |
| 1038 | nmdc:mga06r32_517088_c1 | 3300050510 | Bacteria | 1170 |
| 1039 | nmdc:mga06r32_913693_c1 | 3300050510 | Bacteria | 834 |
| 1040 | nmdc:mga0n895_1090152_c1 | 3300050512 | Bacteria | 776 |
| 1041 | nmdc:mga0n895_64166_c1 | 3300050512 | Bacteria | 3633 |
| 1042 | nmdc:mga0n895_76922_c1 | 3300050512 | Bacteria | 3319 |
| 1043 | nmdc:mga0n895_80677_c1 | 3300050512 | Bacteria | 3242 |
| 1044 | nmdc:mga0rr50_289793_c1 | 3300050513 | Bacteria | 1368 |
| 1045 | nmdc:mga0rr50_376532_c1 | 3300050513 | Bacteria | 1196 |
| 1046 | nmdc:mga0rr50_42045_c1 | 3300050513 | Bacteria | 3335 |
| 1047 | nmdc:mga0rr50_650450_c1 | 3300050513 | Bacteria | 899 |
| 1048 | nmdc:mga0rr50_901_c1 | 3300050513 | Bacteria | 16066 |
| 1049 | nmdc:mga0rr50_90468_c1 | 3300050513 | Bacteria | 2382 |
| 1050 | nmdc:mga08x19_21480_c1 | 3300050514 | Bacteria | 3986 |
| 1051 | nmdc:mga08x19_555077_c1 | 3300050514 | Bacteria | 813 |
| 1052 | nmdc:mga08x19_620743_c1 | 3300050514 | Bacteria | 766 |
| 1053 | nmdc:mga08x19_66942_c1 | 3300050514 | Bacteria | 2336 |
| 1054 | nmdc:mga08x19_743781_c1 | 3300050514 | Bacteria | 696 |
| 1055 | nmdc:mga08x19_92046_c1 | 3300050514 | Bacteria | 2002 |
| 1056 | nmdc:mga0a205_147319_c1 | 3300050515 | Bacteria | 2254 |
| 1057 | Ga0495601_0023284 | 3300053077 | Bacteria | 3805 |
| 1058 | Ga0495601_0031070 | 3300053077 | Bacteria | 3318 |
| 1059 | Ga0495601_0046115 | 3300053077 | Bacteria | 2743 |
| 1060 | Ga0495601_0050486 | 3300053077 | Bacteria | 2623 |
| 1061 | Ga0495612_0003397 | 3300053078 | Bacteria | 6596 |
| 1062 | Ga0495612_0012345 | 3300053078 | Bacteria | 3443 |
| 1063 | Ga0495612_0016147 | 3300053078 | Bacteria | 2991 |
| 1064 | Ga0495612_0189731 | 3300053078 | Bacteria | 904 |
| 1065 | Ga0495595_0003315 | 3300053084 | Bacteria | 6386 |
| 1066 | Ga0495595_0006299 | 3300053084 | Bacteria | 4832 |
| 1067 | Ga0495595_0035229 | 3300053084 | Bacteria | 2267 |
| 1068 | Ga0495595_0052398 | 3300053084 | Bacteria | 1893 |
| 1069 | Ga0495619_0014137 | 3300053085 | Bacteria | 5040 |
| 1070 | Ga0495619_0022070 | 3300053085 | Bacteria | 4069 |
| 1071 | Ga0495619_0188481 | 3300053085 | Bacteria | 1427 |
| 1072 | Ga0495619_0575481 | 3300053085 | Bacteria | 771 |
| 1073 | Ga0495619_0661282 | 3300053085 | Bacteria | 712 |
| 1074 | Ga0501082_0114752 | 3300060353 | Bacteria | 2332 |
| 1075 | 2616698833 | 2616644814 | Bacteria | 11555299 |
| 1076 | 2776372014 | 2775506925 | Bacteria | 7237746 |
| 1077 | 2863072744 | 2863067949 | Bacteria | 8541735 |
| 1078 | Ga0207699_10027900 | |||
| 1079 | JGI24737J22298_10160246 | |||
| 1080 | JGI24735J21928_10093421 | |||
| 1081 | JGI25405J52794_10035640 | |||
| 1082 | Ga0070683_100307317 | |||
| 1083 | Ga0070683_100497232 | |||
| 1084 | Ga0070683_100741731 | |||
| 1085 | Ga0070690_100065426 | |||
| 1086 | Ga0070690_100870557 | |||
| 1087 | Ga0070670_100524492 | |||
| 1088 | Ga0070670_100768070 | |||
| 1089 | Ga0068869_100906888 | |||
| 1090 | Ga0070666_10275128 | |||
| 1091 | Ga0070682_100122746 | |||
| 1092 | Ga0068868_100016481 | |||
| 1093 | Ga0068868_100038154 | |||
| 1094 | Ga0068868_100050853 | |||
| 1095 | Ga0068868_100802099 | |||
| 1096 | Ga0070660_100027711 | |||
| 1097 | Ga0070660_100039597 | |||
| 1098 | Ga0070660_100061081 | |||
| 1099 | Ga0070660_100278383 | |||
| 1100 | Ga0070689_100550756 | |||
| 1101 | Ga0070691_10039982 | |||
| 1102 | Ga0070691_10062670 | |||
| 1103 | Ga0070691_10089050 | |||
| 1104 | Ga0070691_10228752 | |||
| 1105 | Ga0070687_100357250 | |||
| 1106 | Ga0070661_101215401 | |||
| 1107 | Ga0070692_10026793 | |||
| 1108 | Ga0070692_10212074 | |||
| 1109 | Ga0070692_10500182 | |||
| 1110 | Ga0070668_100604672 | |||
| 1111 | Ga0070669_100303473 | |||
| 1112 | Ga0070671_100489358 | |||
| 1113 | Ga0070671_100949736 | |||
| 1114 | Ga0070671_101116593 | |||
| 1115 | Ga0070674_100051847 | |||
| 1116 | Ga0070673_101692510 | |||
| 1117 | Ga0070688_100233666 | |||
| 1118 | Ga0070688_100306472 | |||
| 1119 | Ga0070659_100033283 | |||
| 1120 | Ga0070659_100194188 | |||
| 1121 | Ga0070667_101420759 | |||
| 1122 | Ga0070709_10002265 | |||
| 1123 | Ga0070709_10019775 | |||
| 1124 | Ga0070709_10167921 | |||
| 1125 | Ga0070709_10179577 | |||
| 1126 | Ga0070709_10686549 | |||
| 1127 | Ga0070714_100115390 | |||
| 1128 | Ga0070714_100256802 | |||
| 1129 | Ga0070714_100260198 | |||
| 1130 | Ga0070714_100354509 | |||
| 1131 | Ga0070714_100466077 | |||
| 1132 | Ga0070714_100615307 | |||
| 1133 | Ga0070714_100843212 | |||
| 1134 | Ga0070714_100978775 | |||
| 1135 | Ga0070713_100023504 | |||
| 1136 | Ga0070713_100040276 | |||
| 1137 | Ga0070713_100065915 | |||
| 1138 | Ga0070713_100083999 | |||
| 1139 | Ga0070713_100114161 | |||
| 1140 | Ga0070713_100210599 | |||
| 1141 | Ga0070713_100336574 | |||
| 1142 | Ga0070713_100819919 | |||
| 1143 | Ga0070713_100964657 | |||
| 1144 | Ga0070710_10000062 | |||
| 1145 | Ga0070710_10001471 | |||
| 1146 | Ga0070710_10085055 | |||
| 1147 | Ga0070710_10181653 | |||
| 1148 | Ga0070710_10183221 | |||
| 1149 | Ga0070710_10271182 | |||
| 1150 | Ga0070710_10280668 | |||
| 1151 | Ga0070710_10443148 | |||
| 1152 | Ga0070701_10386290 | |||
| 1153 | Ga0070701_10619525 | |||
| 1154 | Ga0070701_10753897 | |||
| 1155 | Ga0070711_100005424 | |||
| 1156 | Ga0070711_100008495 | |||
| 1157 | Ga0070711_100016448 | |||
| 1158 | Ga0070711_100016904 | |||
| 1159 | Ga0070711_100073573 | |||
| 1160 | Ga0070711_100419923 | |||
| 1161 | Ga0070700_100041681 | |||
| 1162 | Ga0070700_100340297 | |||
| 1163 | Ga0070694_100087949 | |||
| 1164 | Ga0070694_100216858 | |||
| 1165 | Ga0070708_100005426 | |||
| 1166 | Ga0070708_100016992 | |||
| 1167 | Ga0070708_100480890 | |||
| 1168 | Ga0070663_100196445 | |||
| 1169 | Ga0070663_100464970 | |||
| 1170 | Ga0070678_100137178 | |||
| 1171 | Ga0070678_100178806 | |||
| 1172 | Ga0070678_100370996 | |||
| 1173 | Ga0070662_100230604 | |||
| 1174 | Ga0070681_10317335 | |||
| 1175 | Ga0068867_100084429 | |||
| 1176 | Ga0068867_100695110 | |||
| 1177 | Ga0070685_10114512 | |||
| 1178 | Ga0070685_10659487 | |||
| 1179 | Ga0070706_100002279 | |||
| 1180 | Ga0070706_100002738 | |||
| 1181 | Ga0070706_100008799 | |||
| 1182 | Ga0070706_100010481 | |||
| 1183 | Ga0070706_100054380 | |||
| 1184 | Ga0070706_100103563 | |||
| 1185 | Ga0070706_100135523 | |||
| 1186 | Ga0070706_100398727 | |||
| 1187 | Ga0070706_100413919 | |||
| 1188 | Ga0070706_100500708 | |||
| 1189 | Ga0070706_100860426 | |||
| 1190 | Ga0070707_100000766 | |||
| 1191 | Ga0070707_100005165 | |||
| 1192 | Ga0070707_100006185 | |||
| 1193 | Ga0070707_100011348 | |||
| 1194 | Ga0070707_100020722 | |||
| 1195 | Ga0070707_100085411 | |||
| 1196 | Ga0070707_100335877 | |||
| 1197 | Ga0070707_100377055 | |||
| 1198 | Ga0070707_100396758 | |||
| 1199 | Ga0070707_101018551 | |||
| 1200 | Ga0070698_100000052 | |||
| 1201 | Ga0070698_100000240 | |||
| 1202 | Ga0070698_100001129 | |||
| 1203 | Ga0070698_100003354 | |||
| 1204 | Ga0070698_100005243 | |||
| 1205 | Ga0070698_100013120 | |||
| 1206 | Ga0070698_100055330 | |||
| 1207 | Ga0070698_100212488 | |||
| 1208 | Ga0070699_100253103 | |||
| 1209 | Ga0070699_101257490 | |||
| 1210 | Ga0070679_100012946 | |||
| 1211 | Ga0070679_100114074 | |||
| 1212 | Ga0070679_100663271 | |||
| 1213 | Ga0070684_100043947 | |||
| 1214 | Ga0070684_100195894 | |||
| 1215 | Ga0070684_100680421 | |||
| 1216 | Ga0070684_100799064 | |||
| 1217 | Ga0070684_101097988 | |||
| 1218 | Ga0070697_100007609 | |||
| 1219 | Ga0068853_100004797 | |||
| 1220 | Ga0068853_100594607 | |||
| 1221 | Ga0070672_101059232 | |||
| 1222 | Ga0070686_100083169 | |||
| 1223 | Ga0070686_100084243 | |||
| 1224 | Ga0070695_100011751 | |||
| 1225 | Ga0070696_100207430 | |||
| 1226 | Ga0070696_100621978 | |||
| 1227 | Ga0070693_100229791 | |||
| 1228 | Ga0070665_100024902 | |||
| 1229 | Ga0070665_100129287 | |||
| 1230 | Ga0070665_100159587 | |||
| 1231 | Ga0070704_100009198 | |||
| 1232 | Ga0068855_100062078 | |||
| 1233 | Ga0068855_100064949 | |||
| 1234 | Ga0068855_100986362 | |||
| 1235 | Ga0070664_100403696 | |||
| 1236 | Ga0068857_100142928 | |||
| 1237 | Ga0068857_100175450 | |||
| 1238 | Ga0068857_100205191 | |||
| 1239 | Ga0068854_100002781 | |||
| 1240 | Ga0068854_100232659 | |||
| 1241 | Ga0068854_100522646 | |||
| 1242 | Ga0068856_100116981 | |||
| 1243 | Ga0068856_100201091 | |||
| 1244 | Ga0068856_100217338 | |||
| 1245 | Ga0068856_100336074 | |||
| 1246 | Ga0068856_100371172 | |||
| 1247 | Ga0068856_100409676 | |||
| 1248 | Ga0068856_100711659 | |||
| 1249 | Ga0070702_100035399 | |||
| 1250 | Ga0070702_100037322 | |||
| 1251 | Ga0070702_100088248 | |||
| 1252 | Ga0068852_100639401 | |||
| 1253 | Ga0068859_100057132 | |||
| 1254 | Ga0068859_100065371 | |||
| 1255 | Ga0068859_100426432 | |||
| 1256 | Ga0068859_100692745 | |||
| 1257 | Ga0068864_100041744 | |||
| 1258 | Ga0068864_100072061 | |||
| 1259 | Ga0068864_100279276 | |||
| 1260 | Ga0068864_100343175 | |||
| 1261 | Ga0068866_10063641 | |||
| 1262 | Ga0068866_10197049 | |||
| 1263 | Ga0068851_10026810 | |||
| 1264 | Ga0068863_100045859 | |||
| 1265 | Ga0068863_100046775 | |||
| 1266 | Ga0068863_100418425 | |||
| 1267 | Ga0068863_100472858 | |||
| 1268 | Ga0068863_100915285 | |||
| 1269 | Ga0068863_101903271 | |||
| 1270 | Ga0068858_100211923 | |||
| 1271 | Ga0068858_100486811 | |||
| 1272 | Ga0068860_100020629 | |||
| 1273 | Ga0068860_100131329 | |||
| 1274 | Ga0068860_100379837 | |||
| 1275 | Ga0081455_10001937 | |||
| 1276 | Ga0081455_10016218 | |||
| 1277 | Ga0081538_10002084 | |||
| 1278 | Ga0081538_10004035 | |||
| 1279 | Ga0081540_1003740 | |||
| 1280 | Ga0081540_1005630 | |||
| 1281 | Ga0081540_1023540 | |||
| 1282 | Ga0070717_10023809 | |||
| 1283 | Ga0070717_10083818 | |||
| 1284 | Ga0070717_10110358 | |||
| 1285 | Ga0070717_10116251 | |||
| 1286 | Ga0070717_10118858 | |||
| 1287 | Ga0070717_10170150 | |||
| 1288 | Ga0070717_10241112 | |||
| 1289 | Ga0070717_10583525 | |||
| 1290 | Ga0070717_10745248 | |||
| 1291 | Ga0075365_10466746 | |||
| 1292 | Ga0075432_10055200 | |||
| 1293 | Ga0070715_10006440 | |||
| 1294 | Ga0070715_10008224 | |||
| 1295 | Ga0070715_10023449 | |||
| 1296 | Ga0070715_10068850 | |||
| 1297 | Ga0070715_10071947 | |||
| 1298 | Ga0070715_10522790 | |||
| 1299 | Ga0070716_100043934 | |||
| 1300 | Ga0070716_100065349 | |||
| 1301 | Ga0070716_100104672 | |||
| 1302 | Ga0070716_100288058 | |||
| 1303 | Ga0070716_100297222 | |||
| 1304 | Ga0070712_100012380 | |||
| 1305 | Ga0070712_100168892 | |||
| 1306 | Ga0070712_100199023 | |||
| 1307 | Ga0070712_100271233 | |||
| 1308 | Ga0070712_100464804 | |||
| 1309 | Ga0070712_100475036 | |||
| 1310 | Ga0070712_100717420 | |||
| 1311 | Ga0097621_100211628 | |||
| 1312 | Ga0097621_100879294 | |||
| 1313 | Ga0068871_100015846 | |||
| 1314 | Ga0068871_100350500 | |||
| 1315 | Ga0075431_100007823 | |||
| 1316 | Ga0075431_100971727 | |||
| 1317 | Ga0075433_10047959 | |||
| 1318 | Ga0075433_10065399 | |||
| 1319 | Ga0075433_10066227 | |||
| 1320 | Ga0075433_10142550 | |||
| 1321 | Ga0075434_100001286 | |||
| 1322 | Ga0075434_100005698 | |||
| 1323 | Ga0075434_100072103 | |||
| 1324 | Ga0075434_100074251 | |||
| 1325 | Ga0075434_100139705 | |||
| 1326 | Ga0075434_100722957 | |||
| 1327 | Ga0075434_101271474 | |||
| 1328 | Ga0068865_100346889 | |||
| 1329 | Ga0068865_100426423 | |||
| 1330 | Ga0075436_100076354 | |||
| 1331 | Ga0075436_100089709 | |||
| 1332 | Ga0075436_100123136 | |||
| 1333 | Ga0075436_100185475 | |||
| 1334 | Ga0075436_100674392 | |||
| 1335 | Ga0097620_100057135 | |||
| 1336 | Ga0097620_100065372 | |||
| 1337 | Ga0097620_100426414 | |||
| 1338 | Ga0097620_100692773 | |||
| 1339 | Ga0075435_100026742 | |||
| 1340 | Ga0075435_100074841 | |||
| 1341 | Ga0075435_100081661 | |||
| 1342 | Ga0075435_100295481 | |||
| 1343 | Ga0075435_100412351 | |||
| 1344 | Ga0105240_10023204 | |||
| 1345 | Ga0105240_10244863 | |||
| 1346 | Ga0105240_10599435 | |||
| 1347 | Ga0105240_10951325 | |||
| 1348 | Ga0111539_10215835 | |||
| 1349 | Ga0111539_10302489 | |||
| 1350 | Ga0105245_10002929 | |||
| 1351 | Ga0105245_10017210 | |||
| 1352 | Ga0105245_10105754 | |||
| 1353 | Ga0105245_10202444 | |||
| 1354 | Ga0105245_10503595 | |||
| 1355 | Ga0105247_10071459 | |||
| 1356 | Ga0105247_10207792 | |||
| 1357 | Ga0105247_10287245 | |||
| 1358 | Ga0105247_10363096 | |||
| 1359 | Ga0114129_10001833 | |||
| 1360 | Ga0114129_10026476 | |||
| 1361 | Ga0114129_10040022 | |||
| 1362 | Ga0114129_10091948 | |||
| 1363 | Ga0114129_11154820 | |||
| 1364 | Ga0114129_11251461 | |||
| 1365 | Ga0114129_11379535 | |||
| 1366 | Ga0105243_10061350 | |||
| 1367 | Ga0105243_10079189 | |||
| 1368 | Ga0105243_11062704 | |||
| 1369 | Ga0105243_11256592 | |||
| 1370 | Ga0105243_11711984 | |||
| 1371 | Ga0105243_12497103 | |||
| 1372 | Ga0105242_10062167 | |||
| 1373 | Ga0105242_10104966 | |||
| 1374 | Ga0105242_10317229 | |||
| 1375 | Ga0105242_10822083 | |||
| 1376 | Ga0105248_10211288 | |||
| 1377 | Ga0105248_10463612 | |||
| 1378 | Ga0105248_10983387 | |||
| 1379 | Ga0105248_11024837 | |||
| 1380 | Ga0105237_10181882 | |||
| 1381 | Ga0105238_10064237 | |||
| 1382 | Ga0105238_11485484 | |||
| 1383 | Ga0105249_10013128 | |||
| 1384 | Ga0105249_10236514 | |||
| 1385 | Ga0105249_10408552 | |||
| 1386 | Ga0105239_10016303 | |||
| 1387 | Ga0105239_10143995 | |||
| 1388 | Ga0105246_10001080 | |||
| 1389 | Ga0105246_10723191 | |||
| 1390 | Ga0105246_10859001 | |||
| 1391 | Ga0157371_10574908 | |||
| 1392 | Ga0157371_10651523 | |||
| 1393 | Ga0157370_10021287 | |||
| 1394 | Ga0157370_10604846 | |||
| 1395 | Ga0157369_10262083 | |||
| 1396 | Ga0157369_10972768 | |||
| 1397 | Ga0157374_10086571 | |||
| 1398 | Ga0157374_10230397 | |||
| 1399 | Ga0157374_10869181 | |||
| 1400 | Ga0157378_10053800 | |||
| 1401 | Ga0157378_10876270 | |||
| 1402 | Ga0163162_10011696 | |||
| 1403 | Ga0163162_10093105 | |||
| 1404 | Ga0157372_10027041 | |||
| 1405 | Ga0157372_10054428 | |||
| 1406 | Ga0157372_10322562 | |||
| 1407 | Ga0157372_10352705 | |||
| 1408 | Ga0157375_10457624 | |||
| 1409 | Ga0157375_10554369 | |||
| 1410 | Ga0157375_10945253 | |||
| 1411 | Ga0163163_10018830 | |||
| 1412 | Ga0163163_10276084 | |||
| 1413 | Ga0157380_10073757 | |||
| 1414 | Ga0157377_10051266 | |||
| 1415 | Ga0157377_10301163 | |||
| 1416 | Ga0157379_10043645 | |||
| 1417 | Ga0157379_10239361 | |||
| 1418 | Ga0157379_10375102 | |||
| 1419 | Ga0157379_10469900 | |||
| 1420 | Ga0157379_10550291 | |||
| 1421 | Ga0157376_10255455 | |||
| 1422 | Ga0157376_10363875 | |||
| 1423 | Ga0157376_11676932 | |||
| 1424 | Ga0182005_1057582 | |||
| 1425 | Ga0163161_10015187 | |||
| 1426 | Ga0163161_10135818 | |||
| 1427 | Ga0197907_10193487 | |||
| 1428 | Ga0206356_10016421 | |||
| 1429 | Ga0206356_11724377 | |||
| 1430 | Ga0206355_1190914 | |||
| 1431 | Ga0206351_10217137 | |||
| 1432 | Ga0206352_10888235 | |||
| 1433 | Ga0206350_11009252 | |||
| 1434 | Ga0206354_10507425 | |||
| 1435 | Ga0206354_10872599 | |||
| 1436 | Ga0206353_11031566 | |||
| 1437 | Ga0206353_11153769 | |||
| 1438 | Ga0213875_10000312 | |||
| 1439 | Ga0213875_10094627 | |||
| 1440 | Ga0213875_10260724 | |||
| 1441 | Ga0224712_10016888 | |||
| 1442 | Ga0224712_10378905 | |||
| 1443 | Ga0228598_1009818 | |||
| 1444 | Ga0207692_10008449 | |||
| 1445 | Ga0207692_10014974 | |||
| 1446 | Ga0207692_10053087 | |||
| 1447 | Ga0207692_10096150 | |||
| 1448 | Ga0207642_10035776 | |||
| 1449 | Ga0207642_10115078 | |||
| 1450 | Ga0207710_10079136 | |||
| 1451 | Ga0207710_10377461 | |||
| 1452 | Ga0207688_10006566 | |||
| 1453 | Ga0207688_10115790 | |||
| 1454 | Ga0207680_10026973 | |||
| 1455 | Ga0207680_10342344 | |||
| 1456 | Ga0207647_10196993 | |||
| 1457 | Ga0207647_10304675 | |||
| 1458 | Ga0207685_10015217 | |||
| 1459 | Ga0207685_10024079 | |||
| 1460 | Ga0207685_10046686 | |||
| 1461 | Ga0207685_10164427 | |||
| 1462 | Ga0207699_10060547 | |||
| 1463 | Ga0207699_10071150 | |||
| 1464 | Ga0207699_10126295 | |||
| 1465 | Ga0207699_10205334 | |||
| 1466 | Ga0207699_10207017 | |||
| 1467 | Ga0207699_10571721 | |||
| 1468 | Ga0207645_10169507 | |||
| 1469 | Ga0207645_10455080 | |||
| 1470 | Ga0207684_10005898 | |||
| 1471 | Ga0207684_10011913 | |||
| 1472 | Ga0207684_10012239 | |||
| 1473 | Ga0207684_10016464 | |||
| 1474 | Ga0207684_10020833 | |||
| 1475 | Ga0207684_10101842 | |||
| 1476 | Ga0207684_10111877 | |||
| 1477 | Ga0207684_10195434 | |||
| 1478 | Ga0207684_10312798 | |||
| 1479 | Ga0207654_10049444 | |||
| 1480 | Ga0207654_10064032 | |||
| 1481 | Ga0207707_10203271 | |||
| 1482 | Ga0207707_10343871 | |||
| 1483 | Ga0207695_10169045 | |||
| 1484 | Ga0207671_10020275 | |||
| 1485 | Ga0207671_10297516 | |||
| 1486 | Ga0207671_10405881 | |||
| 1487 | Ga0207671_10433545 | |||
| 1488 | Ga0207693_10002203 | |||
| 1489 | Ga0207693_10010820 | |||
| 1490 | Ga0207693_10037347 | |||
| 1491 | Ga0207693_10064471 | |||
| 1492 | Ga0207693_10084809 | |||
| 1493 | Ga0207693_10194366 | |||
| 1494 | Ga0207693_10195170 | |||
| 1495 | Ga0207663_10002369 | |||
| 1496 | Ga0207663_10013744 | |||
| 1497 | Ga0207663_10031459 | |||
| 1498 | Ga0207663_10233442 | |||
| 1499 | Ga0207663_11096989 | |||
| 1500 | Ga0207657_10009598 | |||
| 1501 | Ga0207657_10071365 | |||
| 1502 | Ga0207657_10289241 | |||
| 1503 | Ga0207652_10071175 | |||
| 1504 | Ga0207652_10650478 | |||
| 1505 | Ga0207652_10656065 | |||
| 1506 | Ga0207652_11145211 | |||
| 1507 | Ga0207646_10000522 | |||
| 1508 | Ga0207646_10000995 | |||
| 1509 | Ga0207646_10031343 | |||
| 1510 | Ga0207646_10124805 | |||
| 1511 | Ga0207646_10301969 | |||
| 1512 | Ga0207646_10493209 | |||
| 1513 | Ga0207646_10538464 | |||
| 1514 | Ga0207646_10894712 | |||
| 1515 | Ga0207681_10224454 | |||
| 1516 | Ga0207681_10376051 | |||
| 1517 | Ga0207687_10004449 | |||
| 1518 | Ga0207687_10008371 | |||
| 1519 | Ga0207687_10165298 | |||
| 1520 | Ga0207687_10342798 | |||
| 1521 | Ga0207700_10002650 | |||
| 1522 | Ga0207700_10004201 | |||
| 1523 | Ga0207700_10026046 | |||
| 1524 | Ga0207700_10182412 | |||
| 1525 | Ga0207700_10230822 | |||
| 1526 | Ga0207700_10348450 | |||
| 1527 | Ga0207700_10573731 | |||
| 1528 | Ga0207700_10694338 | |||
| 1529 | Ga0207700_10792992 | |||
| 1530 | Ga0207700_11092593 | |||
| 1531 | Ga0207664_10001320 | |||
| 1532 | Ga0207664_10011877 | |||
| 1533 | Ga0207664_10141183 | |||
| 1534 | Ga0207664_10191464 | |||
| 1535 | Ga0207664_10420663 | |||
| 1536 | Ga0207690_10014526 | |||
| 1537 | Ga0207706_10151200 | |||
| 1538 | Ga0207686_10115979 | |||
| 1539 | Ga0207686_10221376 | |||
| 1540 | Ga0207709_10075878 | |||
| 1541 | Ga0207709_10202832 | |||
| 1542 | Ga0207670_10119242 | |||
| 1543 | Ga0207670_10491505 | |||
| 1544 | Ga0207669_10066469 | |||
| 1545 | Ga0207704_10222921 | |||
| 1546 | Ga0207665_10000415 | |||
| 1547 | Ga0207665_10001572 | |||
| 1548 | Ga0207665_10003444 | |||
| 1549 | Ga0207665_10018055 | |||
| 1550 | Ga0207665_10020679 | |||
| 1551 | Ga0207665_10123370 | |||
| 1552 | Ga0207665_10378412 | |||
| 1553 | Ga0207691_10569634 | |||
| 1554 | Ga0207711_10907722 | |||
| 1555 | Ga0207661_10417609 | |||
| 1556 | Ga0207661_10943378 | |||
| 1557 | Ga0207679_10267619 | |||
| 1558 | Ga0207667_10010261 | |||
| 1559 | Ga0207667_10576434 | |||
| 1560 | Ga0207712_10060148 | |||
| 1561 | Ga0207668_10092092 | |||
| 1562 | Ga0207640_10064652 | |||
| 1563 | Ga0207640_10085371 | |||
| 1564 | Ga0207640_10536817 | |||
| 1565 | Ga0207658_10220971 | |||
| 1566 | Ga0207658_10489880 | |||
| 1567 | Ga0207677_10027607 | |||
| 1568 | Ga0207677_11259617 | |||
| 1569 | Ga0207703_10824850 | |||
| 1570 | Ga0207639_10124905 | |||
| 1571 | Ga0207639_10400390 | |||
| 1572 | Ga0207678_10007876 | |||
| 1573 | Ga0207708_10112122 | |||
| 1574 | Ga0207708_10449680 | |||
| 1575 | Ga0207702_10021410 | |||
| 1576 | Ga0207702_10027062 | |||
| 1577 | Ga0207702_10044033 | |||
| 1578 | Ga0207702_10173480 | |||
| 1579 | Ga0207702_10336735 | |||
| 1580 | Ga0207702_10618640 | |||
| 1581 | Ga0207702_11104023 | |||
| 1582 | Ga0207641_10036817 | |||
| 1583 | Ga0207641_10261293 | |||
| 1584 | Ga0207641_10632223 | |||
| 1585 | Ga0207641_10731223 | |||
| 1586 | Ga0207648_10053262 | |||
| 1587 | Ga0207648_10561562 | |||
| 1588 | Ga0207676_10784392 | |||
| 1589 | Ga0207674_10108611 | |||
| 1590 | Ga0207674_10263904 | |||
| 1591 | Ga0207674_10387552 | |||
| 1592 | Ga0207675_100018442 | |||
| 1593 | Ga0207675_100099574 | |||
| 1594 | Ga0207683_10004722 | |||
| 1595 | Ga0207683_10045843 | |||
| 1596 | Ga0207683_10057495 | |||
| 1597 | Ga0207683_10229923 | |||
| 1598 | Ga0207683_10940986 | |||
| 1599 | Ga0207698_10544688 | |||
| 1600 | Ga0209588_1073137 | |||
| 1601 | Ga0207428_10344598 | |||
| 1602 | Ga0268266_10089484 | |||
| 1603 | Ga0268266_10318248 | |||
| 1604 | Ga0268266_10862577 | |||
| 1605 | Ga0268264_10098592 | |||
| 1606 | Ga0268264_11528019 | |||
| 1607 | Ga0265762_1041943 | |||
| 1608 | Ga0265760_10240216 | |||
| 1609 | Ga0316576_10063281 | |||
| 1610 | Ga0307406_10050303 | |||
| 1611 | Ga0307406_11123814 | |||
| 1612 | Ga0307407_10018527 | |||
| 1613 | Ga0307409_100058386 | |||
| 1614 | Ga0307409_101089000 | |||
| 1615 | Ga0307416_100057017 | |||
| 1616 | Ga0307416_100303684 | |||
| 1617 | Ga0307411_10040742 | |||
| 1618 | Ga0373958_0001602 | |||
| 1619 | Ga0373958_0010243 | |||
| 1620 | Ga0373959_0011172 | |||
| 1621 | Ga0373938_0005931 | |||
| 1622 | Ga0373926_0003230 | |||
| 1623 | Ga0373926_0012632 | |||
| 1624 | Ga0373926_0029241 | |||
| 1625 | Ga0373926_0068791 | |||
| 1626 | Ga0373929_0043519 | |||
| 1627 | Ga0373934_0050625 | |||
| 1628 | Ga0373940_0004986 | |||
| 1629 | Ga0373944_0033216 | |||
| 1630 | Ga0373944_0253146 | |||
| 1631 | Ga0373952_0029728 | |||
| 1632 | Ga0373952_0090300 | |||
| 1633 | Ga0373923_0002069 | |||
| 1634 | Ga0373923_0017842 | |||
| 1635 | Ga0373923_0030728 | |||
| 1636 | Ga0373923_0031022 | |||
| 1637 | Ga0373923_0173087 | |||
| 1638 | Ga0373923_0295681 | |||
| 1639 | Ga0373932_0121214 | |||
| 1640 | Ga0373936_0000363 | |||
| 1641 | Ga0373936_0003159 | |||
| 1642 | Ga0373936_0008487 | |||
| 1643 | Ga0373936_0043608 | |||
| 1644 | Ga0373936_0105224 | |||
| 1645 | Ga0373936_0197752 | |||
| 1646 | Ga0373936_0297965 | |||
| 1647 | Ga0373939_0023695 | |||
| 1648 | Ga0373941_0016833 | |||
| 1649 | Ga0373941_0194720 | |||
| 1650 | Ga0373945_0002381 | |||
| 1651 | Ga0373945_0005406 | |||
| 1652 | Ga0373945_0012734 | |||
| 1653 | Ga0373945_0048873 | |||
| 1654 | Ga0373953_0006340 | |||
| 1655 | Ga0373953_0022119 | |||
| 1656 | Ga0373953_0023939 | |||
| 1657 | Ga0373954_0007188 | |||
| 1658 | Ga0373954_0039944 | |||
| 1659 | Ga0373954_0042016 | |||
| 1660 | Ga0373956_0039754 | |||
| 1661 | Ga0373956_0087132 | |||
| 1662 | Ga0373957_0013707 | |||
| 1663 | Ga0373957_0035093 | |||
| 1664 | Ga0373957_0041612 | |||
| 1665 | Ga0373957_0058955 | |||
| 1666 | Ga0373957_0127871 | |||
| 1667 | Ga0373957_0155371 | |||
| 1668 | Ga0373960_0021382 | |||
| 1669 | Ga0373960_0187614 | |||
| 1670 | Ga0373943_0000082 | |||
| 1671 | Ga0373943_0000981 | |||
| 1672 | Ga0373943_0173684 | |||
| 1673 | Ga0373943_0198498 | |||
| 1674 | Ga0373946_0001593 | |||
| 1675 | Ga0373946_0006874 | |||
| 1676 | Ga0373946_0055825 | |||
| 1677 | Ga0373946_0086528 | |||
| 1678 | Ga0373955_0034949 | |||
| 1679 | Ga0373955_0039792 | |||
| 1680 | Ga0373955_0102418 | |||
| 1681 | Ga0373955_0266935 | |||
| 1682 | Ga0373942_0019031 | |||
| 1683 | Ga0373961_0049256 | |||
| 1684 | Ga0316574_0008986 | |||
| 1685 | Ga0373924_0004423 | |||
| 1686 | Ga0373924_0035276 | |||
| 1687 | Ga0373924_0048091 | |||
| 1688 | Ga0373924_0071218 | |||
| 1689 | Ga0373924_0074756 | |||
| 1690 | Ga0373931_0001917 | |||
| 1691 | Ga0373931_0045974 | |||
| 1692 | Ga0373935_0000744 | |||
| 1693 | Ga0373935_0007338 | |||
| 1694 | Ga0373935_0014495 | |||
| 1695 | Ga0373935_0113204 | |||
| 1696 | Ga0373935_0142657 | |||
| 1697 | Ga0373935_0564236 | |||
| 1698 | Ga0373927_0000670 | |||
| 1699 | Ga0373927_0006924 | |||
| 1700 | Ga0373927_0017377 | |||
| 1701 | Ga0373927_0837514 | |||
| 1702 | Ga0373933_0004220 | |||
| 1703 | Ga0373933_0038743 | |||
| 1704 | Ga0373933_0194235 | |||
| 1705 | Ga0373933_0326309 | |||
| 1706 | Ga0373947_0000619 | |||
| 1707 | Ga0373947_0001676 | |||
| 1708 | Ga0373947_0029323 | |||
| 1709 | Ga0373947_0097291 | |||
| 1710 | Ga0373947_0135282 | |||
| 1711 | Ga0373947_0200024 | |||
| 1712 | Ga0373947_0245605 | |||
| 1713 | Ga0373947_0364382 | |||
| 1714 | Ga0373947_0373150 | |||
| 1715 | Ga0373947_0700188 | |||
| 1716 | Ga0373937_0012653 | |||
| 1717 | Ga0373937_0084779 | |||
| 1718 | Ga0373937_0226011 | |||
| 1719 | Ga0373937_0232446 | |||
| 1720 | Ga0373937_0379458 | |||
| 1721 | Ga0373937_0420458 | |||
| 1722 | Ga0373937_0463455 | |||
| 1723 | Ga0316582_0575986 | |||
| 1724 | Ga0373925_0000013 | |||
| 1725 | Ga0373925_0002887 | |||
| 1726 | Ga0373925_0005796 | |||
| 1727 | Ga0373925_0023433 | |||
| 1728 | Ga0373925_0069601 | |||
| 1729 | Ga0373925_0171052 | |||
| 1730 | Ga0373925_0357664 | |||
| 1731 | Ga0373925_0964489 | |||
| 1732 | Ga0395898_0007269 | |||
| 1733 | Ga0395905_0018704 | |||
| 1734 | Ga0436364_0590257 | |||
| 1735 | Ga0436364_0794523 | |||
| 1736 | Ga0436364_1101267 | |||
| 1737 | Ga0395901_0024963 | |||
| 1738 | Ga0436362_1213167 | |||
| 1739 | Ga0451841_0503580 | |||
| 1740 | Ga0439455_0136410 | |||
| 1741 | Ga0466963_0025233 | |||
| 1742 | Ga0466970_0157384 | |||
| 1743 | Ga0466958_0169034 | |||
| 1744 | Ga0466958_0188393 | |||
| 1745 | Ga0466967_0213298 | |||
| 1746 | Ga0466967_0227616 | |||
| 1747 | Ga0466967_0920227 | |||
| 1748 | Ga0495592_0010608 | |||
| 1749 | Ga0495592_0015367 | |||
| 1750 | Ga0495592_0016899 | |||
| 1751 | Ga0495592_0075392 | |||
| 1752 | Ga0495592_0400554 | |||
| 1753 | Ga0495603_0032365 | |||
| 1754 | Ga0495603_0129101 | |||
| 1755 | Ga0495590_0045509 | |||
| 1756 | Ga0495629_0008537 | |||
| 1757 | Ga0495629_0010816 | |||
| 1758 | Ga0495629_0023045 | |||
| 1759 | Ga0495629_0081240 | |||
| 1760 | Ga0495629_0274512 | |||
| 1761 | Ga0495641_0002945 | |||
| 1762 | Ga0495641_0006657 | |||
| 1763 | Ga0495641_0010459 | |||
| 1764 | Ga0495641_0041485 | |||
| 1765 | Ga0495651_0004872 | |||
| 1766 | Ga0495651_0044093 | |||
| 1767 | Ga0495651_0086420 | |||
| 1768 | Ga0495651_0117212 | |||
| 1769 | Ga0495651_0130097 | |||
| 1770 | Ga0495651_0632086 | |||
| 1771 | Ga0495653_0002769 | |||
| 1772 | Ga0495653_0003629 | |||
| 1773 | Ga0495653_0016193 | |||
| 1774 | Ga0495653_0025855 | |||
| 1775 | Ga0495653_0057897 | |||
| 1776 | Ga0495653_0059658 | |||
| 1777 | Ga0495653_0060419 | |||
| 1778 | Ga0495653_0260945 | |||
| 1779 | Ga0495580_0013042 | |||
| 1780 | Ga0495580_0014128 | |||
| 1781 | Ga0495580_0098039 | |||
| 1782 | Ga0495582_0005354 | |||
| 1783 | Ga0495582_0049272 | |||
| 1784 | Ga0495582_0121891 | |||
| 1785 | Ga0495639_0005141 | |||
| 1786 | Ga0495639_0005478 | |||
| 1787 | Ga0495639_0170734 | |||
| 1788 | Ga0495639_0240850 | |||
| 1789 | Ga0495639_0245420 | |||
| 1790 | Ga0495662_0000412 | |||
| 1791 | Ga0495662_0002937 | |||
| 1792 | Ga0495662_0009808 | |||
| 1793 | Ga0495662_0018085 | |||
| 1794 | Ga0495662_0022911 | |||
| 1795 | Ga0495664_0001165 | |||
| 1796 | Ga0495664_0001890 | |||
| 1797 | Ga0495664_0003573 | |||
| 1798 | Ga0495664_0060626 | |||
| 1799 | Ga0495664_0068057 | |||
| 1800 | Ga0495664_0087897 | |||
| 1801 | Ga0495664_0166000 | |||
| 1802 | Ga0495664_0293088 | |||
| 1803 | Ga0495664_0352053 | |||
| 1804 | Ga0495664_0520289 | |||
| 1805 | Ga0495594_0007359 | |||
| 1806 | Ga0495594_0058770 | |||
| 1807 | Ga0495594_0079479 | |||
| 1808 | Ga0495594_0466578 | |||
| 1809 | Ga0495608_0002056 | |||
| 1810 | Ga0495608_0005716 | |||
| 1811 | Ga0495608_0007465 | |||
| 1812 | Ga0495608_0023494 | |||
| 1813 | Ga0495608_0032890 | |||
| 1814 | Ga0495608_0078230 | |||
| 1815 | Ga0495608_0089581 | |||
| 1816 | Ga0495608_0146801 | |||
| 1817 | Ga0495608_0513621 | |||
| 1818 | Ga0495618_0002753 | |||
| 1819 | Ga0495618_0034684 | |||
| 1820 | Ga0495618_0071970 | |||
| 1821 | Ga0495618_0078659 | |||
| 1822 | Ga0495618_0215514 | |||
| 1823 | Ga0495620_0002530 | |||
| 1824 | Ga0495628_0006341 | |||
| 1825 | Ga0495628_0023189 | |||
| 1826 | Ga0495628_0273997 | |||
| 1827 | Ga0495628_0364092 | |||
| 1828 | Ga0495628_0398039 | |||
| 1829 | Ga0495628_0416432 | |||
| 1830 | Ga0495628_0419460 | |||
| 1831 | Ga0495630_0041245 | |||
| 1832 | Ga0495630_0131022 | |||
| 1833 | Ga0495630_0247316 | |||
| 1834 | Ga0495630_0278247 | |||
| 1835 | Ga0495630_0792064 | |||
| 1836 | Ga0495643_0004928 | |||
| 1837 | Ga0495648_0001739 | |||
| 1838 | Ga0495648_0061056 | |||
| 1839 | Ga0495666_0047271 | |||
| 1840 | Ga0495666_0257422 | |||
| 1841 | Ga0495642_0091215 | |||
| 1842 | Ga0495652_0010636 | |||
| 1843 | Ga0495652_0029759 | |||
| 1844 | Ga0495652_0068948 | |||
| 1845 | Ga0495652_0142687 | |||
| 1846 | Ga0495652_0243480 | |||
| 1847 | Ga0495652_0306394 | |||
| 1848 | Ga0495652_0636827 | |||
| 1849 | Ga0495654_0027042 | |||
| 1850 | Ga0495665_0000527 | |||
| 1851 | Ga0495665_0001636 | |||
| 1852 | Ga0495665_0005757 | |||
| 1853 | Ga0495665_0027374 | |||
| 1854 | Ga0495665_0195361 | |||
| 1855 | Ga0495640_0017096 | |||
| 1856 | Ga0495640_0022869 | |||
| 1857 | Ga0495640_0029267 | |||
| 1858 | Ga0495640_0045341 | |||
| 1859 | Ga0495640_0059035 | |||
| 1860 | Ga0495640_0177384 | |||
| 1861 | Ga0495586_0003401 | |||
| 1862 | Ga0495586_0004628 | |||
| 1863 | Ga0495586_0036463 | |||
| 1864 | Ga0495587_0017623 | |||
| 1865 | Ga0495587_0055131 | |||
| 1866 | Ga0495587_0067454 | |||
| 1867 | Ga0495587_0091792 | |||
| 1868 | Ga0495587_0163884 | |||
| 1869 | Ga0495587_0365195 | |||
| 1870 | Ga0495597_0004001 | |||
| 1871 | Ga0495645_0008911 | |||
| 1872 | Ga0495645_0013185 | |||
| 1873 | Ga0495645_0120487 | |||
| 1874 | Ga0495645_0170280 | |||
| 1875 | Ga0495667_0001822 | |||
| 1876 | Ga0495667_0007970 | |||
| 1877 | Ga0495667_0008462 | |||
| 1878 | Ga0495667_0015884 | |||
| 1879 | Ga0495667_0017050 | |||
| 1880 | Ga0495667_0028615 | |||
| 1881 | Ga0495667_0062294 | |||
| 1882 | Ga0495667_0064921 | |||
| 1883 | Ga0495668_0016829 | |||
| 1884 | Ga0495634_0004848 | |||
| 1885 | Ga0495634_0011711 | |||
| 1886 | Ga0495634_0014802 | |||
| 1887 | Ga0495634_0024908 | |||
| 1888 | Ga0495634_0026269 | |||
| 1889 | Ga0495634_0027695 | |||
| 1890 | Ga0495634_0121002 | |||
| 1891 | Ga0495611_0118508 | |||
| 1892 | Ga0495611_0247982 | |||
| 1893 | Ga0495635_0002095 | |||
| 1894 | Ga0495635_0013993 | |||
| 1895 | Ga0495635_0029852 | |||
| 1896 | Ga0495635_0032664 | |||
| 1897 | Ga0495635_0163094 | |||
| 1898 | Ga0495635_0180065 | |||
| 1899 | Ga0495635_0271088 | |||
| 1900 | Ga0495588_0002905 | |||
| 1901 | Ga0495588_0032267 | |||
| 1902 | Ga0495588_0152399 | |||
| 1903 | Ga0495657_0005225 | |||
| 1904 | Ga0495657_0018927 | |||
| 1905 | Ga0495657_0020071 | |||
| 1906 | Ga0495657_0027035 | |||
| 1907 | Ga0495657_0035016 | |||
| 1908 | Ga0495657_0040974 | |||
| 1909 | Ga0495599_0006865 | |||
| 1910 | Ga0495599_0009805 | |||
| 1911 | Ga0495599_0013955 | |||
| 1912 | Ga0495599_0027472 | |||
| 1913 | Ga0495599_0030594 | |||
| 1914 | Ga0495599_0049813 | |||
| 1915 | Ga0495599_0316745 | |||
| 1916 | Ga0495623_0031543 | |||
| 1917 | Ga0495623_0106721 | |||
| 1918 | Ga0495623_0282193 | |||
| 1919 | Ga0495623_0327516 | |||
| 1920 | Ga0495646_0004953 | |||
| 1921 | Ga0495646_0025844 | |||
| 1922 | Ga0495646_0030429 | |||
| 1923 | Ga0495647_0081811 | |||
| 1924 | Ga0495658_0003617 | |||
| 1925 | Ga0495658_0015647 | |||
| 1926 | Ga0495658_0069621 | |||
| 1927 | Ga0495658_0194716 | |||
| 1928 | Ga0495613_0004498 | |||
| 1929 | Ga0495613_0075223 | |||
| 1930 | Ga0495613_0093465 | |||
| 1931 | Ga0495613_0182824 | |||
| 1932 | Ga0495624_0008035 | |||
| 1933 | Ga0495624_0009276 | |||
| 1934 | Ga0495624_0011078 | |||
| 1935 | Ga0495624_0019615 | |||
| 1936 | Ga0495624_0145528 | |||
| 1937 | Ga0495671_0032908 | |||
| 1938 | Ga0495649_0037901 | |||
| 1939 | Ga0495589_0021643 | |||
| 1940 | Ga0495600_0004205 | |||
| 1941 | Ga0495600_0006618 | |||
| 1942 | Ga0495600_0031204 | |||
| 1943 | Ga0495600_0037979 | |||
| 1944 | Ga0495600_0053541 | |||
| 1945 | Ga0495600_0066381 | |||
| 1946 | Ga0495600_0138596 | |||
| 1947 | Ga0495600_0264666 | |||
| 1948 | Ga0495660_0023101 | |||
| 1949 | Ga0495581_0003802 | |||
| 1950 | Ga0495581_0005975 | |||
| 1951 | Ga0495581_0008002 | |||
| 1952 | Ga0495581_0010149 | |||
| 1953 | Ga0495581_0010625 | |||
| 1954 | Ga0495581_0247020 | |||
| 1955 | Ga0495581_0643928 | |||
| 1956 | Ga0495581_0696696 | |||
| 1957 | Ga0495604_0028129 | |||
| 1958 | Ga0495604_0033329 | |||
| 1959 | Ga0495604_0044165 | |||
| 1960 | Ga0495604_0107403 | |||
| 1961 | Ga0495604_0141785 | |||
| 1962 | Ga0495604_0305923 | |||
| 1963 | Ga0495674_0001939 | |||
| 1964 | Ga0495674_0005954 | |||
| 1965 | Ga0495674_0039427 | |||
| 1966 | Ga0495674_0047011 | |||
| 1967 | Ga0495674_0083509 | |||
| 1968 | Ga0495674_0240067 | |||
| 1969 | Ga0495674_0305147 | |||
| 1970 | Ga0495674_0398944 | |||
| 1971 | Ga0495674_0412763 | |||
| 1972 | Ga0495674_0580662 | |||
| 1973 | Ga0495674_0977222 | |||
| 1974 | Ga0495672_0001084 | |||
| 1975 | Ga0495676_0014233 | |||
| 1976 | Ga0495676_0029722 | |||
| 1977 | Ga0495676_0032348 | |||
| 1978 | Ga0495676_0104921 | |||
| 1979 | Ga0495676_0432874 | |||
| 1980 | Ga0495680_0004959 | |||
| 1981 | Ga0495680_0040720 | |||
| 1982 | Ga0495680_0045281 | |||
| 1983 | Ga0495680_0052221 | |||
| 1984 | Ga0495680_0087409 | |||
| 1985 | Ga0495680_0129634 | |||
| 1986 | Ga0495680_0305774 | |||
| 1987 | Ga0495680_0486686 | |||
| 1988 | Ga0495683_0073618 | |||
| 1989 | Ga0495687_017124 | |||
| 1990 | Ga0495675_0017646 | |||
| 1991 | Ga0495675_0018849 | |||
| 1992 | Ga0495675_0031676 | |||
| 1993 | Ga0495675_0063827 | |||
| 1994 | Ga0495675_0121648 | |||
| 1995 | Ga0495675_0187677 | |||
| 1996 | Ga0495675_0205479 | |||
| 1997 | Ga0495677_0011039 | |||
| 1998 | Ga0495677_0049407 | |||
| 1999 | Ga0495673_0001554 | |||
| 2000 | Ga0495684_0001710 | |||
| 2001 | Ga0495684_0001792 | |||
| 2002 | Ga0495684_0009255 | |||
| 2003 | Ga0495684_0015690 | |||
| 2004 | Ga0495684_0061160 | |||
| 2005 | Ga0495684_0088808 | |||
| 2006 | Ga0495684_0244909 | |||
| 2007 | Ga0495593_0002686 | |||
| 2008 | Ga0495593_0003268 | |||
| 2009 | Ga0495593_0032155 | |||
| 2010 | Ga0495593_0061312 | |||
| 2011 | Ga0495602_0042823 | |||
| 2012 | Ga0495602_0049682 | |||
| 2013 | Ga0495602_0071308 | |||
| 2014 | Ga0495602_0073794 | |||
| 2015 | Ga0495602_0131359 | |||
| 2016 | Ga0495602_0616566 | |||
| 2017 | Ga0495614_0001922 | |||
| 2018 | Ga0495614_0018578 | |||
| 2019 | Ga0495614_0018654 | |||
| 2020 | Ga0496100_0031222 | |||
| 2021 | Ga0496100_0042032 | |||
| 2022 | Ga0496100_0055391 | |||
| 2023 | Ga0496100_0146155 | |||
| 2024 | Ga0496100_0901097 | |||
| 2025 | Ga0496100_1293289 | |||
| 2026 | Ga0496101_0007400 | |||
| 2027 | Ga0496101_0009428 | |||
| 2028 | Ga0496101_0016606 | |||
| 2029 | Ga0496101_0027452 | |||
| 2030 | Ga0496101_0078509 | |||
| 2031 | Ga0496102_0002361 | |||
| 2032 | Ga0496102_0059619 | |||
| 2033 | Ga0496102_0063830 | |||
| 2034 | Ga0496102_0314893 | |||
| 2035 | Ga0496102_0340472 | |||
| 2036 | Ga0496103_0000900 | |||
| 2037 | Ga0496103_0021988 | |||
| 2038 | Ga0496103_0060001 | |||
| 2039 | Ga0496103_0494979 | |||
| 2040 | Ga0496103_0597210 | |||
| 2041 | Ga0496104_0052222 | |||
| 2042 | Ga0496104_0127458 | |||
| 2043 | Ga0496104_0786087 | |||
| 2044 | Ga0496105_0131535 | |||
| 2045 | Ga0496105_0142488 | |||
| 2046 | Ga0496105_0535885 | |||
| 2047 | Ga0496106_0008276 | |||
| 2048 | Ga0496106_0014311 | |||
| 2049 | Ga0496106_0017839 | |||
| 2050 | Ga0496106_0197799 | |||
| 2051 | Ga0496106_0222264 | |||
| 2052 | Ga0496107_0031543 | |||
| 2053 | Ga0496107_0041358 | |||
| 2054 | Ga0496107_0042154 | |||
| 2055 | Ga0496107_0087504 | |||
| 2056 | Ga0496107_0459552 | |||
| 2057 | Ga0496108_0001177 | |||
| 2058 | Ga0496108_0005259 | |||
| 2059 | Ga0496108_0037682 | |||
| 2060 | Ga0496109_0000999 | |||
| 2061 | Ga0496109_0004046 | |||
| 2062 | Ga0496109_0016077 | |||
| 2063 | Ga0496109_0598665 | |||
| 2064 | Ga0496110_0001024 | |||
| 2065 | Ga0496110_0027396 | |||
| 2066 | Ga0496110_0054339 | |||
| 2067 | Ga0496110_0112353 | |||
| 2068 | Ga0496110_0605308 | |||
| 2069 | Ga0496111_0000822 | |||
| 2070 | Ga0496111_0031219 | |||
| 2071 | Ga0496111_0350133 | |||
| 2072 | Ga0496112_0005524 | |||
| 2073 | Ga0496112_0025280 | |||
| 2074 | Ga0496112_0077765 | |||
| 2075 | Ga0496112_0286452 | |||
| 2076 | Ga0496112_0964220 | |||
| 2077 | Ga0496112_1208963 | |||
| 2078 | Ga0496113_0026268 | |||
| 2079 | Ga0496113_0200431 | |||
| 2080 | Ga0496113_1039547 | |||
| 2081 | Ga0496114_0012826 | |||
| 2082 | Ga0496114_0052454 | |||
| 2083 | Ga0496114_0287010 | |||
| 2084 | Ga0496114_0405272 | |||
| 2085 | Ga0496115_0011617 | |||
| 2086 | Ga0496115_0215929 | |||
| 2087 | Ga0496115_0241103 | |||
| 2088 | Ga0496115_0251814 | |||
| 2089 | Ga0496115_0481314 | |||
| 2090 | Ga0496115_0740418 | |||
| 2091 | Ga0496126_0018870 | |||
| 2092 | Ga0501032_0040837 | |||
| 2093 | Ga0501034_1338215 | |||
| 2094 | Ga0501038_0014496 | |||
| 2095 | Ga0501038_0226986 | |||
| 2096 | Ga0501040_0116215 | |||
| 2097 | Ga0501042_0145193 | |||
| 2098 | Ga0501047_0070677 | |||
| 2099 | Ga0501048_0016245 | |||
| 2100 | Ga0501076_0065560 | |||
| 2101 | Ga0501077_0066460 | |||
| 2102 | Ga0501079_0091892 | |||
| 2103 | Ga0501079_0965205 | |||
| 2104 | Ga0501080_0227225 | |||
| 2105 | Ga0501081_0168560 | |||
| 2106 | Ga0501035_0021515 | |||
| 2107 | Ga0501044_0133704 | |||
| 2108 | nmdc:mga07m45_38484_c1 | |||
| 2109 | nmdc:mga05p37_1162329_c1 | |||
| 2110 | nmdc:mga05p37_19328_c1 | |||
| 2111 | nmdc:mga05p37_78124_c1 | |||
| 2112 | nmdc:mga09592_198152_c1 | |||
| 2113 | nmdc:mga09592_451649_c1 | |||
| 2114 | nmdc:mga06r32_361007_c1 | |||
| 2115 | nmdc:mga06r32_517088_c1 | |||
| 2116 | nmdc:mga06r32_913693_c1 | |||
| 2117 | nmdc:mga0n895_1090152_c1 | |||
| 2118 | nmdc:mga0n895_64166_c1 | |||
| 2119 | nmdc:mga0n895_76922_c1 | |||
| 2120 | nmdc:mga0n895_80677_c1 | |||
| 2121 | nmdc:mga0rr50_289793_c1 | |||
| 2122 | nmdc:mga0rr50_376532_c1 | |||
| 2123 | nmdc:mga0rr50_42045_c1 | |||
| 2124 | nmdc:mga0rr50_650450_c1 | |||
| 2125 | nmdc:mga0rr50_901_c1 | |||
| 2126 | nmdc:mga0rr50_90468_c1 | |||
| 2127 | nmdc:mga08x19_21480_c1 | |||
| 2128 | nmdc:mga08x19_555077_c1 | |||
| 2129 | nmdc:mga08x19_620743_c1 | |||
| 2130 | nmdc:mga08x19_66942_c1 | |||
| 2131 | nmdc:mga08x19_743781_c1 | |||
| 2132 | nmdc:mga08x19_92046_c1 | |||
| 2133 | nmdc:mga0a205_147319_c1 | |||
| 2134 | Ga0495601_0023284 | |||
| 2135 | Ga0495601_0031070 | |||
| 2136 | Ga0495601_0046115 | |||
| 2137 | Ga0495601_0050486 | |||
| 2138 | Ga0495612_0003397 | |||
| 2139 | Ga0495612_0012345 | |||
| 2140 | Ga0495612_0016147 | |||
| 2141 | Ga0495612_0189731 | |||
| 2142 | Ga0495595_0003315 | |||
| 2143 | Ga0495595_0006299 | |||
| 2144 | Ga0495595_0035229 | |||
| 2145 | Ga0495595_0052398 | |||
| 2146 | Ga0495619_0014137 | |||
| 2147 | Ga0495619_0022070 | |||
| 2148 | Ga0495619_0188481 | |||
| 2149 | Ga0495619_0575481 | |||
| 2150 | Ga0495619_0661282 | |||
| 2151 | Ga0501082_0114752 | |||
| 2152 | 2616698833 | |||
| 2153 | 2776372014 | |||
| 2154 | 2863072744 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9264 | 1 | 153 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9251 | 1 | 153 |
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.9226 | 2 | 152 |
| 5y6q-assembly1.cif.gz_A | crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 | 0.9206 | 1 | 153 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9195 | 1 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9217 | 1 | 75 | 3.10.20.30 |
| 1ffuD02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9074 | 78 | 152 | 1.10.150.120 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9074 | 77 | 152 | 1.10.150.120 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9023 | 1 | 75 | 3.10.20.30 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8956 | 1 | 73 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B0AH17-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9488 | 1 | 154 |
GO:0016491
GO:0046872 GO:0051536 GO:0071949 |
| AF-A0A3D0D3K8-F1-model_v4 | (2Fe-2S)-binding protein | 0.9454 | 1 | 153 |
GO:0016020
GO:0016491 GO:0046872 GO:0051537 |
| AF-A0A3P4AWJ2-F1-model_v4 | Nicotinate dehydrogenase subunit A (EC 1.17.2.1) | 0.9454 | 1 | 154 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A3D0D829-F1-model_v4 | (2Fe-2S)-binding protein | 0.9444 | 1 | 150 |
GO:0016020
GO:0016491 GO:0046872 GO:0051537 |
| AF-F0J567-F1-model_v4 | Oxidoreductase iron-sulfur binding subunit | 0.9437 | 1 | 153 |
GO:0016491
GO:0046872 GO:0051537 |