F489382

General Info

Members Datasets Scaffolds Average Seq Length
1065 412 876 293

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0000166|Ga0495607_0000166_5014_6039
Length 341
Sequence MTSAPLAGLRPLEHARSLDLRGHIGDNAKNVMLSHVSSSCLAPAMKRLPPLPALHTFLITARCCNFTRAAQLLHITQGAVSRQISGLESHLGYRLFHRQARGLSLTAQGRAFFPRIEQIFSLLEDAVDEVGTARQALQLKAPTCITRWLLPRLMQWQKERPDVPVELTTTIAHGVDFRRERFDAAVVYGAHPGDSMNVHHLFDEQLTPVCSRSLIGESQPLAQYSDLERHMLLHPTLDEQDWTQWLKAAGTRLSNVGKGQHFDTMDLAMTVASQGSGVAMGDWALIGEDLSAGRLVTPFELKLRTGAAYYFVYPERATVPAQLNELLDWLKTQAAQRQIAH

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
22 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
23 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
24 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
25 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
26 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
27 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
28 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
29 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
30 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
31 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
32 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
33 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
34 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
35 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
36 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
37 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
38 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
39 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
40 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
41 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
42 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
43 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
44 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
45 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
46 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
47 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
48 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
49 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
50 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
51 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
52 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
53 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
54 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
55 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
56 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
57 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
58 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
59 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
60 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
61 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
62 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
63 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
64 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
65 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
66 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
67 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
68 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
69 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
70 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
71 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
72 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
73 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
74 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
75 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
76 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
77 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
78 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
79 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
80 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
81 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
82 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
83 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
84 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
85 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
86 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
87 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
88 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
89 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
90 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
91 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
92 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
93 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
94 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
95 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
96 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
97 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
98 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
99 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
100 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
101 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
102 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
103 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
104 2765235841 Pseudomonas putida AA7 Isolate Unclassified
105 2773857670 Pseudomonas sp. 478 Isolate Unclassified
106 2773857673 Pseudomonas sp. 443 Isolate Unclassified
107 2784132063 Pseudomonas sp. 424 Isolate Unclassified
108 2784132072 Pseudomonas sp. 460 Isolate Unclassified
109 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
110 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
111 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
112 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
113 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
114 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
115 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
116 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
117 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
118 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
119 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
120 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
121 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
122 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
123 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
124 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
125 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
126 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
127 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
128 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
129 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
130 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
131 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
132 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
133 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
134 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
135 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
136 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
137 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
138 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
139 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
140 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
141 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
142 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
143 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
144 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
145 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
146 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
147 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
148 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
149 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
150 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
151 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
152 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
153 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
154 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
155 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
156 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
157 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
158 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
159 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
160 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
161 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
162 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
163 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
164 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
165 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
166 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
167 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
168 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
169 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
170 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
171 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
172 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
173 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
174 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
175 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
176 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
177 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
178 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
179 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
180 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
181 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
182 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
183 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
184 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
185 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
186 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
187 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
188 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
189 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
190 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
191 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
192 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
193 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
194 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
195 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
196 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
197 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
198 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
199 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
200 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
201 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
202 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
203 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
204 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
205 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
206 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
207 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
208 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
209 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
210 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
212 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
213 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
214 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
215 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
230 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
231 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
232 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
236 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
237 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
238 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
251 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
252 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
253 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
254 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
255 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
256 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
257 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
258 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
259 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
260 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
261 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
262 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
263 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
264 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
265 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
266 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
267 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
268 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
269 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
270 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
271 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
272 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
273 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
274 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
275 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
276 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
279 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
280 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
281 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
285 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
302 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
303 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
307 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
308 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
311 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
312 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
313 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
314 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
315 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
328 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
329 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
330 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
333 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
336 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
337 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
342 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
343 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
344 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
345 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
346 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
350 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
351 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
352 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
353 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
354 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
355 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
356 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
359 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
360 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
361 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
362 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
363 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
364 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
376 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
379 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
380 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
384 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
385 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
386 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
389 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
390 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
391 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
392 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
393 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
394 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
395 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
396 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
397 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
398 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
399 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
400 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
401 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
402 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
403 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
404 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
405 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
406 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
407 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
408 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
409 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
410 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
411 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
412 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.25
Metatranscriptomes 0
Isolates 17.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 2.54
Rhizoplane 6.01
Rhizosphere 76.62
Stem 0
Stem Tuber 0
Unclassified 10.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_5569 2124908027 Bacteria 2432
2 MRS2a_Contig_68 2124908027 Bacteria 28070
3 MRS2a_Contig_7842 2124908027 Bacteria 2286
4 MRS2a_Contig_9059 2124908027 Bacteria 2873
5 SwRhRL2b_contig_3176154 2162886007 Bacteria 1716
6 JGI25162J39368_1000297 3300002737 Bacteria 45689
7 JGI25163J39215_1000602 3300002771 Bacteria 9997
8 JGI25163J39215_1000696 3300002771 Bacteria 8835
9 JGI25164J39214_1000254 3300002772 Bacteria 40149
10 JGI25164J39214_1000482 3300002772 Bacteria 19688
11 JGI25165J46597_1000403 3300003214 Bacteria 45689
12 JGI25165J46597_1000465 3300003214 Bacteria 40032
13 Ga0055536_1000295 3300003781 Bacteria 37444
14 Ga0055530_10000047 3300003791 Bacteria 108305
15 Ga0055530_10000433 3300003791 Bacteria 37159
16 Ga0055530_10000783 3300003791 Bacteria 26486
17 Ga0055540_1000083 3300003792 Bacteria 108305
18 Ga0055540_1000309 3300003792 Bacteria 43275
19 Ga0055540_1001345 3300003792 Bacteria 14798
20 Ga0055531_10000113 3300003794 Bacteria 88757
21 Ga0055531_10000306 3300003794 Bacteria 48429
22 Ga0065714_10008045 3300005288 Bacteria 3015
23 Ga0065714_10067507 3300005288 Bacteria 5427
24 Ga0065714_10138192 3300005288 Bacteria 1185
25 Ga0065704_10079756 3300005289 Bacteria 4088
26 Ga0065712_10009601 3300005290 Bacteria 3395
27 Ga0070661_100000060 3300005344 Bacteria 86915
28 Ga0070669_100034870 3300005353 Bacteria 3643
29 Ga0070664_100000139 3300005564 Bacteria 49134
30 Ga0075364_10242873 3300006051 Bacteria 1223
31 Ga0075432_10000292 3300006058 Bacteria 13961
32 Ga0075432_10009006 3300006058 Bacteria 3403
33 Ga0075432_10011321 3300006058 Bacteria 3031
34 Ga0075432_10030466 3300006058 Bacteria 1864
35 Ga0079104_1000168 3300006946 Bacteria 93546
36 Ga0079104_1000349 3300006946 Bacteria 55547
37 Ga0079104_1009472 3300006946 Bacteria 3295
38 Ga0099826_10011991 3300006948 Bacteria 6530
39 Ga0105251_10000004 3300009011 Bacteria 285212
40 Ga0105251_10003324 3300009011 Bacteria 11741
41 Ga0105251_10004540 3300009011 Bacteria 9414
42 Ga0105251_10010592 3300009011 Bacteria 5333
43 Ga0105251_10062627 3300009011 Bacteria 1746
44 Ga0105244_10001072 3300009036 Bacteria 22803
45 Ga0105244_10028014 3300009036 Bacteria 3027
46 Ga0105244_10044200 3300009036 Bacteria 2295
47 Ga0105244_10071615 3300009036 Bacteria 1728
48 Ga0105244_10072980 3300009036 Bacteria 1709
49 Ga0105244_10159853 3300009036 Bacteria 1076
50 Ga0105250_10000254 3300009092 Bacteria 44259
51 Ga0105250_10000532 3300009092 Bacteria 26371
52 Ga0105250_10001755 3300009092 Bacteria 11420
53 Ga0105250_10002082 3300009092 Bacteria 10262
54 Ga0105243_10000383 3300009148 Bacteria 47537
55 Ga0105243_10000873 3300009148 Bacteria 28501
56 Ga0105243_10014168 3300009148 Bacteria 6033
57 Ga0105243_10278911 3300009148 Bacteria 1504
58 Ga0105243_10529485 3300009148 Bacteria 1122
59 Ga0105242_10000809 3300009176 Bacteria 24265
60 Ga0105237_10000640 3300009545 Bacteria 48895
61 Ga0105249_10361374 3300009553 Bacteria 1473
62 Ga0105246_10000366 3300011119 Bacteria 24276
63 Ga0105246_10097837 3300011119 Bacteria 2130
64 Ga0157345_1000101 3300012498 Bacteria 17009
65 Ga0157373_10006083 3300013100 Bacteria 9023
66 Ga0157373_10008006 3300013100 Bacteria 7859
67 Ga0157373_10056785 3300013100 Bacteria 2778
68 Ga0157373_10063789 3300013100 Bacteria 2608
69 Ga0157373_10133854 3300013100 Bacteria 1743
70 Ga0157371_10000101 3300013102 Bacteria 129981
71 Ga0157371_10002072 3300013102 Bacteria 19643
72 Ga0157371_10002419 3300013102 Bacteria 17859
73 Ga0157371_10003573 3300013102 Bacteria 14020
74 Ga0157370_10042214 3300013104 Bacteria 4396
75 Ga0157370_10141550 3300013104 Bacteria 2241
76 Ga0157370_10294286 3300013104 Bacteria 1499
77 Ga0157370_10366529 3300013104 Bacteria 1328
78 Ga0157370_10400923 3300013104 Bacteria 1263
79 Ga0157369_10000562 3300013105 Bacteria 48790
80 Ga0157369_10484115 3300013105 Bacteria 1280
81 Ga0163162_10000620 3300013306 Bacteria 32915
82 Ga0163162_10222543 3300013306 Bacteria 2017
83 Ga0163162_10246026 3300013306 Bacteria 1920
84 Ga0157372_10003234 3300013307 Bacteria 17602
85 Ga0157375_10121151 3300013308 Bacteria 2725
86 Ga0157375_10341375 3300013308 Bacteria 1663
87 Ga0182008_10000997 3300014497 Bacteria 19682
88 Ga0182008_10003736 3300014497 Bacteria 9069
89 Ga0182008_10009472 3300014497 Bacteria 5254
90 Ga0182008_10017920 3300014497 Bacteria 3669
91 Ga0182008_10034910 3300014497 Bacteria 2520
92 Ga0182006_1001170 3300015261 Bacteria 16538
93 Ga0182006_1011627 3300015261 Bacteria 3868
94 Ga0182006_1016494 3300015261 Bacteria 3150
95 Ga0182006_1019515 3300015261 Bacteria 2853
96 Ga0182006_1023137 3300015261 Bacteria 2575
97 Ga0182006_1030244 3300015261 Bacteria 2189
98 Ga0182006_1107483 3300015261 Bacteria 982
99 Ga0182007_10007005 3300015262 Bacteria 4782
100 Ga0182007_10015848 3300015262 Bacteria 2797
101 Ga0182005_1011690 3300015265 Bacteria 2497
102 Ga0163161_10008306 3300017792 Bacteria 7188
103 Ga0163161_10060948 3300017792 Bacteria 2747
104 Ga0209760_100132 3300025207 Bacteria 49134
105 Ga0209760_100172 3300025207 Bacteria 35933
106 Ga0209563_100410 3300025230 Bacteria 15121
107 Ga0207427_100004 3300025231 Bacteria 939600
108 Ga0207427_100007 3300025231 Bacteria 746220
109 Ga0209437_100006 3300025233 Bacteria 1042724
110 Ga0209437_100028 3300025233 Bacteria 540136
111 Ga0209759_1002314 3300025256 Bacteria 8557
112 Ga0209233_1000008 3300025261 Bacteria 1356712
113 Ga0209233_1000059 3300025261 Bacteria 414562
114 Ga0209675_1004616 3300025291 Bacteria 6059
115 Ga0209676_1000006 3300025292 Bacteria 1039588
116 Ga0209676_1000010 3300025292 Bacteria 954025
117 Ga0209676_1000834 3300025292 Bacteria 39941
118 Ga0209676_1006865 3300025292 Bacteria 5510
119 Ga0209050_1000019 3300025298 Bacteria 608757
120 Ga0209050_1000027 3300025298 Bacteria 483261
121 Ga0209050_1000065 3300025298 Bacteria 313668
122 Ga0209050_1000792 3300025298 Bacteria 44888
123 Ga0209051_1000065 3300025303 Bacteria 231445
124 Ga0209051_1000138 3300025303 Bacteria 137073
125 Ga0209051_1000189 3300025303 Bacteria 109144
126 Ga0209257_1000405 3300025304 Bacteria 83871
127 Ga0209257_1008055 3300025304 Bacteria 6134
128 Ga0207696_1000044 3300025711 Bacteria 300953
129 Ga0207696_1000063 3300025711 Bacteria 239123
130 Ga0207696_1000073 3300025711 Bacteria 215388
131 Ga0207696_1001156 3300025711 Bacteria 15176
132 Ga0207696_1012454 3300025711 Bacteria 3007
133 Ga0207696_1026356 3300025711 Bacteria 1800
134 Ga0207696_1026490 3300025711 Bacteria 1794
135 Ga0207655_1000005 3300025728 Bacteria 917277
136 Ga0207655_1000250 3300025728 Bacteria 86806
137 Ga0207655_1000516 3300025728 Bacteria 49122
138 Ga0207655_1001578 3300025728 Bacteria 20471
139 Ga0207655_1004246 3300025728 Bacteria 10257
140 Ga0207655_1004365 3300025728 Bacteria 10058
141 Ga0207655_1004505 3300025728 Bacteria 9858
142 Ga0207655_1015168 3300025728 Bacteria 4301
143 Ga0207655_1021305 3300025728 Bacteria 3294
144 Ga0207713_1000013 3300025735 Bacteria 475751
145 Ga0207713_1000230 3300025735 Bacteria 74936
146 Ga0207713_1000515 3300025735 Bacteria 39243
147 Ga0207713_1002677 3300025735 Bacteria 12754
148 Ga0207713_1004387 3300025735 Bacteria 9166
149 Ga0207713_1005361 3300025735 Bacteria 8051
150 Ga0207713_1005667 3300025735 Bacteria 7762
151 Ga0207713_1006830 3300025735 Bacteria 6884
152 Ga0207713_1017410 3300025735 Bacteria 3604
153 Ga0207713_1022856 3300025735 Bacteria 2957
154 Ga0207713_1028810 3300025735 Bacteria 2498
155 Ga0207713_1042409 3300025735 Bacteria 1889
156 Ga0207671_10000566 3300025914 Bacteria 49574
157 Ga0207649_10000002 3300025920 Bacteria 498633
158 Ga0207690_10094180 3300025932 Bacteria 2124
159 Ga0207709_10000013 3300025935 Bacteria 531977
160 Ga0207709_10000333 3300025935 Bacteria 49685
161 Ga0207709_10009929 3300025935 Bacteria 5242
162 Ga0207669_10211970 3300025937 Bacteria 1415
163 Ga0207679_10000006 3300025945 Bacteria 498868
164 Ga0209281_1000015 3300027111 Bacteria 590084
165 Ga0209281_1000049 3300027111 Bacteria 322274
166 Ga0209389_1000002 3300027296 Bacteria 333932
167 Ga0209282_1008662 3300027666 Bacteria 6422
168 Ga0209974_10040212 3300027876 Bacteria 1556
169 Ga0207428_10017953 3300027907 Bacteria 6060
170 Ga0207428_10024556 3300027907 Bacteria 5062
171 Ga0207428_10054102 3300027907 Bacteria 3197
172 Ga0207428_10120152 3300027907 Bacteria 2015
173 Ga0207428_10160424 3300027907 Bacteria 1708
174 Ga0207428_10376722 3300027907 Bacteria 1042
175 Ga0268266_10017290 3300028379 Bacteria 6156
176 Ga0307511_10036008 3300030521 Bacteria 4308
177 Ga0316177_1207043 3300030731 Bacteria 2674
178 Ga0314311_1027865 3300030733 Bacteria 2501
179 Ga0316181_1119635 3300030744 Bacteria 2796
180 Ga0307408_100011721 3300031548 Bacteria 5797
181 Ga0307408_100028613 3300031548 Bacteria 3852
182 Ga0307408_100028931 3300031548 Bacteria 3833
183 Ga0307408_100285728 3300031548 Bacteria 1375
184 Ga0307516_10322728 3300031730 Bacteria 1215
185 Ga0307405_10000116 3300031731 Bacteria 32023
186 Ga0307405_10004506 3300031731 Bacteria 6593
187 Ga0307413_10002809 3300031824 Bacteria 7174
188 Ga0307406_10012640 3300031901 Bacteria 4813
189 Ga0307407_10395089 3300031903 Bacteria 990
190 Ga0307412_10002059 3300031911 Bacteria 11165
191 Ga0307412_10025605 3300031911 Bacteria 3655
192 Ga0307412_10272726 3300031911 Bacteria 1324
193 Ga0307412_10320248 3300031911 Bacteria 1233
194 Ga0307409_100040463 3300031995 Bacteria 3471
195 Ga0307416_100107615 3300032002 Bacteria 2447
196 Ga0307414_10126211 3300032004 Bacteria 1977
197 Ga0307414_10370560 3300032004 Bacteria 1235
198 Ga0307411_10031381 3300032005 Bacteria 3268
199 Ga0307411_10138754 3300032005 Bacteria 1789
200 Ga0439438_001994 3300041405 Bacteria 8921
201 Ga0439438_002237 3300041405 Bacteria 8327
202 Ga0439438_002288 3300041405 Bacteria 8207
203 Ga0439438_002470 3300041405 Bacteria 7864
204 Ga0439438_003657 3300041405 Bacteria 6141
205 Ga0439438_006974 3300041405 Bacteria 3916
206 Ga0439438_017621 3300041405 Bacteria 2050
207 Ga0439447_000378 3300041407 Bacteria 16217
208 Ga0439447_002781 3300041407 Bacteria 6307
209 Ga0439447_004557 3300041407 Bacteria 4741
210 Ga0439447_008045 3300041407 Bacteria 3293
211 Ga0439447_009541 3300041407 Bacteria 2933
212 Ga0439447_013417 3300041407 Bacteria 2324
213 Ga0439447_051559 3300041407 Bacteria 981
214 Ga0439466_0000179 3300041411 Bacteria 25206
215 Ga0439466_0003838 3300041411 Bacteria 5799
216 Ga0439466_0005091 3300041411 Bacteria 5039
217 Ga0439466_0005754 3300041411 Bacteria 4728
218 Ga0439466_0030067 3300041411 Bacteria 1865
219 Ga0439431_0011682 3300041997 Bacteria 2009
220 Ga0439431_0012298 3300041997 Bacteria 1964
221 Ga0439445_0017486 3300042004 Bacteria 1772
222 Ga0439445_0032633 3300042004 Bacteria 1358
223 Ga0439432_000903 3300042006 Bacteria 11149
224 Ga0439432_001809 3300042006 Bacteria 8017
225 Ga0439432_003207 3300042006 Bacteria 6086
226 Ga0439432_006683 3300042006 Bacteria 4108
227 Ga0439432_055646 3300042006 Bacteria 1227
228 Ga0439451_001462 3300042009 Bacteria 4669
229 Ga0439451_003644 3300042009 Bacteria 3119
230 Ga0439451_004822 3300042009 Bacteria 2744
231 Ga0439452_000099 3300042010 Bacteria 72507
232 Ga0439452_000668 3300042010 Bacteria 16915
233 Ga0439452_000919 3300042010 Bacteria 13373
234 Ga0439452_002674 3300042010 Bacteria 6463
235 Ga0439452_003151 3300042010 Bacteria 5841
236 Ga0439452_005738 3300042010 Bacteria 3967
237 Ga0439452_015877 3300042010 Bacteria 2055
238 Ga0439452_016974 3300042010 Bacteria 1967
239 Ga0439452_024715 3300042010 Bacteria 1532
240 Ga0439452_028511 3300042010 Bacteria 1392
241 Ga0439456_000246 3300042013 Bacteria 14066
242 Ga0439456_000399 3300042013 Bacteria 9725
243 Ga0439456_003334 3300042013 Bacteria 3247
244 Ga0439456_029064 3300042013 Bacteria 1180
245 Ga0439456_044978 3300042013 Bacteria 961
246 Ga0439463_000803 3300042016 Bacteria 8657
247 Ga0439463_002092 3300042016 Bacteria 5165
248 Ga0439463_004540 3300042016 Bacteria 3480
249 Ga0439463_012906 3300042016 Bacteria 2054
250 Ga0439463_013809 3300042016 Bacteria 1990
251 Ga0450911_000270 3300042115 Bacteria 19316
252 Ga0450911_002474 3300042115 Bacteria 3607
253 Ga0450911_006604 3300042115 Bacteria 1720
254 Ga0450919_001044 3300042121 Bacteria 3589
255 Ga0450919_008914 3300042121 Bacteria 1156
256 Ga0450922_001164 3300042124 Bacteria 2600
257 Ga0450922_003439 3300042124 Bacteria 1458
258 Ga0450923_010671 3300042125 Bacteria 1636
259 Ga0450890_000336 3300042127 Bacteria 6857
260 Ga0450891_001080 3300042129 Bacteria 2851
261 Ga0450902_006972 3300042137 Bacteria 1740
262 Ga0450903_002464 3300042138 Bacteria 3290
263 Ga0450903_004668 3300042138 Bacteria 2322
264 Ga0450903_009451 3300042138 Bacteria 1589
265 Ga0450903_010646 3300042138 Bacteria 1486
266 Ga0450904_000986 3300042139 Bacteria 4442
267 Ga0450905_000743 3300042142 Bacteria 4003
268 Ga0450905_010455 3300042142 Bacteria 1285
269 Ga0450906_000116 3300042145 Bacteria 13813
270 Ga0450906_003424 3300042145 Bacteria 3413
271 Ga0450906_009265 3300042145 Bacteria 1879
272 Ga0450907_000077 3300042146 Bacteria 37194
273 Ga0450907_005182 3300042146 Bacteria 2206
274 Ga0450907_017206 3300042146 Bacteria 1205
275 Ga0450910_001982 3300042147 Bacteria 2656
276 Ga0450910_005181 3300042147 Bacteria 1773
277 Ga0439446_0000301 3300042156 Bacteria 9383
278 Ga0450908_008750 3300042184 Bacteria 1891
279 Ga0450909_003200 3300042185 Bacteria 2329
280 Ga0450909_005640 3300042185 Bacteria 1800
281 Ga0439434_0001883 3300042435 Bacteria 6102
282 Ga0439434_0002522 3300042435 Bacteria 5325
283 Ga0439464_0004027 3300042439 Bacteria 3741
284 Ga0439460_0045888 3300042461 Bacteria 1297
285 Ga0450901_005212 3300042533 Bacteria 1336
286 Ga0495617_001173 3300046452 Bacteria 11851
287 Ga0495617_003803 3300046452 Bacteria 5582
288 Ga0495617_004597 3300046452 Bacteria 4998
289 Ga0495617_007982 3300046452 Bacteria 3658
290 Ga0495617_013324 3300046452 Bacteria 2797
291 Ga0495617_021469 3300046452 Bacteria 2180
292 Ga0495617_027261 3300046452 Bacteria 1922
293 Ga0495617_030493 3300046452 Bacteria 1812
294 Ga0495627_000821 3300046453 Bacteria 22577
295 Ga0495627_001680 3300046453 Bacteria 12183
296 Ga0495627_013802 3300046453 Bacteria 2836
297 Ga0495627_024885 3300046453 Bacteria 1946
298 Ga0495627_057130 3300046453 Bacteria 1162
299 Ga0495592_0211069 3300046454 Bacteria 1303
300 Ga0495603_0016183 3300046455 Bacteria 4511
301 Ga0495603_0040651 3300046455 Bacteria 2782
302 Ga0495603_0152662 3300046455 Bacteria 1341
303 Ga0495590_0001428 3300046457 Bacteria 10323
304 Ga0495590_0007846 3300046457 Bacteria 4097
305 Ga0495590_0008283 3300046457 Bacteria 3971
306 Ga0495590_0013809 3300046457 Bacteria 2961
307 Ga0495590_0065528 3300046457 Bacteria 1272
308 Ga0495590_0065629 3300046457 Bacteria 1270
309 Ga0495591_000672 3300046458 Bacteria 25137
310 Ga0495591_000838 3300046458 Bacteria 21740
311 Ga0495591_000865 3300046458 Bacteria 21264
312 Ga0495591_001019 3300046458 Bacteria 18932
313 Ga0495591_001130 3300046458 Bacteria 17609
314 Ga0495591_001425 3300046458 Bacteria 14888
315 Ga0495591_004241 3300046458 Bacteria 7106
316 Ga0495591_004343 3300046458 Bacteria 6979
317 Ga0495591_007900 3300046458 Bacteria 4436
318 Ga0495591_015677 3300046458 Bacteria 2667
319 Ga0495591_017199 3300046458 Bacteria 2492
320 Ga0495591_020134 3300046458 Bacteria 2212
321 Ga0495591_023071 3300046458 Bacteria 2001
322 Ga0495591_028313 3300046458 Bacteria 1715
323 Ga0495591_030321 3300046458 Bacteria 1634
324 Ga0495629_0002791 3300046459 Bacteria 13323
325 Ga0495638_0002825 3300046460 Bacteria 13908
326 Ga0495638_0003398 3300046460 Bacteria 12550
327 Ga0495638_0016071 3300046460 Bacteria 5016
328 Ga0495638_0017042 3300046460 Bacteria 4853
329 Ga0495638_0033201 3300046460 Bacteria 3301
330 Ga0495638_0074805 3300046460 Bacteria 2065
331 Ga0495638_0113511 3300046460 Bacteria 1607
332 Ga0495653_0004282 3300046463 Bacteria 11556
333 Ga0495653_0039037 3300046463 Bacteria 3722
334 Ga0495653_0192433 3300046463 Bacteria 1390
335 Ga0495650_0000214 3300046471 Bacteria 123366
336 Ga0495650_0003573 3300046471 Bacteria 11241
337 Ga0495650_0003864 3300046471 Bacteria 10621
338 Ga0495650_0009063 3300046471 Bacteria 5708
339 Ga0495650_0010134 3300046471 Bacteria 5285
340 Ga0495650_0018512 3300046471 Bacteria 3457
341 Ga0495650_0028530 3300046471 Bacteria 2560
342 Ga0495650_0034227 3300046471 Bacteria 2251
343 Ga0495650_0036755 3300046471 Bacteria 2139
344 Ga0495580_0243680 3300046472 Bacteria 1232
345 Ga0495582_0000733 3300046473 Bacteria 18094
346 Ga0495605_0000016 3300046474 Bacteria 289508
347 Ga0495605_0000031 3300046474 Bacteria 213242
348 Ga0495605_0000188 3300046474 Bacteria 76990
349 Ga0495605_0001298 3300046474 Bacteria 16574
350 Ga0495605_0003806 3300046474 Bacteria 8948
351 Ga0495605_0007383 3300046474 Bacteria 6241
352 Ga0495605_0011436 3300046474 Bacteria 4946
353 Ga0495605_0015275 3300046474 Bacteria 4181
354 Ga0495605_0030700 3300046474 Bacteria 2752
355 Ga0495639_0000539 3300046475 Bacteria 17739
356 Ga0495639_0006675 3300046475 Bacteria 4966
357 Ga0495639_0114279 3300046475 Bacteria 1283
358 Ga0495584_0001540 3300046491 Bacteria 13693
359 Ga0495584_0005789 3300046491 Bacteria 6519
360 Ga0495584_0007785 3300046491 Bacteria 5575
361 Ga0495584_0008287 3300046491 Bacteria 5383
362 Ga0495584_0023723 3300046491 Bacteria 3110
363 Ga0495584_0034252 3300046491 Bacteria 2569
364 Ga0495584_0037722 3300046491 Bacteria 2443
365 Ga0495584_0040164 3300046491 Bacteria 2362
366 Ga0495584_0060267 3300046491 Bacteria 1908
367 Ga0495584_0080456 3300046491 Bacteria 1639
368 Ga0495585_0002150 3300046492 Bacteria 14354
369 Ga0495585_0005157 3300046492 Bacteria 8295
370 Ga0495585_0007381 3300046492 Bacteria 6733
371 Ga0495585_0008742 3300046492 Bacteria 6123
372 Ga0495585_0008799 3300046492 Bacteria 6094
373 Ga0495585_0015567 3300046492 Bacteria 4419
374 Ga0495585_0020521 3300046492 Bacteria 3799
375 Ga0495585_0022004 3300046492 Bacteria 3659
376 Ga0495585_0095525 3300046492 Bacteria 1596
377 Ga0495594_0000132 3300046499 Bacteria 35426
378 Ga0495594_0006827 3300046499 Bacteria 5864
379 Ga0495594_0088709 3300046499 Bacteria 1731
380 Ga0495594_0168584 3300046499 Bacteria 1245
381 Ga0495596_0000827 3300046500 Bacteria 18753
382 Ga0495596_0013106 3300046500 Bacteria 3527
383 Ga0495607_0000155 3300046501 Bacteria 71920
384 Ga0495607_0000166 3300046501 Bacteria 70056
385 Ga0495607_0001964 3300046501 Bacteria 17358
386 Ga0495607_0002454 3300046501 Bacteria 15064
387 Ga0495607_0002817 3300046501 Bacteria 13816
388 Ga0495607_0004767 3300046501 Bacteria 9913
389 Ga0495607_0006044 3300046501 Bacteria 8570
390 Ga0495607_0008040 3300046501 Bacteria 7242
391 Ga0495607_0014403 3300046501 Bacteria 5148
392 Ga0495607_0015123 3300046501 Bacteria 5011
393 Ga0495607_0017133 3300046501 Bacteria 4660
394 Ga0495607_0033581 3300046501 Bacteria 3121
395 Ga0495607_0036109 3300046501 Bacteria 2982
396 Ga0495607_0047931 3300046501 Bacteria 2500
397 Ga0495607_0050678 3300046501 Bacteria 2415
398 Ga0495607_0068412 3300046501 Bacteria 1991
399 Ga0495607_0098737 3300046501 Bacteria 1567
400 Ga0495607_0100547 3300046501 Bacteria 1549
401 Ga0495607_0105905 3300046501 Bacteria 1498
402 Ga0495607_0114845 3300046501 Bacteria 1422
403 Ga0495607_0130430 3300046501 Bacteria 1308
404 Ga0495607_0134995 3300046501 Bacteria 1279
405 Ga0495607_0155544 3300046501 Bacteria 1166
406 Ga0495583_0000041 3300046506 Bacteria 234707
407 Ga0495583_0000915 3300046506 Bacteria 34946
408 Ga0495583_0001118 3300046506 Bacteria 29570
409 Ga0495583_0001611 3300046506 Bacteria 22132
410 Ga0495583_0004592 3300046506 Bacteria 9789
411 Ga0495583_0005845 3300046506 Bacteria 8205
412 Ga0495583_0028831 3300046506 Bacteria 2723
413 Ga0495583_0032224 3300046506 Bacteria 2531
414 Ga0495583_0045039 3300046506 Bacteria 2042
415 Ga0495583_0084442 3300046506 Bacteria 1375
416 Ga0495583_0129367 3300046506 Bacteria 1057
417 Ga0495606_0000055 3300046507 Bacteria 199348
418 Ga0495606_0000595 3300046507 Bacteria 57210
419 Ga0495606_0003583 3300046507 Bacteria 16364
420 Ga0495606_0006825 3300046507 Bacteria 10421
421 Ga0495606_0006876 3300046507 Bacteria 10370
422 Ga0495606_0007907 3300046507 Bacteria 9376
423 Ga0495606_0008023 3300046507 Bacteria 9272
424 Ga0495606_0009507 3300046507 Bacteria 8211
425 Ga0495606_0017801 3300046507 Bacteria 5353
426 Ga0495606_0027133 3300046507 Bacteria 4066
427 Ga0495606_0082867 3300046507 Bacteria 1990
428 Ga0495606_0090859 3300046507 Bacteria 1878
429 Ga0495606_0225102 3300046507 Bacteria 1054
430 Ga0495610_0002167 3300046512 Bacteria 16696
431 Ga0495610_0003038 3300046512 Bacteria 13435
432 Ga0495610_0003907 3300046512 Bacteria 11304
433 Ga0495610_0004768 3300046512 Bacteria 9890
434 Ga0495610_0006442 3300046512 Bacteria 8074
435 Ga0495610_0009145 3300046512 Bacteria 6301
436 Ga0495610_0011459 3300046512 Bacteria 5419
437 Ga0495610_0011795 3300046512 Bacteria 5310
438 Ga0495610_0013406 3300046512 Bacteria 4872
439 Ga0495610_0021456 3300046512 Bacteria 3551
440 Ga0495610_0031467 3300046512 Bacteria 2768
441 Ga0495610_0048338 3300046512 Bacteria 2089
442 Ga0495610_0098488 3300046512 Bacteria 1313
443 Ga0495616_0001297 3300046513 Bacteria 17531
444 Ga0495616_0004657 3300046513 Bacteria 8606
445 Ga0495616_0006238 3300046513 Bacteria 7246
446 Ga0495616_0007398 3300046513 Bacteria 6568
447 Ga0495616_0007901 3300046513 Bacteria 6343
448 Ga0495616_0011280 3300046513 Bacteria 5129
449 Ga0495616_0011966 3300046513 Bacteria 4940
450 Ga0495616_0076169 3300046513 Bacteria 1612
451 Ga0495620_0000015 3300046515 Bacteria 154625
452 Ga0495620_0000925 3300046515 Bacteria 18056
453 Ga0495620_0000988 3300046515 Bacteria 17562
454 Ga0495620_0004712 3300046515 Bacteria 7665
455 Ga0495620_0013261 3300046515 Bacteria 4226
456 Ga0495620_0014367 3300046515 Bacteria 4026
457 Ga0495620_0018619 3300046515 Bacteria 3436
458 Ga0495620_0025542 3300046515 Bacteria 2792
459 Ga0495620_0027290 3300046515 Bacteria 2673
460 Ga0495620_0044242 3300046515 Bacteria 1935
461 Ga0495628_0251212 3300046516 Bacteria 1320
462 Ga0495630_0029624 3300046517 Bacteria 4069
463 Ga0495630_0376460 3300046517 Bacteria 1087
464 Ga0495631_0000862 3300046518 Bacteria 19078
465 Ga0495631_0002166 3300046518 Bacteria 11346
466 Ga0495631_0005391 3300046518 Bacteria 6696
467 Ga0495631_0010330 3300046518 Bacteria 4622
468 Ga0495631_0010456 3300046518 Bacteria 4589
469 Ga0495631_0014013 3300046518 Bacteria 3875
470 Ga0495631_0042159 3300046518 Bacteria 2017
471 Ga0495632_0001686 3300046519 Bacteria 18081
472 Ga0495632_0002162 3300046519 Bacteria 15176
473 Ga0495632_0002585 3300046519 Bacteria 13661
474 Ga0495632_0003197 3300046519 Bacteria 11792
475 Ga0495632_0009040 3300046519 Bacteria 6038
476 Ga0495632_0010406 3300046519 Bacteria 5513
477 Ga0495632_0013525 3300046519 Bacteria 4654
478 Ga0495632_0018667 3300046519 Bacteria 3800
479 Ga0495632_0041390 3300046519 Bacteria 2315
480 Ga0495632_0041457 3300046519 Bacteria 2313
481 Ga0495632_0057081 3300046519 Bacteria 1906
482 Ga0495632_0059206 3300046519 Bacteria 1864
483 Ga0495632_0123309 3300046519 Bacteria 1209
484 Ga0495632_0133919 3300046519 Bacteria 1152
485 Ga0495632_0153284 3300046519 Bacteria 1064
486 Ga0495637_0000135 3300046520 Bacteria 55229
487 Ga0495637_0000369 3300046520 Bacteria 33911
488 Ga0495637_0000884 3300046520 Bacteria 19392
489 Ga0495637_0001413 3300046520 Bacteria 14187
490 Ga0495637_0001703 3300046520 Bacteria 12698
491 Ga0495637_0001762 3300046520 Bacteria 12403
492 Ga0495637_0002653 3300046520 Bacteria 9783
493 Ga0495637_0004042 3300046520 Bacteria 7661
494 Ga0495637_0012171 3300046520 Bacteria 4119
495 Ga0495637_0014039 3300046520 Bacteria 3788
496 Ga0495637_0017491 3300046520 Bacteria 3339
497 Ga0495637_0020845 3300046520 Bacteria 3009
498 Ga0495637_0021117 3300046520 Bacteria 2987
499 Ga0495637_0030803 3300046520 Bacteria 2376
500 Ga0495637_0031168 3300046520 Bacteria 2360
501 Ga0495637_0037126 3300046520 Bacteria 2117
502 Ga0495637_0070589 3300046520 Bacteria 1410
503 Ga0495637_0098851 3300046520 Bacteria 1142
504 Ga0495643_0000795 3300046522 Bacteria 34919
505 Ga0495643_0003825 3300046522 Bacteria 10857
506 Ga0495643_0004563 3300046522 Bacteria 9645
507 Ga0495643_0022619 3300046522 Bacteria 3585
508 Ga0495643_0023790 3300046522 Bacteria 3478
509 Ga0495643_0026581 3300046522 Bacteria 3263
510 Ga0495643_0040870 3300046522 Bacteria 2531
511 Ga0495643_0146539 3300046522 Bacteria 1172
512 Ga0495644_0004361 3300046523 Bacteria 5560
513 Ga0495644_0030117 3300046523 Bacteria 2049
514 Ga0495644_0030989 3300046523 Bacteria 2019
515 Ga0495644_0051450 3300046523 Bacteria 1546
516 Ga0495648_0002157 3300046524 Bacteria 18539
517 Ga0495648_0002239 3300046524 Bacteria 18073
518 Ga0495648_0003283 3300046524 Bacteria 14297
519 Ga0495648_0008633 3300046524 Bacteria 7990
520 Ga0495648_0014858 3300046524 Bacteria 5672
521 Ga0495648_0019787 3300046524 Bacteria 4716
522 Ga0495648_0036881 3300046524 Bacteria 3146
523 Ga0495648_0050044 3300046524 Bacteria 2556
524 Ga0495648_0057510 3300046524 Bacteria 2331
525 Ga0495648_0085525 3300046524 Bacteria 1781
526 Ga0495648_0094821 3300046524 Bacteria 1661
527 Ga0495648_0110289 3300046524 Bacteria 1498
528 Ga0495648_0127816 3300046524 Bacteria 1355
529 Ga0495648_0139221 3300046524 Bacteria 1279
530 Ga0495648_0139866 3300046524 Bacteria 1275
531 Ga0495666_0002784 3300046526 Bacteria 8737
532 Ga0495666_0011278 3300046526 Bacteria 4457
533 Ga0495666_0033617 3300046526 Bacteria 2504
534 Ga0495666_0063046 3300046526 Bacteria 1769
535 Ga0495642_0000254 3300046528 Bacteria 29928
536 Ga0495642_0000654 3300046528 Bacteria 17347
537 Ga0495642_0003384 3300046528 Bacteria 6296
538 Ga0495654_0000447 3300046530 Bacteria 34853
539 Ga0495654_0001035 3300046530 Bacteria 20350
540 Ga0495654_0002767 3300046530 Bacteria 11054
541 Ga0495654_0005185 3300046530 Bacteria 7600
542 Ga0495654_0007322 3300046530 Bacteria 6182
543 Ga0495654_0010093 3300046530 Bacteria 5151
544 Ga0495654_0012475 3300046530 Bacteria 4561
545 Ga0495654_0015773 3300046530 Bacteria 4007
546 Ga0495654_0015835 3300046530 Bacteria 3998
547 Ga0495654_0028383 3300046530 Bacteria 2861
548 Ga0495654_0036976 3300046530 Bacteria 2451
549 Ga0495654_0050346 3300046530 Bacteria 2036
550 Ga0495654_0063468 3300046530 Bacteria 1768
551 Ga0495654_0081147 3300046530 Bacteria 1520
552 Ga0495654_0105714 3300046530 Bacteria 1290
553 Ga0495654_0119557 3300046530 Bacteria 1194
554 Ga0495654_0136125 3300046530 Bacteria 1098
555 Ga0495586_0007026 3300046535 Bacteria 6000
556 Ga0495587_0002099 3300046536 Bacteria 13308
557 Ga0495609_0000015 3300046538 Bacteria 322474
558 Ga0495609_0000050 3300046538 Bacteria 154752
559 Ga0495609_0000066 3300046538 Bacteria 131202
560 Ga0495609_0001515 3300046538 Bacteria 15314
561 Ga0495609_0002365 3300046538 Bacteria 11642
562 Ga0495609_0016741 3300046538 Bacteria 3414
563 Ga0495609_0021086 3300046538 Bacteria 3006
564 Ga0495609_0155173 3300046538 Bacteria 972
565 Ga0495597_0001871 3300046542 Bacteria 14377
566 Ga0495597_0004231 3300046542 Bacteria 7940
567 Ga0495597_0004953 3300046542 Bacteria 7159
568 Ga0495597_0005883 3300046542 Bacteria 6407
569 Ga0495597_0021554 3300046542 Bacteria 2994
570 Ga0495597_0043663 3300046542 Bacteria 1995
571 Ga0495597_0048057 3300046542 Bacteria 1888
572 Ga0495597_0062484 3300046542 Bacteria 1620
573 Ga0495597_0069740 3300046542 Bacteria 1516
574 Ga0495645_0118863 3300046543 Bacteria 1862
575 Ga0495645_0175630 3300046543 Bacteria 1471
576 Ga0495622_0000372 3300046557 Bacteria 31015
577 Ga0495622_0010433 3300046557 Bacteria 4291
578 Ga0495633_0000060 3300046558 Bacteria 144561
579 Ga0495633_0000907 3300046558 Bacteria 25252
580 Ga0495633_0002167 3300046558 Bacteria 14088
581 Ga0495656_0020024 3300046615 Bacteria 2590
582 Ga0495668_0002258 3300046616 Bacteria 16212
583 Ga0495668_0003383 3300046616 Bacteria 12006
584 Ga0495668_0009417 3300046616 Bacteria 6000
585 Ga0495668_0028633 3300046616 Bacteria 3150
586 Ga0495668_0030227 3300046616 Bacteria 3059
587 Ga0495668_0079749 3300046616 Bacteria 1796
588 Ga0495634_0004876 3300046642 Bacteria 10396
589 Ga0495634_0062909 3300046642 Bacteria 2463
590 Ga0495611_0000509 3300046648 Bacteria 23059
591 Ga0495611_0000632 3300046648 Bacteria 20270
592 Ga0495611_0004631 3300046648 Bacteria 5913
593 Ga0495611_0019067 3300046648 Bacteria 2946
594 Ga0495611_0040782 3300046648 Bacteria 2070
595 Ga0495611_0052496 3300046648 Bacteria 1839
596 Ga0495611_0166474 3300046648 Bacteria 1030
597 Ga0495625_0000055 3300046660 Bacteria 186381
598 Ga0495625_0002765 3300046660 Bacteria 18527
599 Ga0495625_0004271 3300046660 Bacteria 13599
600 Ga0495625_0004290 3300046660 Bacteria 13559
601 Ga0495625_0008598 3300046660 Bacteria 8688
602 Ga0495625_0028955 3300046660 Bacteria 4146
603 Ga0495625_0044404 3300046660 Bacteria 3217
604 Ga0495625_0140163 3300046660 Bacteria 1631
605 Ga0495635_0015612 3300046663 Bacteria 5306
606 Ga0495635_0038830 3300046663 Bacteria 3296
607 Ga0495659_0000371 3300046664 Bacteria 17425
608 Ga0495659_0022000 3300046664 Bacteria 2152
609 Ga0495661_0000046 3300046665 Bacteria 148306
610 Ga0495661_0000139 3300046665 Bacteria 85160
611 Ga0495661_0001234 3300046665 Bacteria 22162
612 Ga0495661_0003018 3300046665 Bacteria 12685
613 Ga0495661_0010504 3300046665 Bacteria 6315
614 Ga0495661_0012941 3300046665 Bacteria 5620
615 Ga0495661_0027676 3300046665 Bacteria 3636
616 Ga0495661_0071589 3300046665 Bacteria 2025
617 Ga0495588_0040467 3300046674 Bacteria 2377
618 Ga0495588_0063526 3300046674 Bacteria 1914
619 Ga0495588_0260830 3300046674 Bacteria 913
620 Ga0495623_0017881 3300046679 Bacteria 4579
621 Ga0495646_0006545 3300046680 Bacteria 7392
622 Ga0495646_0008302 3300046680 Bacteria 6603
623 Ga0495669_0005628 3300046684 Bacteria 5228
624 Ga0495669_0029352 3300046684 Bacteria 2411
625 Ga0495613_0003327 3300046689 Bacteria 12028
626 Ga0495613_0123528 3300046689 Bacteria 1857
627 Ga0495624_0000715 3300046690 Bacteria 25992
628 Ga0495624_0296418 3300046690 Bacteria 975
629 Ga0495670_0001044 3300046691 Bacteria 13393
630 Ga0495670_0001705 3300046691 Bacteria 10806
631 Ga0495670_0004339 3300046691 Bacteria 6951
632 Ga0495670_0021367 3300046691 Bacteria 3191
633 Ga0495670_0039870 3300046691 Bacteria 2343
634 Ga0495670_0042871 3300046691 Bacteria 2258
635 Ga0495670_0103634 3300046691 Bacteria 1467
636 Ga0495670_0132491 3300046691 Bacteria 1300
637 Ga0495670_0140282 3300046691 Bacteria 1263
638 Ga0495671_0000516 3300046692 Bacteria 29556
639 Ga0495671_0001833 3300046692 Bacteria 13676
640 Ga0495671_0003399 3300046692 Bacteria 9790
641 Ga0495671_0007486 3300046692 Bacteria 6216
642 Ga0495671_0010383 3300046692 Bacteria 5160
643 Ga0495671_0014106 3300046692 Bacteria 4308
644 Ga0495671_0020879 3300046692 Bacteria 3447
645 Ga0495671_0032228 3300046692 Bacteria 2675
646 Ga0495671_0037908 3300046692 Bacteria 2436
647 Ga0495671_0046196 3300046692 Bacteria 2177
648 Ga0495671_0046960 3300046692 Bacteria 2158
649 Ga0495671_0064874 3300046692 Bacteria 1797
650 Ga0495671_0127421 3300046692 Bacteria 1241
651 Ga0495649_0001026 3300046694 Bacteria 21907
652 Ga0495649_0005286 3300046694 Bacteria 8247
653 Ga0495649_0008202 3300046694 Bacteria 6294
654 Ga0495649_0011041 3300046694 Bacteria 5321
655 Ga0495649_0013507 3300046694 Bacteria 4709
656 Ga0495649_0015070 3300046694 Bacteria 4407
657 Ga0495649_0027829 3300046694 Bacteria 3134
658 Ga0495649_0037535 3300046694 Bacteria 2659
659 Ga0495649_0046221 3300046694 Bacteria 2370
660 Ga0495649_0180476 3300046694 Bacteria 1101
661 Ga0495589_0000773 3300046794 Bacteria 20398
662 Ga0495589_0000909 3300046794 Bacteria 18210
663 Ga0495589_0008318 3300046794 Bacteria 5420
664 Ga0495589_0009027 3300046794 Bacteria 5185
665 Ga0495589_0009456 3300046794 Bacteria 5069
666 Ga0495589_0019665 3300046794 Bacteria 3457
667 Ga0495600_0013336 3300046809 Bacteria 5160
668 Ga0495600_0130126 3300046809 Bacteria 1636
669 Ga0495660_0001330 3300046810 Bacteria 17017
670 Ga0495660_0004987 3300046810 Bacteria 7987
671 Ga0495660_0009422 3300046810 Bacteria 5695
672 Ga0495660_0009578 3300046810 Bacteria 5647
673 Ga0495660_0011131 3300046810 Bacteria 5223
674 Ga0495660_0018248 3300046810 Bacteria 4031
675 Ga0495660_0022612 3300046810 Bacteria 3588
676 Ga0495660_0032276 3300046810 Bacteria 2940
677 Ga0495660_0063628 3300046810 Bacteria 1974
678 Ga0495660_0074985 3300046810 Bacteria 1785
679 Ga0495660_0086653 3300046810 Bacteria 1634
680 Ga0495660_0161980 3300046810 Bacteria 1096
681 Ga0495581_0051855 3300047315 Bacteria 2369
682 Ga0495604_0014240 3300047317 Bacteria 6339
683 Ga0495636_0001882 3300047318 Bacteria 8019
684 Ga0495636_0061729 3300047318 Bacteria 1585
685 Ga0495674_0037564 3300047319 Bacteria 4352
686 Ga0495672_0000803 3300047320 Bacteria 33779
687 Ga0495672_0001932 3300047320 Bacteria 19597
688 Ga0495672_0004779 3300047320 Bacteria 10925
689 Ga0495672_0005327 3300047320 Bacteria 10233
690 Ga0495672_0024090 3300047320 Bacteria 3928
691 Ga0495672_0030445 3300047320 Bacteria 3385
692 Ga0495672_0034144 3300047320 Bacteria 3145
693 Ga0495672_0038203 3300047320 Bacteria 2930
694 Ga0495672_0040683 3300047320 Bacteria 2817
695 Ga0495672_0054957 3300047320 Bacteria 2324
696 Ga0495672_0054964 3300047320 Bacteria 2324
697 Ga0495676_0000013 3300047321 Bacteria 213031
698 Ga0495676_0009805 3300047321 Bacteria 8699
699 Ga0495676_0013123 3300047321 Bacteria 7454
700 Ga0495680_0002534 3300047322 Bacteria 18679
701 Ga0495680_0105920 3300047322 Bacteria 2090
702 Ga0495683_0000027 3300047323 Bacteria 153730
703 Ga0495683_0001814 3300047323 Bacteria 13430
704 Ga0495683_0026699 3300047323 Bacteria 2954
705 Ga0495683_0030909 3300047323 Bacteria 2729
706 Ga0495683_0062884 3300047323 Bacteria 1835
707 Ga0495683_0068103 3300047323 Bacteria 1751
708 Ga0495687_017672 3300047443 Bacteria 3546
709 Ga0495675_0004133 3300047444 Bacteria 8789
710 Ga0495677_0001276 3300047445 Bacteria 10068
711 Ga0495679_000129 3300047446 Bacteria 67544
712 Ga0495679_000712 3300047446 Bacteria 21525
713 Ga0495679_004278 3300047446 Bacteria 6629
714 Ga0495679_014943 3300047446 Bacteria 2855
715 Ga0495679_056783 3300047446 Bacteria 1159
716 Ga0495679_061910 3300047446 Bacteria 1096
717 Ga0495685_022422 3300047447 Bacteria 2173
718 Ga0495673_0000510 3300047469 Bacteria 41036
719 Ga0495673_0000641 3300047469 Bacteria 34387
720 Ga0495673_0001127 3300047469 Bacteria 22902
721 Ga0495673_0001242 3300047469 Bacteria 21123
722 Ga0495673_0001585 3300047469 Bacteria 17784
723 Ga0495673_0002606 3300047469 Bacteria 12542
724 Ga0495673_0004050 3300047469 Bacteria 9340
725 Ga0495673_0008622 3300047469 Bacteria 5709
726 Ga0495673_0009433 3300047469 Bacteria 5403
727 Ga0495673_0015866 3300047469 Bacteria 3868
728 Ga0495673_0017832 3300047469 Bacteria 3593
729 Ga0495673_0019202 3300047469 Bacteria 3428
730 Ga0495673_0035268 3300047469 Bacteria 2307
731 Ga0495673_0061380 3300047469 Bacteria 1609
732 Ga0495673_0072255 3300047469 Bacteria 1448
733 Ga0495673_0107818 3300047469 Bacteria 1117
734 Ga0495681_0002384 3300047470 Bacteria 13458
735 Ga0495681_0002455 3300047470 Bacteria 13230
736 Ga0495681_0003399 3300047470 Bacteria 11081
737 Ga0495681_0004258 3300047470 Bacteria 9814
738 Ga0495681_0005284 3300047470 Bacteria 8667
739 Ga0495681_0006096 3300047470 Bacteria 7965
740 Ga0495681_0008745 3300047470 Bacteria 6316
741 Ga0495681_0009977 3300047470 Bacteria 5786
742 Ga0495681_0016713 3300047470 Bacteria 4099
743 Ga0495681_0022409 3300047470 Bacteria 3379
744 Ga0495681_0041744 3300047470 Bacteria 2225
745 Ga0495681_0118190 3300047470 Bacteria 1140
746 Ga0495681_0126352 3300047470 Bacteria 1092
747 Ga0495684_0033679 3300047471 Bacteria 3929
748 Ga0495684_0178831 3300047471 Bacteria 1573
749 Ga0495686_0006584 3300047472 Bacteria 8859
750 Ga0495686_0009485 3300047472 Bacteria 7002
751 Ga0495686_0015327 3300047472 Bacteria 5239
752 Ga0495686_0162979 3300047472 Bacteria 1301
753 Ga0495593_0016645 3300047673 Bacteria 4144
754 Ga0495593_0026906 3300047673 Bacteria 3170
755 Ga0495593_0031754 3300047673 Bacteria 2882
756 Ga0495593_0037735 3300047673 Bacteria 2611
757 Ga0495602_0014510 3300048088 Bacteria 7996
758 Ga0495626_0000056 3300048091 Bacteria 150654
759 Ga0495626_0001345 3300048091 Bacteria 19882
760 Ga0495626_0001594 3300048091 Bacteria 17690
761 Ga0495626_0003478 3300048091 Bacteria 10091
762 Ga0495626_0004130 3300048091 Bacteria 9019
763 Ga0495626_0004217 3300048091 Bacteria 8892
764 Ga0495626_0005916 3300048091 Bacteria 7042
765 Ga0495626_0017330 3300048091 Bacteria 3639
766 Ga0495626_0020552 3300048091 Bacteria 3288
767 Ga0495626_0074305 3300048091 Bacteria 1521
768 Ga0495626_0122234 3300048091 Bacteria 1118
769 Ga0495626_0125533 3300048091 Bacteria 1099
770 Ga0495626_0138270 3300048091 Bacteria 1034
771 Ga0496102_0000796 3300048905 Bacteria 30627
772 Ga0496102_0260522 3300048905 Bacteria 1635
773 Ga0496103_0036967 3300048906 Bacteria 2991
774 Ga0496110_0251761 3300048913 Bacteria 1608
775 Ga0496110_0282475 3300048913 Bacteria 1511
776 Ga0496112_0102825 3300048915 Bacteria 2827
777 Ga0496113_0193501 3300048916 Bacteria 1615
778 Ga0496114_0005561 3300048917 Bacteria 9878
779 Ga0496116_0001359 3300048919 Bacteria 27688
780 Ga0496116_0004680 3300048919 Bacteria 12946
781 Ga0496116_0010160 3300048919 Bacteria 7926
782 Ga0496116_0011094 3300048919 Bacteria 7494
783 Ga0496116_0011855 3300048919 Bacteria 7172
784 Ga0496116_0019855 3300048919 Bacteria 5129
785 Ga0496117_0002232 3300048920 Bacteria 25020
786 Ga0496117_0006033 3300048920 Bacteria 12450
787 Ga0496117_0009723 3300048920 Bacteria 8883
788 Ga0496117_0013986 3300048920 Bacteria 6953
789 Ga0496117_0022419 3300048920 Bacteria 5065
790 Ga0496117_0039614 3300048920 Bacteria 3475
791 Ga0496117_0066729 3300048920 Bacteria 2438
792 Ga0496117_0104062 3300048920 Bacteria 1787
793 Ga0496118_0001275 3300048921 Bacteria 38632
794 Ga0496118_0008333 3300048921 Bacteria 10737
795 Ga0496118_0014129 3300048921 Bacteria 7489
796 Ga0496118_0024151 3300048921 Bacteria 5255
797 Ga0496118_0028217 3300048921 Bacteria 4733
798 Ga0496118_0047223 3300048921 Bacteria 3340
799 Ga0496118_0050163 3300048921 Bacteria 3206
800 Ga0496118_0061183 3300048921 Bacteria 2790
801 Ga0496118_0103796 3300048921 Bacteria 1910
802 Ga0496118_0111314 3300048921 Bacteria 1815
803 Ga0496120_0041278 3300048923 Bacteria 2704
804 Ga0496121_0002904 3300048924 Bacteria 25153
805 Ga0496121_0008688 3300048924 Bacteria 11859
806 Ga0496121_0025147 3300048924 Bacteria 5663
807 Ga0496121_0030644 3300048924 Bacteria 4935
808 Ga0496121_0072441 3300048924 Bacteria 2766
809 Ga0496121_0246032 3300048924 Bacteria 1243
810 Ga0496121_0251221 3300048924 Bacteria 1226
811 Ga0496121_0286204 3300048924 Bacteria 1125
812 Ga0496122_0000122 3300048925 Bacteria 181491
813 Ga0496122_0004214 3300048925 Bacteria 18081
814 Ga0496122_0009792 3300048925 Bacteria 10008
815 Ga0496122_0023535 3300048925 Bacteria 5426
816 Ga0496122_0025117 3300048925 Bacteria 5189
817 Ga0496122_0101007 3300048925 Bacteria 1928
818 Ga0496123_0000173 3300048926 Bacteria 130586
819 Ga0496123_0000391 3300048926 Bacteria 82015
820 Ga0496123_0003346 3300048926 Bacteria 18142
821 Ga0496123_0014039 3300048926 Bacteria 6666
822 Ga0496123_0019308 3300048926 Bacteria 5378
823 Ga0496123_0040786 3300048926 Bacteria 3228
824 Ga0496123_0044494 3300048926 Bacteria 3035
825 Ga0496124_0000145 3300048927 Bacteria 146878
826 Ga0496124_0003404 3300048927 Bacteria 19519
827 Ga0496124_0007252 3300048927 Bacteria 11827
828 Ga0496124_0010268 3300048927 Bacteria 9506
829 Ga0496124_0013455 3300048927 Bacteria 7986
830 Ga0496124_0017225 3300048927 Bacteria 6818
831 Ga0496124_0020832 3300048927 Bacteria 6051
832 Ga0496124_0033779 3300048927 Bacteria 4496
833 Ga0496124_0053046 3300048927 Bacteria 3440
834 Ga0496124_0064866 3300048927 Bacteria 3047
835 Ga0496124_0096707 3300048927 Bacteria 2398
836 Ga0496125_0005725 3300048928 Bacteria 13680
837 Ga0496125_0028636 3300048928 Bacteria 5025
838 Ga0496125_0055348 3300048928 Bacteria 3233
839 Ga0496125_0068977 3300048928 Bacteria 2777
840 Ga0496125_0087892 3300048928 Bacteria 2345
841 Ga0496125_0269993 3300048928 Bacteria 1060
842 Ga0496126_0013799 3300048929 Bacteria 8192
843 Ga0496126_0054787 3300048929 Bacteria 3610
844 Ga0496126_0057063 3300048929 Bacteria 3527
845 Ga0495678_000031 3300049459 Bacteria 215528
846 Ga0495678_000039 3300049459 Bacteria 191665
847 Ga0495678_001592 3300049459 Bacteria 17415
848 Ga0495678_002493 3300049459 Bacteria 12411
849 Ga0495678_003300 3300049459 Bacteria 10073
850 Ga0495678_003504 3300049459 Bacteria 9655
851 Ga0495678_003647 3300049459 Bacteria 9355
852 Ga0495678_003769 3300049459 Bacteria 9155
853 Ga0495678_009564 3300049459 Bacteria 4786
854 Ga0495678_012509 3300049459 Bacteria 4020
855 Ga0495678_012860 3300049459 Bacteria 3949
856 Ga0495678_030524 3300049459 Bacteria 2254
857 Ga0495678_034844 3300049459 Bacteria 2067
858 Ga0495678_042890 3300049459 Bacteria 1800
859 Ga0495682_0000280 3300049460 Bacteria 39963
860 Ga0495682_0001245 3300049460 Bacteria 14386
861 Ga0495682_0001969 3300049460 Bacteria 10160
862 Ga0495682_0003866 3300049460 Bacteria 6559
863 Ga0495682_0020250 3300049460 Bacteria 2497
864 Ga0495682_0110662 3300049460 Bacteria 984
865 Ga0501034_0000137 3300049571 Bacteria 136592
866 Ga0501037_0100357 3300049573 Bacteria 2090
867 Ga0501039_0150436 3300049575 Bacteria 1829
868 Ga0501222_005807 3300049662 Bacteria 1661
869 Ga0501240_016096 3300049673 Bacteria 1071
870 Ga0501252_008508 3300049682 Bacteria 1181
871 Ga0501241_000708 3300049758 Bacteria 7199
872 nmdc:mga00v17_301201_c1 3300050491 Bacteria 1041
873 nmdc:mga00v17_98362_c1 3300050491 Bacteria 1845
874 Ga0500572_003400 3300053111 Bacteria 3650
875 Ga0500659_0000763 3300053135 Bacteria 20701
876 Ga0500586_086471 3300053145 Bacteria 1101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2818991445 2819594300 277
2 3300042009 Ga0439451_001462 Ga0439451_001462_3528_4367 279
3 3300046557 Ga0495622_0010433 Ga0495622_0010433_3107_3946 279
4 3300046501 Ga0495607_0008040 Ga0495607_0008040_4141_4983 280
5 3300046520 Ga0495637_0017491 Ga0495637_0017491_2466_3308 280
6 3300046524 Ga0495648_0085525 Ga0495648_0085525_217_1059 280
7 iso_pu_bacteria 8055878733 8055881508 283
8 iso_pu_bacteria 8056120720 8056124926 284
9 iso_pu_bacteria 8056115690 8056117376 285
10 iso_pu_bacteria 2643221571 2643873030 286
11 iso_pu_bacteria 2675903420 2677897294 286
12 iso_pu_bacteria 2808606385 2808975677 286
13 iso_pu_bacteria 2808606388 2808990684 286
14 iso_pu_bacteria 2852612431 2852615031 286
15 iso_pu_bacteria 2852667396 2852669999 286
16 iso_pu_bacteria 2947233263 2947236266 286
17 iso_pu_bacteria 8054503363 8054504983 286
18 iso_pu_bacteria 8056148874 8056149617 286
19 iso_pu_bacteria 8056161164 8056164777 286
20 iso_pu_bacteria 8054929484 8054933194 287
21 3300048927 Ga0496124_0013455 Ga0496124_0013455_6249_7115 288
22 iso_pu_bacteria 2511231010 2511289274 288
23 iso_pu_bacteria 2548876994 2550694688 288
24 iso_pu_bacteria 2600255318 2601796749 288
25 iso_pu_bacteria 2603880185 2606073898 288
26 iso_pu_bacteria 2603880199 2606126457 288
27 iso_pu_bacteria 2623620443 2624482447 288
28 iso_pu_bacteria 2765235841 2765585738 288
29 iso_pu_bacteria 2878029506 2878034374 288
30 iso_pu_bacteria 2912963787 2912968017 288
31 iso_pu_bacteria 2919063839 2919066567 288
32 iso_pu_bacteria 2939651529 2939652493 288
33 iso_pu_bacteria 3007718800 3007720154 288
34 2124908027 MRS2a_Contig_7842 MRS2a_00693250 289
35 3300025711 Ga0207696_1026490 Ga0207696_10264902 289
36 3300025735 Ga0207713_1028810 Ga0207713_10288101 289
37 iso_pu_bacteria 2511231004 2511254312 289
38 iso_pu_bacteria 2511231006 2511268322 289
39 iso_pu_bacteria 2511231007 2511272189 289
40 iso_pu_bacteria 2511231008 2511277702 289
41 iso_pu_bacteria 2511231011 2511296546 289
42 iso_pu_bacteria 2511231012 2511303836 289
43 iso_pu_bacteria 2511231014 2511313601 289
44 iso_pu_bacteria 2511231015 2511317545 289
45 iso_pu_bacteria 2511231016 2511326549 289
46 iso_pu_bacteria 2511231017 2511334767 289
47 iso_pu_bacteria 2511231018 2511341041 289
48 iso_pu_bacteria 2511231019 2511345815 289
49 iso_pu_bacteria 2511231020 2511352039 289
50 iso_pu_bacteria 2511231021 2511357836 289
51 iso_pu_bacteria 2511231022 2511361841 289
52 iso_pu_bacteria 2511231023 2511371051 289
53 iso_pu_bacteria 2511231031 2511412831 289
54 iso_pu_bacteria 2511231156 2511826666 289
55 iso_pu_bacteria 2582580891 2583794237 289
56 iso_pu_bacteria 2597489887 2597859824 289
57 iso_pu_bacteria 2599185160 2599354107 289
58 iso_pu_bacteria 2599185161 2599360214 289
59 iso_pu_bacteria 2599185162 2599366536 289
60 iso_pu_bacteria 2599185163 2599373325 289
61 iso_pu_bacteria 2599185164 2599379215 289
62 iso_pu_bacteria 2599185165 2599385807 289
63 iso_pu_bacteria 2599185166 2599392184 289
64 iso_pu_bacteria 2599185168 2599403950 289
65 iso_pu_bacteria 2599185181 2599460941 289
66 iso_pu_bacteria 2599185182 2599470488 289
67 iso_pu_bacteria 2599185185 2599482654 289
68 iso_pu_bacteria 2599185186 2599489962 289
69 iso_pu_bacteria 2599185188 2599502990 289
70 iso_pu_bacteria 2599185212 2599616468 289
71 iso_pu_bacteria 2599185248 2599770896 289
72 iso_pu_bacteria 2599185257 2599803624 289
73 iso_pu_bacteria 2599185289 2599886049 289
74 iso_pu_bacteria 2599185291 2599897763 289
75 iso_pu_bacteria 2599185300 2599929984 289
76 iso_pu_bacteria 2599185302 2599944850 289
77 iso_pu_bacteria 2599185304 2599957169 289
78 iso_pu_bacteria 2599185305 2599960074 289
79 iso_pu_bacteria 2599185306 2599967189 289
80 iso_pu_bacteria 2599185308 2599980839 289
81 iso_pu_bacteria 2599185309 2599986715 289
82 iso_pu_bacteria 2599185310 2599990128 289
83 iso_pu_bacteria 2599185311 2599996087 289
84 iso_pu_bacteria 2599185312 2600000606 289
85 iso_pu_bacteria 2599185313 2600005276 289
86 iso_pu_bacteria 2599185314 2600014715 289
87 iso_pu_bacteria 2599185315 2600017577 289
88 iso_pu_bacteria 2599185316 2600025851 289
89 iso_pu_bacteria 2599185317 2600028774 289
90 iso_pu_bacteria 2599185318 2600033557 289
91 iso_pu_bacteria 2599185319 2600040151 289
92 iso_pu_bacteria 2599185320 2600047562 289
93 iso_pu_bacteria 2599185321 2600053692 289
94 iso_pu_bacteria 2599185322 2600059125 289
95 iso_pu_bacteria 2599185323 2600064363 289
96 iso_pu_bacteria 2599185324 2600074218 289
97 iso_pu_bacteria 2599185325 2600077190 289
98 iso_pu_bacteria 2599185356 2600213556 289
99 iso_pu_bacteria 2600254930 2600357942 289
100 iso_pu_bacteria 2600254931 2600365111 289
101 iso_pu_bacteria 2600255313 2601773723 289
102 iso_pu_bacteria 2623620446 2624490522 289
103 iso_pu_bacteria 2643221565 2643841453 289
104 iso_pu_bacteria 2643221589 2643955249 289
105 iso_pu_bacteria 2643221602 2644023602 289
106 iso_pu_bacteria 2643221633 2644186276 289
107 iso_pu_bacteria 2643221650 2644287068 289
108 iso_pu_bacteria 2651869719 2652548154 289
109 iso_pu_bacteria 2667528170 2671089857 289
110 iso_pu_bacteria 2667528171 2671096689 289
111 iso_pu_bacteria 2667528176 2671125507 289
112 iso_pu_bacteria 2671180172 2671770808 289
113 iso_pu_bacteria 2675903515 2678265016 289
114 iso_pu_bacteria 2713897148 2715750441 289
115 iso_pu_bacteria 2718217725 2718635649 289
116 iso_pu_bacteria 2738543004 2739196658 289
117 iso_pu_bacteria 2738543015 2739257636 289
118 iso_pu_bacteria 2738543025 2739313506 289
119 iso_pu_bacteria 2740892503 2743739366 289
120 iso_pu_bacteria 2744054620 2745005472 289
121 iso_pu_bacteria 2773857670 2774122926 289
122 iso_pu_bacteria 2773857673 2774133328 289
123 iso_pu_bacteria 2784132063 2784262797 289
124 iso_pu_bacteria 2784132072 2784315284 289
125 iso_pu_bacteria 2791355520 2794595661 289
126 iso_pu_bacteria 2808606377 2808933422 289
127 iso_pu_bacteria 2808606379 2808941186 289
128 iso_pu_bacteria 2808606381 2808955544 289
129 iso_pu_bacteria 2808606382 2808958586 289
130 iso_pu_bacteria 2808606445 2809218318 289
131 iso_pu_bacteria 2818991456 2819656125 289
132 iso_pu_bacteria 2818991464 2819701782 289
133 iso_pu_bacteria 2825651385 2825656084 289
134 iso_pu_bacteria 2842832357 2842837302 289
135 iso_pu_bacteria 2842843487 2842845094 289
136 iso_pu_bacteria 2842854478 2842856486 289
137 iso_pu_bacteria 2844665904 2844672258 289
138 iso_pu_bacteria 2852657418 2852660815 289
139 iso_pu_bacteria 2860339153 2860341294 289
140 iso_pu_bacteria 2880230671 2880235007 289
141 iso_pu_bacteria 2904518522 2904524061 289
142 iso_pu_bacteria 2904550169 2904555339 289
143 iso_pu_bacteria 2913036834 2913041618 289
144 iso_pu_bacteria 2917070673 2917075608 289
145 iso_pu_bacteria 2919385768 2919388447 289
146 iso_pu_bacteria 2919456309 2919459394 289
147 iso_pu_bacteria 2919481497 2919484569 289
148 iso_pu_bacteria 2919487758 2919490234 289
149 iso_pu_bacteria 2919697872 2919701717 289
150 iso_pu_bacteria 2923153595 2923158451 289
151 iso_pu_bacteria 2923586266 2923590273 289
152 iso_pu_bacteria 2929144301 2929148958 289
153 iso_pu_bacteria 2931369376 2931373626 289
154 iso_pu_bacteria 2931396565 2931397031 289
155 iso_pu_bacteria 2935353572 2935356597 289
156 iso_pu_bacteria 2939636861 2939637124 289
157 iso_pu_bacteria 2969304461 2969309149 289
158 iso_pu_bacteria 2974289157 2974289480 289
159 iso_pu_bacteria 2984286254 2984287718 289
160 iso_pu_bacteria 2988728565 2988730547 289
161 iso_pu_bacteria 2998139840 2998144435 289
162 iso_pu_bacteria 3007395558 3007397726 289
163 iso_pu_bacteria 3007419365 3007420975 289
164 iso_pu_bacteria 3007511990 3007516225 289
165 iso_pu_bacteria 3007614139 3007618323 289
166 iso_pu_bacteria 3007619802 3007621795 289
167 iso_pu_bacteria 3007855910 3007858582 289
168 iso_pu_bacteria 3007861166 3007865889 289
169 iso_pu_bacteria 637000220 637322149 289
170 iso_pu_bacteria 8011350971 8011354221 289
171 iso_pu_bacteria 8015687852 8015692540 289
172 iso_pu_bacteria 8019769354 8019771519 289
173 iso_pu_bacteria 8019775933 8019780849 289
174 iso_pu_bacteria 8029995093 8029996445 289
175 iso_pu_bacteria 8055770955 8055775772 289
176 iso_pu_bacteria 8056125926 8056130721 289
177 iso_pu_bacteria 8056143049 8056144441 289
178 iso_pu_bacteria 8056155041 8056155413 289
179 iso_pu_bacteria 8056166840 8056172138 289
180 iso_pu_bacteria 8056172158 8056172813 289
181 iso_pu_bacteria 8056177738 8056183336 289
182 iso_pu_bacteria 8056569372 8056572513 289
183 3300005344 Ga0070661_100000060 Ga0070661_10000006010 290
184 3300005564 Ga0070664_100000139 Ga0070664_10000013934 290
185 3300009011 Ga0105251_10004540 Ga0105251_100045401 290
186 3300009036 Ga0105244_10001072 Ga0105244_100010729 290
187 3300009036 Ga0105244_10028014 Ga0105244_100280142 290
188 3300009092 Ga0105250_10000254 Ga0105250_1000025426 290
189 3300009176 Ga0105242_10000809 Ga0105242_1000080913 290
190 3300009545 Ga0105237_10000640 Ga0105237_1000064038 290
191 3300013100 Ga0157373_10063789 Ga0157373_100637893 290
192 3300013104 Ga0157370_10141550 Ga0157370_101415503 290
193 3300013105 Ga0157369_10000562 Ga0157369_1000056223 290
194 3300013306 Ga0163162_10222543 Ga0163162_102225432 290
195 3300013306 Ga0163162_10246026 Ga0163162_102460263 290
196 3300013308 Ga0157375_10121151 Ga0157375_101211512 290
197 3300017792 Ga0163161_10008306 Ga0163161_100083069 290
198 3300025711 Ga0207696_1000063 Ga0207696_1000063123 290
199 3300025728 Ga0207655_1000250 Ga0207655_100025043 290
200 3300025728 Ga0207655_1004365 Ga0207655_10043652 290
201 3300025735 Ga0207713_1000230 Ga0207713_100023071 290
202 3300025914 Ga0207671_10000566 Ga0207671_1000056638 290
203 3300025920 Ga0207649_10000002 Ga0207649_10000002168 290
204 3300025945 Ga0207679_10000006 Ga0207679_10000006323 290
205 3300031731 Ga0307405_10000116 Ga0307405_1000011625 290
206 3300046512 Ga0495610_0002167 Ga0495610_0002167_4619_5509 290
207 3300046512 Ga0495610_0048338 Ga0495610_0048338_1052_1930 290
208 3300046530 Ga0495654_0002767 Ga0495654_0002767_4595_5485 290
209 3300046530 Ga0495654_0119557 Ga0495654_0119557_144_1022 290
210 3300046648 Ga0495611_0052496 Ga0495611_0052496_594_1466 290
211 3300048920 Ga0496117_0066729 Ga0496117_0066729_443_1315 290
212 3300048921 Ga0496118_0028217 Ga0496118_0028217_3176_4048 290
213 3300048921 Ga0496118_0061183 Ga0496118_0061183_110_982 290
214 3300048923 Ga0496120_0041278 Ga0496120_0041278_1728_2600 290
215 3300048924 Ga0496121_0030644 Ga0496121_0030644_2160_3032 290
216 3300048925 Ga0496122_0101007 Ga0496122_0101007_667_1539 290
217 3300048926 Ga0496123_0014039 Ga0496123_0014039_504_1376 290
218 3300048927 Ga0496124_0017225 Ga0496124_0017225_4851_5723 290
219 3300048927 Ga0496124_0033779 Ga0496124_0033779_1993_2865 290
220 3300048927 Ga0496124_0053046 Ga0496124_0053046_291_1163 290
221 3300048928 Ga0496125_0087892 Ga0496125_0087892_379_1257 290
222 3300048929 Ga0496126_0013799 Ga0496126_0013799_5415_6287 290
223 iso_pu_bacteria 2599185288 2599880063 290
224 iso_pu_bacteria 2738541294 2738809534 290
225 iso_pu_bacteria 2738541309 2738896894 290
226 3300009011 Ga0105251_10003324 Ga0105251_100033248 291
227 3300013102 Ga0157371_10000101 Ga0157371_100001014 291
228 3300025711 Ga0207696_1012454 Ga0207696_10124543 291
229 3300025728 Ga0207655_1000516 Ga0207655_10005165 291
230 3300025735 Ga0207713_1004387 Ga0207713_10043879 291
231 3300025735 Ga0207713_1005361 Ga0207713_10053616 291
232 3300027296 Ga0209389_1000002 Ga0209389_1000002208 291
233 3300042010 Ga0439452_002674 Ga0439452_002674_320_1195 291
234 3300042142 Ga0450905_000743 Ga0450905_000743_328_1203 291
235 3300042439 Ga0439464_0004027 Ga0439464_0004027_453_1328 291
236 3300046522 Ga0495643_0000795 Ga0495643_0000795_8292_9167 291
237 3300048917 Ga0496114_0005561 Ga0496114_0005561_4821_5696 291
238 3300048920 Ga0496117_0006033 Ga0496117_0006033_11535_12410 291
239 3300048920 Ga0496117_0013986 Ga0496117_0013986_5497_6432 291
240 3300048921 Ga0496118_0001275 Ga0496118_0001275_13884_14819 291
241 3300048921 Ga0496118_0008333 Ga0496118_0008333_1860_2735 291
242 3300048926 Ga0496123_0000391 Ga0496123_0000391_64984_65859 291
243 3300048927 Ga0496124_0010268 Ga0496124_0010268_7319_8194 291
244 3300048928 Ga0496125_0028636 Ga0496125_0028636_1804_2679 291
245 3300049571 Ga0501034_0000137 Ga0501034_0000137_57759_58634 291
246 3300053135 Ga0500659_0000763 Ga0500659_0000763_7273_8148 291
247 iso_pu_bacteria 2713897149 2715755159 291
248 3300003781 Ga0055536_1000295 Ga0055536_100029517 292
249 3300003791 Ga0055530_10000433 Ga0055530_1000043315 292
250 3300003792 Ga0055540_1000309 Ga0055540_100030915 292
251 3300003794 Ga0055531_10000113 Ga0055531_1000011326 292
252 3300003794 Ga0055531_10000306 Ga0055531_1000030636 292
253 3300005353 Ga0070669_100034870 Ga0070669_1000348702 292
254 3300009148 Ga0105243_10000383 Ga0105243_1000038314 292
255 3300011119 Ga0105246_10000366 Ga0105246_1000036619 292
256 3300015261 Ga0182006_1107483 Ga0182006_11074831 292
257 3300025291 Ga0209675_1004616 Ga0209675_10046162 292
258 3300025292 Ga0209676_1000010 Ga0209676_1000010579 292
259 3300025298 Ga0209050_1000019 Ga0209050_1000019283 292
260 3300025303 Ga0209051_1000138 Ga0209051_100013872 292
261 3300025304 Ga0209257_1000405 Ga0209257_100040545 292
262 3300025728 Ga0207655_1001578 Ga0207655_100157815 292
263 3300025735 Ga0207713_1000515 Ga0207713_100051525 292
264 3300025735 Ga0207713_1022856 Ga0207713_10228561 292
265 3300025935 Ga0207709_10000013 Ga0207709_10000013312 292
266 3300041407 Ga0439447_051559 Ga0439447_051559_89_967 292
267 3300041411 Ga0439466_0005091 Ga0439466_0005091_2587_3465 292
268 3300042006 Ga0439432_055646 Ga0439432_055646_198_1076 292
269 3300042009 Ga0439451_004822 Ga0439451_004822_1240_2118 292
270 3300042010 Ga0439452_003151 Ga0439452_003151_1628_2506 292
271 3300042013 Ga0439456_000246 Ga0439456_000246_3308_4189 292
272 3300042016 Ga0439463_002092 Ga0439463_002092_4203_5090 292
273 3300042461 Ga0439460_0045888 Ga0439460_0045888_366_1244 292
274 3300042533 Ga0450901_005212 Ga0450901_005212_38_916 292
275 3300048926 Ga0496123_0040786 Ga0496123_0040786_903_1784 292
276 3300048927 Ga0496124_0000145 Ga0496124_0000145_90928_91815 292
277 3300048927 Ga0496124_0007252 Ga0496124_0007252_3589_4470 292
278 3300048928 Ga0496125_0005725 Ga0496125_0005725_5898_6779 292
279 3300048929 Ga0496126_0057063 Ga0496126_0057063_181_1062 292
280 iso_pu_bacteria 2599185307 2599973198 292
281 iso_pu_bacteria 2738541271 2738689683 292
282 iso_pu_bacteria 2738543016 2739265457 292
283 2124908027 MRS2a_Contig_5569 MRS2a_00441980 293
284 2124908027 MRS2a_Contig_68 MRS2a_00539360 293
285 2124908027 MRS2a_Contig_9059 MRS2a_00460360 293
286 2162886007 SwRhRL2b_contig_3176154 SwRhRL2b_0146.00001470 293
287 3300002737 JGI25162J39368_1000297 JGI25162J39368_100029732 293
288 3300002771 JGI25163J39215_1000602 JGI25163J39215_10006028 293
289 3300002771 JGI25163J39215_1000696 JGI25163J39215_10006963 293
290 3300002772 JGI25164J39214_1000254 JGI25164J39214_100025431 293
291 3300002772 JGI25164J39214_1000482 JGI25164J39214_100048213 293
292 3300003214 JGI25165J46597_1000403 JGI25165J46597_100040332 293
293 3300003214 JGI25165J46597_1000465 JGI25165J46597_100046510 293
294 3300003791 Ga0055530_10000047 Ga0055530_1000004741 293
295 3300003791 Ga0055530_10000783 Ga0055530_1000078312 293
296 3300003792 Ga0055540_1000083 Ga0055540_100008355 293
297 3300003792 Ga0055540_1001345 Ga0055540_100134515 293
298 3300005288 Ga0065714_10008045 Ga0065714_100080453 293
299 3300005288 Ga0065714_10067507 Ga0065714_100675076 293
300 3300005288 Ga0065714_10138192 Ga0065714_101381921 293
301 3300005289 Ga0065704_10079756 Ga0065704_100797563 293
302 3300005290 Ga0065712_10009601 Ga0065712_100096012 293
303 3300006051 Ga0075364_10242873 Ga0075364_102428732 293
304 3300006058 Ga0075432_10000292 Ga0075432_1000029214 293
305 3300006058 Ga0075432_10009006 Ga0075432_100090063 293
306 3300006058 Ga0075432_10011321 Ga0075432_100113211 293
307 3300006058 Ga0075432_10030466 Ga0075432_100304663 293
308 3300006946 Ga0079104_1000168 Ga0079104_10001682 293
309 3300006946 Ga0079104_1000349 Ga0079104_100034915 293
310 3300006946 Ga0079104_1009472 Ga0079104_10094723 293
311 3300006948 Ga0099826_10011991 Ga0099826_100119913 293
312 3300009011 Ga0105251_10000004 Ga0105251_10000004157 293
313 3300009011 Ga0105251_10010592 Ga0105251_100105922 293
314 3300009011 Ga0105251_10062627 Ga0105251_100626272 293
315 3300009036 Ga0105244_10044200 Ga0105244_100442003 293
316 3300009036 Ga0105244_10071615 Ga0105244_100716152 293
317 3300009036 Ga0105244_10072980 Ga0105244_100729802 293
318 3300009036 Ga0105244_10159853 Ga0105244_101598531 293
319 3300009092 Ga0105250_10000532 Ga0105250_1000053214 293
320 3300009092 Ga0105250_10001755 Ga0105250_100017556 293
321 3300009092 Ga0105250_10002082 Ga0105250_100020823 293
322 3300009148 Ga0105243_10000873 Ga0105243_1000087313 293
323 3300009148 Ga0105243_10014168 Ga0105243_100141685 293
324 3300009148 Ga0105243_10278911 Ga0105243_102789112 293
325 3300009148 Ga0105243_10529485 Ga0105243_105294851 293
326 3300009553 Ga0105249_10361374 Ga0105249_103613742 293
327 3300011119 Ga0105246_10097837 Ga0105246_100978371 293
328 3300012498 Ga0157345_1000101 Ga0157345_100010114 293
329 3300013100 Ga0157373_10006083 Ga0157373_100060834 293
330 3300013100 Ga0157373_10008006 Ga0157373_100080062 293
331 3300013100 Ga0157373_10056785 Ga0157373_100567852 293
332 3300013100 Ga0157373_10133854 Ga0157373_101338541 293
333 3300013102 Ga0157371_10002072 Ga0157371_1000207213 293
334 3300013102 Ga0157371_10002419 Ga0157371_100024194 293
335 3300013102 Ga0157371_10003573 Ga0157371_100035738 293
336 3300013104 Ga0157370_10042214 Ga0157370_100422143 293
337 3300013104 Ga0157370_10294286 Ga0157370_102942861 293
338 3300013104 Ga0157370_10366529 Ga0157370_103665291 293
339 3300013104 Ga0157370_10400923 Ga0157370_104009231 293
340 3300013105 Ga0157369_10484115 Ga0157369_104841152 293
341 3300013306 Ga0163162_10000620 Ga0163162_1000062021 293
342 3300013307 Ga0157372_10003234 Ga0157372_100032344 293
343 3300013308 Ga0157375_10341375 Ga0157375_103413751 293
344 3300014497 Ga0182008_10000997 Ga0182008_1000099710 293
345 3300014497 Ga0182008_10003736 Ga0182008_100037361 293
346 3300014497 Ga0182008_10009472 Ga0182008_100094723 293
347 3300014497 Ga0182008_10017920 Ga0182008_100179203 293
348 3300014497 Ga0182008_10034910 Ga0182008_100349102 293
349 3300015261 Ga0182006_1001170 Ga0182006_100117011 293
350 3300015261 Ga0182006_1011627 Ga0182006_10116273 293
351 3300015261 Ga0182006_1016494 Ga0182006_10164942 293
352 3300015261 Ga0182006_1019515 Ga0182006_10195152 293
353 3300015261 Ga0182006_1023137 Ga0182006_10231372 293
354 3300015261 Ga0182006_1030244 Ga0182006_10302442 293
355 3300015262 Ga0182007_10007005 Ga0182007_100070052 293
356 3300015262 Ga0182007_10015848 Ga0182007_100158483 293
357 3300015265 Ga0182005_1011690 Ga0182005_10116901 293
358 3300017792 Ga0163161_10060948 Ga0163161_100609482 293
359 3300025207 Ga0209760_100132 Ga0209760_10013225 293
360 3300025207 Ga0209760_100172 Ga0209760_10017210 293
361 3300025230 Ga0209563_100410 Ga0209563_1004103 293
362 3300025231 Ga0207427_100004 Ga0207427_100004288 293
363 3300025231 Ga0207427_100007 Ga0207427_100007329 293
364 3300025233 Ga0209437_100006 Ga0209437_100006595 293
365 3300025233 Ga0209437_100028 Ga0209437_100028124 293
366 3300025256 Ga0209759_1002314 Ga0209759_10023147 293
367 3300025261 Ga0209233_1000008 Ga0209233_1000008835 293
368 3300025261 Ga0209233_1000059 Ga0209233_1000059400 293
369 3300025292 Ga0209676_1000006 Ga0209676_1000006578 293
370 3300025292 Ga0209676_1000834 Ga0209676_10008348 293
371 3300025292 Ga0209676_1006865 Ga0209676_10068652 293
372 3300025298 Ga0209050_1000027 Ga0209050_1000027154 293
373 3300025298 Ga0209050_1000065 Ga0209050_100006560 293
374 3300025298 Ga0209050_1000792 Ga0209050_100079216 293
375 3300025303 Ga0209051_1000065 Ga0209051_100006568 293
376 3300025303 Ga0209051_1000189 Ga0209051_100018960 293
377 3300025304 Ga0209257_1008055 Ga0209257_10080553 293
378 3300025711 Ga0207696_1000044 Ga0207696_100004461 293
379 3300025711 Ga0207696_1000073 Ga0207696_1000073188 293
380 3300025711 Ga0207696_1001156 Ga0207696_10011562 293
381 3300025711 Ga0207696_1026356 Ga0207696_10263562 293
382 3300025728 Ga0207655_1000005 Ga0207655_1000005627 293
383 3300025728 Ga0207655_1004246 Ga0207655_10042468 293
384 3300025728 Ga0207655_1004505 Ga0207655_10045055 293
385 3300025728 Ga0207655_1015168 Ga0207655_10151683 293
386 3300025728 Ga0207655_1021305 Ga0207655_10213053 293
387 3300025735 Ga0207713_1000013 Ga0207713_1000013201 293
388 3300025735 Ga0207713_1002677 Ga0207713_10026773 293
389 3300025735 Ga0207713_1005667 Ga0207713_10056673 293
390 3300025735 Ga0207713_1006830 Ga0207713_10068304 293
391 3300025735 Ga0207713_1017410 Ga0207713_10174102 293
392 3300025735 Ga0207713_1042409 Ga0207713_10424092 293
393 3300025932 Ga0207690_10094180 Ga0207690_100941802 293
394 3300025935 Ga0207709_10000333 Ga0207709_1000033333 293
395 3300025935 Ga0207709_10009929 Ga0207709_100099292 293
396 3300025937 Ga0207669_10211970 Ga0207669_102119702 293
397 3300027111 Ga0209281_1000015 Ga0209281_1000015409 293
398 3300027111 Ga0209281_1000049 Ga0209281_1000049167 293
399 3300027666 Ga0209282_1008662 Ga0209282_10086623 293
400 3300027876 Ga0209974_10040212 Ga0209974_100402122 293
401 3300027907 Ga0207428_10017953 Ga0207428_100179534 293
402 3300027907 Ga0207428_10024556 Ga0207428_100245562 293
403 3300027907 Ga0207428_10054102 Ga0207428_100541021 293
404 3300027907 Ga0207428_10120152 Ga0207428_101201522 293
405 3300027907 Ga0207428_10160424 Ga0207428_101604242 293
406 3300027907 Ga0207428_10376722 Ga0207428_103767221 293
407 3300028379 Ga0268266_10017290 Ga0268266_100172903 293
408 3300030521 Ga0307511_10036008 Ga0307511_100360081 293
409 3300030731 Ga0316177_1207043 Ga0316177_12070432 293
410 3300030733 Ga0314311_1027865 Ga0314311_10278652 293
411 3300030744 Ga0316181_1119635 Ga0316181_11196352 293
412 3300031548 Ga0307408_100011721 Ga0307408_1000117214 293
413 3300031548 Ga0307408_100028613 Ga0307408_1000286132 293
414 3300031548 Ga0307408_100028931 Ga0307408_1000289312 293
415 3300031548 Ga0307408_100285728 Ga0307408_1002857281 293
416 3300031730 Ga0307516_10322728 Ga0307516_103227281 293
417 3300031731 Ga0307405_10004506 Ga0307405_100045062 293
418 3300031824 Ga0307413_10002809 Ga0307413_100028092 293
419 3300031901 Ga0307406_10012640 Ga0307406_100126402 293
420 3300031903 Ga0307407_10395089 Ga0307407_103950891 293
421 3300031911 Ga0307412_10002059 Ga0307412_100020596 293
422 3300031911 Ga0307412_10025605 Ga0307412_100256052 293
423 3300031911 Ga0307412_10272726 Ga0307412_102727261 293
424 3300031911 Ga0307412_10320248 Ga0307412_103202481 293
425 3300031995 Ga0307409_100040463 Ga0307409_1000404632 293
426 3300032002 Ga0307416_100107615 Ga0307416_1001076152 293
427 3300032004 Ga0307414_10126211 Ga0307414_101262112 293
428 3300032004 Ga0307414_10370560 Ga0307414_103705602 293
429 3300032005 Ga0307411_10031381 Ga0307411_100313813 293
430 3300032005 Ga0307411_10138754 Ga0307411_101387541 293
431 3300041405 Ga0439438_001994 Ga0439438_001994_5666_6547 293
432 3300041405 Ga0439438_002237 Ga0439438_002237_6864_7745 293
433 3300041405 Ga0439438_002288 Ga0439438_002288_236_1117 293
434 3300041405 Ga0439438_002470 Ga0439438_002470_6478_7359 293
435 3300041405 Ga0439438_003657 Ga0439438_003657_4551_5432 293
436 3300041405 Ga0439438_006974 Ga0439438_006974_830_1711 293
437 3300041405 Ga0439438_017621 Ga0439438_017621_1046_1927 293
438 3300041407 Ga0439447_000378 Ga0439447_000378_5788_6669 293
439 3300041407 Ga0439447_002781 Ga0439447_002781_5070_5951 293
440 3300041407 Ga0439447_004557 Ga0439447_004557_2667_3566 293
441 3300041407 Ga0439447_008045 Ga0439447_008045_2064_2945 293
442 3300041407 Ga0439447_009541 Ga0439447_009541_1557_2438 293
443 3300041407 Ga0439447_013417 Ga0439447_013417_890_1771 293
444 3300041411 Ga0439466_0000179 Ga0439466_0000179_12185_13066 293
445 3300041411 Ga0439466_0003838 Ga0439466_0003838_4064_4945 293
446 3300041411 Ga0439466_0005754 Ga0439466_0005754_2781_3680 293
447 3300041411 Ga0439466_0030067 Ga0439466_0030067_823_1704 293
448 3300041997 Ga0439431_0011682 Ga0439431_0011682_923_1822 293
449 3300041997 Ga0439431_0012298 Ga0439431_0012298_541_1422 293
450 3300042004 Ga0439445_0017486 Ga0439445_0017486_562_1443 293
451 3300042004 Ga0439445_0032633 Ga0439445_0032633_179_1060 293
452 3300042006 Ga0439432_000903 Ga0439432_000903_1371_2270 293
453 3300042006 Ga0439432_001809 Ga0439432_001809_6847_7728 293
454 3300042006 Ga0439432_003207 Ga0439432_003207_4791_5672 293
455 3300042006 Ga0439432_006683 Ga0439432_006683_2272_3153 293
456 3300042009 Ga0439451_003644 Ga0439451_003644_710_1591 293
457 3300042010 Ga0439452_000099 Ga0439452_000099_12136_13017 293
458 3300042010 Ga0439452_000668 Ga0439452_000668_11955_12836 293
459 3300042010 Ga0439452_000919 Ga0439452_000919_9684_10565 293
460 3300042010 Ga0439452_005738 Ga0439452_005738_82_981 293
461 3300042010 Ga0439452_015877 Ga0439452_015877_900_1781 293
462 3300042010 Ga0439452_016974 Ga0439452_016974_275_1156 293
463 3300042010 Ga0439452_024715 Ga0439452_024715_96_977 293
464 3300042010 Ga0439452_028511 Ga0439452_028511_279_1160 293
465 3300042013 Ga0439456_000399 Ga0439456_000399_2480_3361 293
466 3300042013 Ga0439456_003334 Ga0439456_003334_1653_2534 293
467 3300042013 Ga0439456_029064 Ga0439456_029064_79_966 293
468 3300042013 Ga0439456_044978 Ga0439456_044978_48_938 293
469 3300042016 Ga0439463_000803 Ga0439463_000803_2182_3063 293
470 3300042016 Ga0439463_004540 Ga0439463_004540_1384_2265 293
471 3300042016 Ga0439463_012906 Ga0439463_012906_432_1313 293
472 3300042016 Ga0439463_013809 Ga0439463_013809_220_1125 293
473 3300042115 Ga0450911_000270 Ga0450911_000270_6466_7347 293
474 3300042115 Ga0450911_002474 Ga0450911_002474_1493_2374 293
475 3300042115 Ga0450911_006604 Ga0450911_006604_28_909 293
476 3300042121 Ga0450919_001044 Ga0450919_001044_497_1378 293
477 3300042121 Ga0450919_008914 Ga0450919_008914_225_1106 293
478 3300042124 Ga0450922_001164 Ga0450922_001164_274_1155 293
479 3300042124 Ga0450922_003439 Ga0450922_003439_253_1134 293
480 3300042125 Ga0450923_010671 Ga0450923_010671_703_1602 293
481 3300042127 Ga0450890_000336 Ga0450890_000336_2199_3080 293
482 3300042129 Ga0450891_001080 Ga0450891_001080_1660_2547 293
483 3300042137 Ga0450902_006972 Ga0450902_006972_472_1353 293
484 3300042138 Ga0450903_002464 Ga0450903_002464_2358_3239 293
485 3300042138 Ga0450903_004668 Ga0450903_004668_1199_2080 293
486 3300042138 Ga0450903_009451 Ga0450903_009451_346_1227 293
487 3300042138 Ga0450903_010646 Ga0450903_010646_233_1114 293
488 3300042139 Ga0450904_000986 Ga0450904_000986_1312_2193 293
489 3300042142 Ga0450905_010455 Ga0450905_010455_101_982 293
490 3300042145 Ga0450906_000116 Ga0450906_000116_3494_4375 293
491 3300042145 Ga0450906_003424 Ga0450906_003424_945_1826 293
492 3300042145 Ga0450906_009265 Ga0450906_009265_765_1646 293
493 3300042146 Ga0450907_000077 Ga0450907_000077_24323_25204 293
494 3300042146 Ga0450907_005182 Ga0450907_005182_381_1262 293
495 3300042146 Ga0450907_017206 Ga0450907_017206_130_1011 293
496 3300042147 Ga0450910_001982 Ga0450910_001982_827_1708 293
497 3300042147 Ga0450910_005181 Ga0450910_005181_141_1022 293
498 3300042156 Ga0439446_0000301 Ga0439446_0000301_3508_4407 293
499 3300042184 Ga0450908_008750 Ga0450908_008750_92_973 293
500 3300042185 Ga0450909_003200 Ga0450909_003200_155_1036 293
501 3300042185 Ga0450909_005640 Ga0450909_005640_21_902 293
502 3300042435 Ga0439434_0001883 Ga0439434_0001883_5144_6043 293
503 3300042435 Ga0439434_0002522 Ga0439434_0002522_348_1229 293
504 3300046452 Ga0495617_001173 Ga0495617_001173_1361_2242 293
505 3300046452 Ga0495617_003803 Ga0495617_003803_1432_2313 293
506 3300046452 Ga0495617_004597 Ga0495617_004597_861_1742 293
507 3300046452 Ga0495617_007982 Ga0495617_007982_2501_3418 293
508 3300046452 Ga0495617_013324 Ga0495617_013324_1067_1948 293
509 3300046452 Ga0495617_021469 Ga0495617_021469_1102_1983 293
510 3300046452 Ga0495617_027261 Ga0495617_027261_448_1329 293
511 3300046452 Ga0495617_030493 Ga0495617_030493_51_932 293
512 3300046453 Ga0495627_000821 Ga0495627_000821_9248_10129 293
513 3300046453 Ga0495627_001680 Ga0495627_001680_5852_6733 293
514 3300046453 Ga0495627_013802 Ga0495627_013802_790_1680 293
515 3300046453 Ga0495627_024885 Ga0495627_024885_742_1623 293
516 3300046453 Ga0495627_057130 Ga0495627_057130_58_939 293
517 3300046454 Ga0495592_0211069 Ga0495592_0211069_76_957 293
518 3300046455 Ga0495603_0016183 Ga0495603_0016183_3528_4409 293
519 3300046455 Ga0495603_0040651 Ga0495603_0040651_1101_1982 293
520 3300046455 Ga0495603_0152662 Ga0495603_0152662_426_1307 293
521 3300046457 Ga0495590_0001428 Ga0495590_0001428_379_1260 293
522 3300046457 Ga0495590_0007846 Ga0495590_0007846_1788_2669 293
523 3300046457 Ga0495590_0008283 Ga0495590_0008283_474_1355 293
524 3300046457 Ga0495590_0013809 Ga0495590_0013809_702_1583 293
525 3300046457 Ga0495590_0065528 Ga0495590_0065528_86_967 293
526 3300046457 Ga0495590_0065629 Ga0495590_0065629_150_1031 293
527 3300046458 Ga0495591_000672 Ga0495591_000672_11497_12378 293
528 3300046458 Ga0495591_000838 Ga0495591_000838_18137_19018 293
529 3300046458 Ga0495591_000865 Ga0495591_000865_8055_8936 293
530 3300046458 Ga0495591_001019 Ga0495591_001019_1174_2091 293
531 3300046458 Ga0495591_001130 Ga0495591_001130_12705_13586 293
532 3300046458 Ga0495591_001425 Ga0495591_001425_7901_8806 293
533 3300046458 Ga0495591_004241 Ga0495591_004241_2263_3153 293
534 3300046458 Ga0495591_004343 Ga0495591_004343_1874_2755 293
535 3300046458 Ga0495591_007900 Ga0495591_007900_263_1144 293
536 3300046458 Ga0495591_015677 Ga0495591_015677_829_1710 293
537 3300046458 Ga0495591_017199 Ga0495591_017199_1559_2440 293
538 3300046458 Ga0495591_020134 Ga0495591_020134_129_1010 293
539 3300046458 Ga0495591_023071 Ga0495591_023071_757_1638 293
540 3300046458 Ga0495591_028313 Ga0495591_028313_726_1616 293
541 3300046458 Ga0495591_030321 Ga0495591_030321_710_1591 293
542 3300046459 Ga0495629_0002791 Ga0495629_0002791_10719_11600 293
543 3300046460 Ga0495638_0002825 Ga0495638_0002825_4195_5076 293
544 3300046460 Ga0495638_0003398 Ga0495638_0003398_1290_2171 293
545 3300046460 Ga0495638_0016071 Ga0495638_0016071_321_1202 293
546 3300046460 Ga0495638_0017042 Ga0495638_0017042_1078_1959 293
547 3300046460 Ga0495638_0033201 Ga0495638_0033201_2322_3203 293
548 3300046460 Ga0495638_0074805 Ga0495638_0074805_422_1303 293
549 3300046460 Ga0495638_0113511 Ga0495638_0113511_337_1218 293
550 3300046463 Ga0495653_0004282 Ga0495653_0004282_6088_6969 293
551 3300046463 Ga0495653_0039037 Ga0495653_0039037_1726_2607 293
552 3300046463 Ga0495653_0192433 Ga0495653_0192433_361_1242 293
553 3300046471 Ga0495650_0000214 Ga0495650_0000214_77247_78164 293
554 3300046471 Ga0495650_0003573 Ga0495650_0003573_4018_4908 293
555 3300046471 Ga0495650_0003864 Ga0495650_0003864_5845_6726 293
556 3300046471 Ga0495650_0009063 Ga0495650_0009063_3947_4828 293
557 3300046471 Ga0495650_0010134 Ga0495650_0010134_231_1112 293
558 3300046471 Ga0495650_0018512 Ga0495650_0018512_2187_3077 293
559 3300046471 Ga0495650_0028530 Ga0495650_0028530_301_1182 293
560 3300046471 Ga0495650_0034227 Ga0495650_0034227_520_1401 293
561 3300046471 Ga0495650_0036755 Ga0495650_0036755_1165_2046 293
562 3300046472 Ga0495580_0243680 Ga0495580_0243680_299_1180 293
563 3300046473 Ga0495582_0000733 Ga0495582_0000733_5765_6646 293
564 3300046474 Ga0495605_0000016 Ga0495605_0000016_136913_137803 293
565 3300046474 Ga0495605_0000031 Ga0495605_0000031_93200_94171 293
566 3300046474 Ga0495605_0000188 Ga0495605_0000188_59171_60061 293
567 3300046474 Ga0495605_0001298 Ga0495605_0001298_3968_4849 293
568 3300046474 Ga0495605_0003806 Ga0495605_0003806_4582_5463 293
569 3300046474 Ga0495605_0007383 Ga0495605_0007383_4269_5150 293
570 3300046474 Ga0495605_0011436 Ga0495605_0011436_20_901 293
571 3300046474 Ga0495605_0015275 Ga0495605_0015275_3064_3945 293
572 3300046474 Ga0495605_0030700 Ga0495605_0030700_1073_1954 293
573 3300046475 Ga0495639_0000539 Ga0495639_0000539_5255_6136 293
574 3300046475 Ga0495639_0006675 Ga0495639_0006675_2774_3655 293
575 3300046475 Ga0495639_0114279 Ga0495639_0114279_70_951 293
576 3300046491 Ga0495584_0001540 Ga0495584_0001540_12736_13617 293
577 3300046491 Ga0495584_0005789 Ga0495584_0005789_5499_6380 293
578 3300046491 Ga0495584_0007785 Ga0495584_0007785_4312_5193 293
579 3300046491 Ga0495584_0008287 Ga0495584_0008287_3914_4795 293
580 3300046491 Ga0495584_0023723 Ga0495584_0023723_1922_2803 293
581 3300046491 Ga0495584_0034252 Ga0495584_0034252_54_935 293
582 3300046491 Ga0495584_0037722 Ga0495584_0037722_348_1265 293
583 3300046491 Ga0495584_0040164 Ga0495584_0040164_1360_2241 293
584 3300046491 Ga0495584_0060267 Ga0495584_0060267_1008_1889 293
585 3300046491 Ga0495584_0080456 Ga0495584_0080456_246_1127 293
586 3300046492 Ga0495585_0002150 Ga0495585_0002150_6065_6946 293
587 3300046492 Ga0495585_0005157 Ga0495585_0005157_3000_3881 293
588 3300046492 Ga0495585_0007381 Ga0495585_0007381_1615_2496 293
589 3300046492 Ga0495585_0008742 Ga0495585_0008742_1416_2297 293
590 3300046492 Ga0495585_0008799 Ga0495585_0008799_3904_4785 293
591 3300046492 Ga0495585_0015567 Ga0495585_0015567_3258_4139 293
592 3300046492 Ga0495585_0020521 Ga0495585_0020521_794_1675 293
593 3300046492 Ga0495585_0022004 Ga0495585_0022004_1047_1928 293
594 3300046492 Ga0495585_0095525 Ga0495585_0095525_137_1018 293
595 3300046499 Ga0495594_0000132 Ga0495594_0000132_9582_10472 293
596 3300046499 Ga0495594_0006827 Ga0495594_0006827_122_1003 293
597 3300046499 Ga0495594_0088709 Ga0495594_0088709_797_1678 293
598 3300046499 Ga0495594_0168584 Ga0495594_0168584_354_1235 293
599 3300046500 Ga0495596_0000827 Ga0495596_0000827_6467_7348 293
600 3300046500 Ga0495596_0013106 Ga0495596_0013106_1343_2224 293
601 3300046501 Ga0495607_0000155 Ga0495607_0000155_16933_17823 293
602 3300046501 Ga0495607_0000166 Ga0495607_0000166_5014_6039 293
603 3300046501 Ga0495607_0001964 Ga0495607_0001964_4109_4990 293
604 3300046501 Ga0495607_0002454 Ga0495607_0002454_12807_13688 293
605 3300046501 Ga0495607_0002817 Ga0495607_0002817_7570_8451 293
606 3300046501 Ga0495607_0004767 Ga0495607_0004767_3594_4475 293
607 3300046501 Ga0495607_0006044 Ga0495607_0006044_5577_6458 293
608 3300046501 Ga0495607_0014403 Ga0495607_0014403_4187_5068 293
609 3300046501 Ga0495607_0015123 Ga0495607_0015123_896_1777 293
610 3300046501 Ga0495607_0017133 Ga0495607_0017133_804_1697 293
611 3300046501 Ga0495607_0033581 Ga0495607_0033581_247_1128 293
612 3300046501 Ga0495607_0036109 Ga0495607_0036109_1955_2842 293
613 3300046501 Ga0495607_0047931 Ga0495607_0047931_340_1221 293
614 3300046501 Ga0495607_0050678 Ga0495607_0050678_1346_2227 293
615 3300046501 Ga0495607_0068412 Ga0495607_0068412_481_1371 293
616 3300046501 Ga0495607_0098737 Ga0495607_0098737_606_1487 293
617 3300046501 Ga0495607_0100547 Ga0495607_0100547_92_988 293
618 3300046501 Ga0495607_0105905 Ga0495607_0105905_522_1403 293
619 3300046501 Ga0495607_0114845 Ga0495607_0114845_140_1030 293
620 3300046501 Ga0495607_0130430 Ga0495607_0130430_240_1121 293
621 3300046501 Ga0495607_0134995 Ga0495607_0134995_11_901 293
622 3300046501 Ga0495607_0155544 Ga0495607_0155544_126_1007 293
623 3300046506 Ga0495583_0000041 Ga0495583_0000041_114851_115741 293
624 3300046506 Ga0495583_0000915 Ga0495583_0000915_3790_4707 293
625 3300046506 Ga0495583_0001118 Ga0495583_0001118_22998_23879 293
626 3300046506 Ga0495583_0001611 Ga0495583_0001611_4027_4917 293
627 3300046506 Ga0495583_0004592 Ga0495583_0004592_599_1489 293
628 3300046506 Ga0495583_0005845 Ga0495583_0005845_883_1902 293
629 3300046506 Ga0495583_0028831 Ga0495583_0028831_1491_2372 293
630 3300046506 Ga0495583_0032224 Ga0495583_0032224_1415_2296 293
631 3300046506 Ga0495583_0045039 Ga0495583_0045039_525_1415 293
632 3300046506 Ga0495583_0084442 Ga0495583_0084442_104_985 293
633 3300046506 Ga0495583_0129367 Ga0495583_0129367_116_997 293
634 3300046507 Ga0495606_0000055 Ga0495606_0000055_128419_129336 293
635 3300046507 Ga0495606_0000595 Ga0495606_0000595_11760_12650 293
636 3300046507 Ga0495606_0003583 Ga0495606_0003583_5744_6625 293
637 3300046507 Ga0495606_0006825 Ga0495606_0006825_2339_3220 293
638 3300046507 Ga0495606_0006876 Ga0495606_0006876_5341_6222 293
639 3300046507 Ga0495606_0007907 Ga0495606_0007907_4448_5329 293
640 3300046507 Ga0495606_0008023 Ga0495606_0008023_3556_4437 293
641 3300046507 Ga0495606_0009507 Ga0495606_0009507_1798_2679 293
642 3300046507 Ga0495606_0017801 Ga0495606_0017801_4133_5014 293
643 3300046507 Ga0495606_0027133 Ga0495606_0027133_3161_4042 293
644 3300046507 Ga0495606_0082867 Ga0495606_0082867_1090_1971 293
645 3300046507 Ga0495606_0090859 Ga0495606_0090859_180_1061 293
646 3300046507 Ga0495606_0225102 Ga0495606_0225102_149_1030 293
647 3300046512 Ga0495610_0003038 Ga0495610_0003038_140_1021 293
648 3300046512 Ga0495610_0003907 Ga0495610_0003907_4190_5071 293
649 3300046512 Ga0495610_0004768 Ga0495610_0004768_5890_6771 293
650 3300046512 Ga0495610_0006442 Ga0495610_0006442_2288_3169 293
651 3300046512 Ga0495610_0009145 Ga0495610_0009145_1360_2241 293
652 3300046512 Ga0495610_0011459 Ga0495610_0011459_3814_4704 293
653 3300046512 Ga0495610_0011795 Ga0495610_0011795_1750_2631 293
654 3300046512 Ga0495610_0013406 Ga0495610_0013406_2792_3709 293
655 3300046512 Ga0495610_0021456 Ga0495610_0021456_1403_2293 293
656 3300046512 Ga0495610_0031467 Ga0495610_0031467_382_1263 293
657 3300046512 Ga0495610_0098488 Ga0495610_0098488_383_1264 293
658 3300046513 Ga0495616_0001297 Ga0495616_0001297_7271_8152 293
659 3300046513 Ga0495616_0004657 Ga0495616_0004657_3880_4761 293
660 3300046513 Ga0495616_0006238 Ga0495616_0006238_1871_2752 293
661 3300046513 Ga0495616_0007398 Ga0495616_0007398_5423_6304 293
662 3300046513 Ga0495616_0007901 Ga0495616_0007901_828_1709 293
663 3300046513 Ga0495616_0011280 Ga0495616_0011280_3906_4787 293
664 3300046513 Ga0495616_0011966 Ga0495616_0011966_3011_3892 293
665 3300046513 Ga0495616_0076169 Ga0495616_0076169_80_961 293
666 3300046515 Ga0495620_0000015 Ga0495620_0000015_114707_115597 293
667 3300046515 Ga0495620_0000925 Ga0495620_0000925_12340_13221 293
668 3300046515 Ga0495620_0000988 Ga0495620_0000988_12725_13606 293
669 3300046515 Ga0495620_0004712 Ga0495620_0004712_5614_6504 293
670 3300046515 Ga0495620_0013261 Ga0495620_0013261_3327_4208 293
671 3300046515 Ga0495620_0014367 Ga0495620_0014367_2290_3195 293
672 3300046515 Ga0495620_0018619 Ga0495620_0018619_253_1134 293
673 3300046515 Ga0495620_0025542 Ga0495620_0025542_1423_2304 293
674 3300046515 Ga0495620_0027290 Ga0495620_0027290_913_1794 293
675 3300046515 Ga0495620_0044242 Ga0495620_0044242_749_1630 293
676 3300046516 Ga0495628_0251212 Ga0495628_0251212_247_1128 293
677 3300046517 Ga0495630_0029624 Ga0495630_0029624_2791_3672 293
678 3300046517 Ga0495630_0376460 Ga0495630_0376460_82_963 293
679 3300046518 Ga0495631_0000862 Ga0495631_0000862_12505_13386 293
680 3300046518 Ga0495631_0002166 Ga0495631_0002166_8584_9465 293
681 3300046518 Ga0495631_0005391 Ga0495631_0005391_281_1171 293
682 3300046518 Ga0495631_0010330 Ga0495631_0010330_3032_3922 293
683 3300046518 Ga0495631_0010456 Ga0495631_0010456_1130_2047 293
684 3300046518 Ga0495631_0014013 Ga0495631_0014013_354_1235 293
685 3300046518 Ga0495631_0042159 Ga0495631_0042159_237_1118 293
686 3300046519 Ga0495632_0001686 Ga0495632_0001686_4540_5421 293
687 3300046519 Ga0495632_0002162 Ga0495632_0002162_12377_13258 293
688 3300046519 Ga0495632_0002585 Ga0495632_0002585_6248_7165 293
689 3300046519 Ga0495632_0003197 Ga0495632_0003197_9678_10559 293
690 3300046519 Ga0495632_0009040 Ga0495632_0009040_2433_3323 293
691 3300046519 Ga0495632_0010406 Ga0495632_0010406_799_1689 293
692 3300046519 Ga0495632_0013525 Ga0495632_0013525_833_1714 293
693 3300046519 Ga0495632_0018667 Ga0495632_0018667_1307_2188 293
694 3300046519 Ga0495632_0041390 Ga0495632_0041390_1255_2136 293
695 3300046519 Ga0495632_0041457 Ga0495632_0041457_99_980 293
696 3300046519 Ga0495632_0057081 Ga0495632_0057081_762_1643 293
697 3300046519 Ga0495632_0059206 Ga0495632_0059206_237_1118 293
698 3300046519 Ga0495632_0123309 Ga0495632_0123309_233_1114 293
699 3300046519 Ga0495632_0133919 Ga0495632_0133919_207_1088 293
700 3300046519 Ga0495632_0153284 Ga0495632_0153284_85_966 293
701 3300046520 Ga0495637_0000135 Ga0495637_0000135_17747_18664 293
702 3300046520 Ga0495637_0000369 Ga0495637_0000369_27504_28394 293
703 3300046520 Ga0495637_0000884 Ga0495637_0000884_12587_13468 293
704 3300046520 Ga0495637_0001413 Ga0495637_0001413_11163_12044 293
705 3300046520 Ga0495637_0001703 Ga0495637_0001703_2220_3101 293
706 3300046520 Ga0495637_0001762 Ga0495637_0001762_11422_12303 293
707 3300046520 Ga0495637_0002653 Ga0495637_0002653_4837_5718 293
708 3300046520 Ga0495637_0004042 Ga0495637_0004042_300_1190 293
709 3300046520 Ga0495637_0012171 Ga0495637_0012171_2619_3524 293
710 3300046520 Ga0495637_0014039 Ga0495637_0014039_172_1053 293
711 3300046520 Ga0495637_0020845 Ga0495637_0020845_2099_2980 293
712 3300046520 Ga0495637_0021117 Ga0495637_0021117_87_977 293
713 3300046520 Ga0495637_0030803 Ga0495637_0030803_98_979 293
714 3300046520 Ga0495637_0031168 Ga0495637_0031168_92_973 293
715 3300046520 Ga0495637_0037126 Ga0495637_0037126_450_1331 293
716 3300046520 Ga0495637_0070589 Ga0495637_0070589_307_1188 293
717 3300046520 Ga0495637_0098851 Ga0495637_0098851_212_1093 293
718 3300046522 Ga0495643_0003825 Ga0495643_0003825_4389_5270 293
719 3300046522 Ga0495643_0004563 Ga0495643_0004563_242_1123 293
720 3300046522 Ga0495643_0022619 Ga0495643_0022619_2591_3481 293
721 3300046522 Ga0495643_0023790 Ga0495643_0023790_804_1685 293
722 3300046522 Ga0495643_0026581 Ga0495643_0026581_1379_2260 293
723 3300046522 Ga0495643_0040870 Ga0495643_0040870_1515_2396 293
724 3300046522 Ga0495643_0146539 Ga0495643_0146539_185_1066 293
725 3300046523 Ga0495644_0004361 Ga0495644_0004361_201_1082 293
726 3300046523 Ga0495644_0030117 Ga0495644_0030117_15_896 293
727 3300046523 Ga0495644_0030989 Ga0495644_0030989_72_953 293
728 3300046523 Ga0495644_0051450 Ga0495644_0051450_479_1360 293
729 3300046524 Ga0495648_0002157 Ga0495648_0002157_5314_6195 293
730 3300046524 Ga0495648_0002239 Ga0495648_0002239_12012_12893 293
731 3300046524 Ga0495648_0003283 Ga0495648_0003283_7786_8676 293
732 3300046524 Ga0495648_0008633 Ga0495648_0008633_876_1766 293
733 3300046524 Ga0495648_0014858 Ga0495648_0014858_4530_5411 293
734 3300046524 Ga0495648_0019787 Ga0495648_0019787_486_1367 293
735 3300046524 Ga0495648_0036881 Ga0495648_0036881_1079_1996 293
736 3300046524 Ga0495648_0050044 Ga0495648_0050044_1369_2250 293
737 3300046524 Ga0495648_0057510 Ga0495648_0057510_652_1533 293
738 3300046524 Ga0495648_0094821 Ga0495648_0094821_364_1245 293
739 3300046524 Ga0495648_0110289 Ga0495648_0110289_76_957 293
740 3300046524 Ga0495648_0127816 Ga0495648_0127816_53_934 293
741 3300046524 Ga0495648_0139221 Ga0495648_0139221_270_1151 293
742 3300046524 Ga0495648_0139866 Ga0495648_0139866_279_1160 293
743 3300046526 Ga0495666_0002784 Ga0495666_0002784_4330_5211 293
744 3300046526 Ga0495666_0011278 Ga0495666_0011278_3244_4125 293
745 3300046526 Ga0495666_0033617 Ga0495666_0033617_563_1444 293
746 3300046526 Ga0495666_0063046 Ga0495666_0063046_815_1696 293
747 3300046528 Ga0495642_0000254 Ga0495642_0000254_17402_18283 293
748 3300046528 Ga0495642_0000654 Ga0495642_0000654_12623_13504 293
749 3300046528 Ga0495642_0003384 Ga0495642_0003384_5290_6171 293
750 3300046530 Ga0495654_0000447 Ga0495654_0000447_21418_22299 293
751 3300046530 Ga0495654_0001035 Ga0495654_0001035_5154_6038 293
752 3300046530 Ga0495654_0005185 Ga0495654_0005185_1118_2035 293
753 3300046530 Ga0495654_0007322 Ga0495654_0007322_1397_2278 293
754 3300046530 Ga0495654_0010093 Ga0495654_0010093_3112_3993 293
755 3300046530 Ga0495654_0012475 Ga0495654_0012475_3480_4361 293
756 3300046530 Ga0495654_0015773 Ga0495654_0015773_2007_2897 293
757 3300046530 Ga0495654_0015835 Ga0495654_0015835_2113_2994 293
758 3300046530 Ga0495654_0028383 Ga0495654_0028383_960_1841 293
759 3300046530 Ga0495654_0036976 Ga0495654_0036976_84_965 293
760 3300046530 Ga0495654_0050346 Ga0495654_0050346_303_1184 293
761 3300046530 Ga0495654_0063468 Ga0495654_0063468_768_1649 293
762 3300046530 Ga0495654_0081147 Ga0495654_0081147_422_1303 293
763 3300046530 Ga0495654_0105714 Ga0495654_0105714_100_990 293
764 3300046530 Ga0495654_0136125 Ga0495654_0136125_38_919 293
765 3300046535 Ga0495586_0007026 Ga0495586_0007026_2815_3696 293
766 3300046536 Ga0495587_0002099 Ga0495587_0002099_6912_7793 293
767 3300046538 Ga0495609_0000015 Ga0495609_0000015_206635_207525 293
768 3300046538 Ga0495609_0000050 Ga0495609_0000050_37561_38451 293
769 3300046538 Ga0495609_0000066 Ga0495609_0000066_64570_65487 293
770 3300046538 Ga0495609_0001515 Ga0495609_0001515_8833_9714 293
771 3300046538 Ga0495609_0002365 Ga0495609_0002365_9434_10315 293
772 3300046538 Ga0495609_0016741 Ga0495609_0016741_1681_2562 293
773 3300046538 Ga0495609_0021086 Ga0495609_0021086_1640_2521 293
774 3300046538 Ga0495609_0155173 Ga0495609_0155173_48_929 293
775 3300046542 Ga0495597_0001871 Ga0495597_0001871_9952_10833 293
776 3300046542 Ga0495597_0004231 Ga0495597_0004231_4326_5207 293
777 3300046542 Ga0495597_0004953 Ga0495597_0004953_5804_6694 293
778 3300046542 Ga0495597_0005883 Ga0495597_0005883_4470_5351 293
779 3300046542 Ga0495597_0021554 Ga0495597_0021554_2057_2938 293
780 3300046542 Ga0495597_0043663 Ga0495597_0043663_997_1878 293
781 3300046542 Ga0495597_0048057 Ga0495597_0048057_30_911 293
782 3300046542 Ga0495597_0062484 Ga0495597_0062484_96_977 293
783 3300046542 Ga0495597_0069740 Ga0495597_0069740_603_1484 293
784 3300046543 Ga0495645_0118863 Ga0495645_0118863_646_1527 293
785 3300046543 Ga0495645_0175630 Ga0495645_0175630_550_1431 293
786 3300046557 Ga0495622_0000372 Ga0495622_0000372_5743_6624 293
787 3300046558 Ga0495633_0000060 Ga0495633_0000060_38776_39666 293
788 3300046558 Ga0495633_0000907 Ga0495633_0000907_23380_24261 293
789 3300046558 Ga0495633_0002167 Ga0495633_0002167_12586_13467 293
790 3300046615 Ga0495656_0020024 Ga0495656_0020024_1181_2062 293
791 3300046616 Ga0495668_0002258 Ga0495668_0002258_3923_4804 293
792 3300046616 Ga0495668_0003383 Ga0495668_0003383_4054_4935 293
793 3300046616 Ga0495668_0009417 Ga0495668_0009417_112_1017 293
794 3300046616 Ga0495668_0028633 Ga0495668_0028633_1920_2801 293
795 3300046616 Ga0495668_0030227 Ga0495668_0030227_1057_1947 293
796 3300046616 Ga0495668_0079749 Ga0495668_0079749_845_1762 293
797 3300046642 Ga0495634_0004876 Ga0495634_0004876_3108_3992 293
798 3300046642 Ga0495634_0062909 Ga0495634_0062909_988_1869 293
799 3300046648 Ga0495611_0000509 Ga0495611_0000509_21999_22916 293
800 3300046648 Ga0495611_0000632 Ga0495611_0000632_7060_7941 293
801 3300046648 Ga0495611_0004631 Ga0495611_0004631_876_1766 293
802 3300046648 Ga0495611_0019067 Ga0495611_0019067_1439_2320 293
803 3300046648 Ga0495611_0040782 Ga0495611_0040782_180_1061 293
804 3300046648 Ga0495611_0166474 Ga0495611_0166474_23_913 293
805 3300046660 Ga0495625_0000055 Ga0495625_0000055_137722_138639 293
806 3300046660 Ga0495625_0002765 Ga0495625_0002765_12394_13275 293
807 3300046660 Ga0495625_0004271 Ga0495625_0004271_7233_8114 293
808 3300046660 Ga0495625_0004290 Ga0495625_0004290_12591_13472 293
809 3300046660 Ga0495625_0008598 Ga0495625_0008598_4076_4957 293
810 3300046660 Ga0495625_0028955 Ga0495625_0028955_41_922 293
811 3300046660 Ga0495625_0044404 Ga0495625_0044404_1338_2219 293
812 3300046660 Ga0495625_0140163 Ga0495625_0140163_312_1193 293
813 3300046663 Ga0495635_0015612 Ga0495635_0015612_1148_2032 293
814 3300046663 Ga0495635_0038830 Ga0495635_0038830_1742_2623 293
815 3300046664 Ga0495659_0000371 Ga0495659_0000371_11379_12260 293
816 3300046664 Ga0495659_0022000 Ga0495659_0022000_1026_1907 293
817 3300046665 Ga0495661_0000046 Ga0495661_0000046_10402_11292 293
818 3300046665 Ga0495661_0000139 Ga0495661_0000139_10756_11673 293
819 3300046665 Ga0495661_0001234 Ga0495661_0001234_4040_4930 293
820 3300046665 Ga0495661_0003018 Ga0495661_0003018_5588_6478 293
821 3300046665 Ga0495661_0010504 Ga0495661_0010504_3400_4281 293
822 3300046665 Ga0495661_0012941 Ga0495661_0012941_917_1807 293
823 3300046665 Ga0495661_0027676 Ga0495661_0027676_559_1440 293
824 3300046665 Ga0495661_0071589 Ga0495661_0071589_734_1615 293
825 3300046674 Ga0495588_0040467 Ga0495588_0040467_1229_2110 293
826 3300046674 Ga0495588_0063526 Ga0495588_0063526_703_1584 293
827 3300046674 Ga0495588_0260830 Ga0495588_0260830_10_891 293
828 3300046679 Ga0495623_0017881 Ga0495623_0017881_3372_4253 293
829 3300046680 Ga0495646_0006545 Ga0495646_0006545_2211_3092 293
830 3300046680 Ga0495646_0008302 Ga0495646_0008302_4810_5691 293
831 3300046684 Ga0495669_0005628 Ga0495669_0005628_2474_3355 293
832 3300046684 Ga0495669_0029352 Ga0495669_0029352_47_928 293
833 3300046689 Ga0495613_0003327 Ga0495613_0003327_6813_7694 293
834 3300046689 Ga0495613_0123528 Ga0495613_0123528_913_1794 293
835 3300046690 Ga0495624_0000715 Ga0495624_0000715_12668_13549 293
836 3300046690 Ga0495624_0296418 Ga0495624_0296418_15_896 293
837 3300046691 Ga0495670_0001044 Ga0495670_0001044_8732_9613 293
838 3300046691 Ga0495670_0001705 Ga0495670_0001705_5524_6405 293
839 3300046691 Ga0495670_0004339 Ga0495670_0004339_480_1361 293
840 3300046691 Ga0495670_0021367 Ga0495670_0021367_1512_2402 293
841 3300046691 Ga0495670_0039870 Ga0495670_0039870_240_1121 293
842 3300046691 Ga0495670_0042871 Ga0495670_0042871_34_915 293
843 3300046691 Ga0495670_0103634 Ga0495670_0103634_217_1098 293
844 3300046691 Ga0495670_0132491 Ga0495670_0132491_281_1198 293
845 3300046691 Ga0495670_0140282 Ga0495670_0140282_176_1057 293
846 3300046692 Ga0495671_0000516 Ga0495671_0000516_17902_18792 293
847 3300046692 Ga0495671_0001833 Ga0495671_0001833_77_958 293
848 3300046692 Ga0495671_0003399 Ga0495671_0003399_3935_4816 293
849 3300046692 Ga0495671_0007486 Ga0495671_0007486_2500_3381 293
850 3300046692 Ga0495671_0010383 Ga0495671_0010383_363_1244 293
851 3300046692 Ga0495671_0014106 Ga0495671_0014106_3281_4162 293
852 3300046692 Ga0495671_0020879 Ga0495671_0020879_1167_2048 293
853 3300046692 Ga0495671_0032228 Ga0495671_0032228_996_1877 293
854 3300046692 Ga0495671_0037908 Ga0495671_0037908_1193_2074 293
855 3300046692 Ga0495671_0046196 Ga0495671_0046196_134_1015 293
856 3300046692 Ga0495671_0046960 Ga0495671_0046960_852_1742 293
857 3300046692 Ga0495671_0064874 Ga0495671_0064874_209_1090 293
858 3300046692 Ga0495671_0127421 Ga0495671_0127421_49_936 293
859 3300046694 Ga0495649_0001026 Ga0495649_0001026_13069_13950 293
860 3300046694 Ga0495649_0005286 Ga0495649_0005286_7232_8113 293
861 3300046694 Ga0495649_0008202 Ga0495649_0008202_1420_2301 293
862 3300046694 Ga0495649_0011041 Ga0495649_0011041_3934_4815 293
863 3300046694 Ga0495649_0013507 Ga0495649_0013507_3517_4398 293
864 3300046694 Ga0495649_0015070 Ga0495649_0015070_2310_3191 293
865 3300046694 Ga0495649_0027829 Ga0495649_0027829_1749_2630 293
866 3300046694 Ga0495649_0037535 Ga0495649_0037535_460_1341 293
867 3300046694 Ga0495649_0046221 Ga0495649_0046221_32_913 293
868 3300046694 Ga0495649_0180476 Ga0495649_0180476_90_971 293
869 3300046794 Ga0495589_0000773 Ga0495589_0000773_12918_13799 293
870 3300046794 Ga0495589_0000909 Ga0495589_0000909_12477_13358 293
871 3300046794 Ga0495589_0008318 Ga0495589_0008318_3298_4179 293
872 3300046794 Ga0495589_0009027 Ga0495589_0009027_3883_4764 293
873 3300046794 Ga0495589_0009456 Ga0495589_0009456_4020_4901 293
874 3300046794 Ga0495589_0019665 Ga0495589_0019665_537_1427 293
875 3300046809 Ga0495600_0013336 Ga0495600_0013336_2084_2965 293
876 3300046809 Ga0495600_0130126 Ga0495600_0130126_327_1208 293
877 3300046810 Ga0495660_0001330 Ga0495660_0001330_6918_7799 293
878 3300046810 Ga0495660_0004987 Ga0495660_0004987_3359_4249 293
879 3300046810 Ga0495660_0009422 Ga0495660_0009422_4739_5629 293
880 3300046810 Ga0495660_0009578 Ga0495660_0009578_990_1907 293
881 3300046810 Ga0495660_0011131 Ga0495660_0011131_1946_2827 293
882 3300046810 Ga0495660_0018248 Ga0495660_0018248_3135_4016 293
883 3300046810 Ga0495660_0022612 Ga0495660_0022612_870_1751 293
884 3300046810 Ga0495660_0032276 Ga0495660_0032276_180_1061 293
885 3300046810 Ga0495660_0063628 Ga0495660_0063628_656_1537 293
886 3300046810 Ga0495660_0074985 Ga0495660_0074985_235_1116 293
887 3300046810 Ga0495660_0086653 Ga0495660_0086653_521_1402 293
888 3300046810 Ga0495660_0161980 Ga0495660_0161980_41_922 293
889 3300047315 Ga0495581_0051855 Ga0495581_0051855_1305_2186 293
890 3300047317 Ga0495604_0014240 Ga0495604_0014240_2789_3670 293
891 3300047318 Ga0495636_0001882 Ga0495636_0001882_1320_2201 293
892 3300047318 Ga0495636_0061729 Ga0495636_0061729_545_1426 293
893 3300047319 Ga0495674_0037564 Ga0495674_0037564_3324_4205 293
894 3300047320 Ga0495672_0000803 Ga0495672_0000803_18907_19788 293
895 3300047320 Ga0495672_0001932 Ga0495672_0001932_12667_13548 293
896 3300047320 Ga0495672_0004779 Ga0495672_0004779_5531_6415 293
897 3300047320 Ga0495672_0005327 Ga0495672_0005327_2766_3647 293
898 3300047320 Ga0495672_0024090 Ga0495672_0024090_1857_2738 293
899 3300047320 Ga0495672_0030445 Ga0495672_0030445_2296_3177 293
900 3300047320 Ga0495672_0034144 Ga0495672_0034144_57_938 293
901 3300047320 Ga0495672_0038203 Ga0495672_0038203_1974_2855 293
902 3300047320 Ga0495672_0040683 Ga0495672_0040683_323_1204 293
903 3300047320 Ga0495672_0054957 Ga0495672_0054957_1190_2071 293
904 3300047320 Ga0495672_0054964 Ga0495672_0054964_1060_1977 293
905 3300047321 Ga0495676_0000013 Ga0495676_0000013_138626_139543 293
906 3300047321 Ga0495676_0009805 Ga0495676_0009805_5600_6481 293
907 3300047321 Ga0495676_0013123 Ga0495676_0013123_1604_2485 293
908 3300047322 Ga0495680_0002534 Ga0495680_0002534_11049_11930 293
909 3300047322 Ga0495680_0105920 Ga0495680_0105920_1187_2068 293
910 3300047323 Ga0495683_0000027 Ga0495683_0000027_39165_40055 293
911 3300047323 Ga0495683_0001814 Ga0495683_0001814_12466_13347 293
912 3300047323 Ga0495683_0026699 Ga0495683_0026699_642_1523 293
913 3300047323 Ga0495683_0030909 Ga0495683_0030909_63_944 293
914 3300047323 Ga0495683_0062884 Ga0495683_0062884_711_1592 293
915 3300047323 Ga0495683_0068103 Ga0495683_0068103_343_1224 293
916 3300047443 Ga0495687_017672 Ga0495687_017672_341_1222 293
917 3300047444 Ga0495675_0004133 Ga0495675_0004133_4923_5804 293
918 3300047445 Ga0495677_0001276 Ga0495677_0001276_5251_6132 293
919 3300047446 Ga0495679_000129 Ga0495679_000129_59861_60778 293
920 3300047446 Ga0495679_000712 Ga0495679_000712_3994_4884 293
921 3300047446 Ga0495679_004278 Ga0495679_004278_326_1207 293
922 3300047446 Ga0495679_014943 Ga0495679_014943_325_1206 293
923 3300047446 Ga0495679_056783 Ga0495679_056783_166_1047 293
924 3300047446 Ga0495679_061910 Ga0495679_061910_51_932 293
925 3300047447 Ga0495685_022422 Ga0495685_022422_184_1065 293
926 3300047469 Ga0495673_0000510 Ga0495673_0000510_4370_5275 293
927 3300047469 Ga0495673_0000641 Ga0495673_0000641_21968_22858 293
928 3300047469 Ga0495673_0001127 Ga0495673_0001127_18099_18989 293
929 3300047469 Ga0495673_0001242 Ga0495673_0001242_11702_12583 293
930 3300047469 Ga0495673_0001585 Ga0495673_0001585_4493_5374 293
931 3300047469 Ga0495673_0002606 Ga0495673_0002606_1287_2168 293
932 3300047469 Ga0495673_0004050 Ga0495673_0004050_2916_3797 293
933 3300047469 Ga0495673_0008622 Ga0495673_0008622_1034_1915 293
934 3300047469 Ga0495673_0009433 Ga0495673_0009433_3542_4432 293
935 3300047469 Ga0495673_0015866 Ga0495673_0015866_134_1024 293
936 3300047469 Ga0495673_0017832 Ga0495673_0017832_2597_3484 293
937 3300047469 Ga0495673_0019202 Ga0495673_0019202_831_1712 293
938 3300047469 Ga0495673_0035268 Ga0495673_0035268_360_1241 293
939 3300047469 Ga0495673_0061380 Ga0495673_0061380_269_1174 293
940 3300047469 Ga0495673_0072255 Ga0495673_0072255_517_1398 293
941 3300047469 Ga0495673_0107818 Ga0495673_0107818_75_956 293
942 3300047470 Ga0495681_0002384 Ga0495681_0002384_3666_4547 293
943 3300047470 Ga0495681_0002455 Ga0495681_0002455_57_938 293
944 3300047470 Ga0495681_0003399 Ga0495681_0003399_539_1420 293
945 3300047470 Ga0495681_0004258 Ga0495681_0004258_4836_5717 293
946 3300047470 Ga0495681_0005284 Ga0495681_0005284_3898_4779 293
947 3300047470 Ga0495681_0006096 Ga0495681_0006096_3031_3948 293
948 3300047470 Ga0495681_0008745 Ga0495681_0008745_5185_6066 293
949 3300047470 Ga0495681_0009977 Ga0495681_0009977_3759_4640 293
950 3300047470 Ga0495681_0016713 Ga0495681_0016713_958_1839 293
951 3300047470 Ga0495681_0022409 Ga0495681_0022409_2170_3051 293
952 3300047470 Ga0495681_0041744 Ga0495681_0041744_191_1072 293
953 3300047470 Ga0495681_0118190 Ga0495681_0118190_103_984 293
954 3300047470 Ga0495681_0126352 Ga0495681_0126352_57_938 293
955 3300047471 Ga0495684_0033679 Ga0495684_0033679_80_961 293
956 3300047471 Ga0495684_0178831 Ga0495684_0178831_282_1163 293
957 3300047472 Ga0495686_0006584 Ga0495686_0006584_3794_4675 293
958 3300047472 Ga0495686_0009485 Ga0495686_0009485_3924_4805 293
959 3300047472 Ga0495686_0015327 Ga0495686_0015327_42_923 293
960 3300047472 Ga0495686_0162979 Ga0495686_0162979_173_1090 293
961 3300047673 Ga0495593_0016645 Ga0495593_0016645_236_1117 293
962 3300047673 Ga0495593_0026906 Ga0495593_0026906_2079_2960 293
963 3300047673 Ga0495593_0031754 Ga0495593_0031754_326_1207 293
964 3300047673 Ga0495593_0037735 Ga0495593_0037735_225_1106 293
965 3300048088 Ga0495602_0014510 Ga0495602_0014510_2309_3190 293
966 3300048091 Ga0495626_0000056 Ga0495626_0000056_76357_77274 293
967 3300048091 Ga0495626_0001345 Ga0495626_0001345_13702_14583 293
968 3300048091 Ga0495626_0001594 Ga0495626_0001594_5152_6033 293
969 3300048091 Ga0495626_0003478 Ga0495626_0003478_514_1395 293
970 3300048091 Ga0495626_0004130 Ga0495626_0004130_218_1099 293
971 3300048091 Ga0495626_0004217 Ga0495626_0004217_3984_4865 293
972 3300048091 Ga0495626_0005916 Ga0495626_0005916_652_1533 293
973 3300048091 Ga0495626_0017330 Ga0495626_0017330_2381_3262 293
974 3300048091 Ga0495626_0020552 Ga0495626_0020552_2172_3053 293
975 3300048091 Ga0495626_0074305 Ga0495626_0074305_82_963 293
976 3300048091 Ga0495626_0122234 Ga0495626_0122234_181_1062 293
977 3300048091 Ga0495626_0125533 Ga0495626_0125533_87_968 293
978 3300048091 Ga0495626_0138270 Ga0495626_0138270_72_953 293
979 3300048905 Ga0496102_0000796 Ga0496102_0000796_17297_18181 293
980 3300048905 Ga0496102_0260522 Ga0496102_0260522_374_1264 293
981 3300048906 Ga0496103_0036967 Ga0496103_0036967_952_1836 293
982 3300048913 Ga0496110_0251761 Ga0496110_0251761_205_1086 293
983 3300048913 Ga0496110_0282475 Ga0496110_0282475_553_1434 293
984 3300048915 Ga0496112_0102825 Ga0496112_0102825_807_1697 293
985 3300048916 Ga0496113_0193501 Ga0496113_0193501_676_1566 293
986 3300048919 Ga0496116_0001359 Ga0496116_0001359_13258_14139 293
987 3300048919 Ga0496116_0004680 Ga0496116_0004680_5521_6402 293
988 3300048919 Ga0496116_0010160 Ga0496116_0010160_1147_2028 293
989 3300048919 Ga0496116_0011094 Ga0496116_0011094_2185_3066 293
990 3300048919 Ga0496116_0011855 Ga0496116_0011855_3993_4874 293
991 3300048919 Ga0496116_0019855 Ga0496116_0019855_191_1081 293
992 3300048920 Ga0496117_0002232 Ga0496117_0002232_13088_13969 293
993 3300048920 Ga0496117_0009723 Ga0496117_0009723_2301_3182 293
994 3300048920 Ga0496117_0022419 Ga0496117_0022419_3074_3958 293
995 3300048920 Ga0496117_0039614 Ga0496117_0039614_1744_2634 293
996 3300048920 Ga0496117_0104062 Ga0496117_0104062_643_1524 293
997 3300048921 Ga0496118_0014129 Ga0496118_0014129_4124_5005 293
998 3300048921 Ga0496118_0024151 Ga0496118_0024151_3030_3911 293
999 3300048921 Ga0496118_0047223 Ga0496118_0047223_1164_2045 293
1000 3300048921 Ga0496118_0050163 Ga0496118_0050163_1264_2154 293
1001 3300048921 Ga0496118_0103796 Ga0496118_0103796_239_1123 293
1002 3300048921 Ga0496118_0111314 Ga0496118_0111314_911_1792 293
1003 3300048924 Ga0496121_0002904 Ga0496121_0002904_13211_14092 293
1004 3300048924 Ga0496121_0008688 Ga0496121_0008688_9691_10572 293
1005 3300048924 Ga0496121_0025147 Ga0496121_0025147_2129_3019 293
1006 3300048924 Ga0496121_0072441 Ga0496121_0072441_595_1476 293
1007 3300048924 Ga0496121_0246032 Ga0496121_0246032_62_943 293
1008 3300048924 Ga0496121_0251221 Ga0496121_0251221_244_1125 293
1009 3300048924 Ga0496121_0286204 Ga0496121_0286204_213_1094 293
1010 3300048925 Ga0496122_0000122 Ga0496122_0000122_110049_110930 293
1011 3300048925 Ga0496122_0004214 Ga0496122_0004214_6175_7056 293
1012 3300048925 Ga0496122_0009792 Ga0496122_0009792_301_1182 293
1013 3300048925 Ga0496122_0023535 Ga0496122_0023535_749_1639 293
1014 3300048925 Ga0496122_0025117 Ga0496122_0025117_1905_2786 293
1015 3300048926 Ga0496123_0000173 Ga0496123_0000173_81956_82837 293
1016 3300048926 Ga0496123_0003346 Ga0496123_0003346_11056_11937 293
1017 3300048926 Ga0496123_0019308 Ga0496123_0019308_2012_2893 293
1018 3300048926 Ga0496123_0044494 Ga0496123_0044494_1465_2355 293
1019 3300048927 Ga0496124_0003404 Ga0496124_0003404_6691_7581 293
1020 3300048927 Ga0496124_0020832 Ga0496124_0020832_211_1116 293
1021 3300048927 Ga0496124_0064866 Ga0496124_0064866_1077_1958 293
1022 3300048927 Ga0496124_0096707 Ga0496124_0096707_232_1113 293
1023 3300048928 Ga0496125_0055348 Ga0496125_0055348_2028_2909 293
1024 3300048928 Ga0496125_0068977 Ga0496125_0068977_461_1342 293
1025 3300048928 Ga0496125_0269993 Ga0496125_0269993_169_1050 293
1026 3300048929 Ga0496126_0054787 Ga0496126_0054787_21_902 293
1027 3300049459 Ga0495678_000031 Ga0495678_000031_151927_152817 293
1028 3300049459 Ga0495678_000039 Ga0495678_000039_72492_73382 293
1029 3300049459 Ga0495678_001592 Ga0495678_001592_12786_13667 293
1030 3300049459 Ga0495678_002493 Ga0495678_002493_5330_6211 293
1031 3300049459 Ga0495678_003300 Ga0495678_003300_3991_4872 293
1032 3300049459 Ga0495678_003504 Ga0495678_003504_57_938 293
1033 3300049459 Ga0495678_003647 Ga0495678_003647_664_1554 293
1034 3300049459 Ga0495678_003769 Ga0495678_003769_3829_4710 293
1035 3300049459 Ga0495678_009564 Ga0495678_009564_1064_1945 293
1036 3300049459 Ga0495678_012509 Ga0495678_012509_1235_2116 293
1037 3300049459 Ga0495678_012860 Ga0495678_012860_1181_2062 293
1038 3300049459 Ga0495678_030524 Ga0495678_030524_99_980 293
1039 3300049459 Ga0495678_034844 Ga0495678_034844_838_1755 293
1040 3300049459 Ga0495678_042890 Ga0495678_042890_807_1688 293
1041 3300049460 Ga0495682_0000280 Ga0495682_0000280_66_965 293
1042 3300049460 Ga0495682_0001245 Ga0495682_0001245_6439_7329 293
1043 3300049460 Ga0495682_0001969 Ga0495682_0001969_3629_4510 293
1044 3300049460 Ga0495682_0003866 Ga0495682_0003866_53_934 293
1045 3300049460 Ga0495682_0020250 Ga0495682_0020250_1193_2074 293
1046 3300049460 Ga0495682_0110662 Ga0495682_0110662_20_901 293
1047 3300049573 Ga0501037_0100357 Ga0501037_0100357_75_965 293
1048 3300049575 Ga0501039_0150436 Ga0501039_0150436_880_1770 293
1049 3300049662 Ga0501222_005807 Ga0501222_005807_578_1459 293
1050 3300049673 Ga0501240_016096 Ga0501240_016096_85_966 293
1051 3300049682 Ga0501252_008508 Ga0501252_008508_127_1008 293
1052 3300049758 Ga0501241_000708 Ga0501241_000708_2496_3377 293
1053 3300050491 nmdc:mga00v17_301201_c1 nmdc:mga00v17_301201_c1_72_953 293
1054 3300050491 nmdc:mga00v17_98362_c1 nmdc:mga00v17_98362_c1_521_1402 293
1055 3300053111 Ga0500572_003400 Ga0500572_003400_951_1832 293
1056 3300053145 Ga0500586_086471 Ga0500586_086471_85_966 293
1057 iso_pu_bacteria 2554235341 2555671737 293
1058 iso_pu_bacteria 2600255283 2601625792 293
1059 iso_pu_bacteria 2808606361 2808854528 293
1060 iso_pu_bacteria 2808606376 2808921829 293
1061 iso_pu_bacteria 2808606378 2808934636 293
1062 iso_pu_bacteria 2808606380 2808943950 293
1063 iso_pu_bacteria 2808606383 2808963033 293
1064 iso_pu_bacteria 2808606389 2808997921 293
1065 iso_pu_bacteria 8057798959 8057804625 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

51

110

0.97

PF03466

LysR_substrate

LysR substrate binding domain

131

335

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9676 5 88
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9574 5 84
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9565 5 91
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9531 5 88
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9451 5 91
ID Description Score Start End Superfamily
af_P77744_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.985 6 89 1.10.10.10
af_P9WPH5_284_409_1.10.10.2840 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;PucR C-terminal helix-turn-helix domain 0.9805 8 48 1.10.10.2840
af_Q57083_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9744 6 85 1.10.10.10
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9714 5 84 1.10.10.10
af_P0ACQ7_8_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9697 6 89 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A833KNX1-F1-model_v4 deleted 0.9637 6 77
AF-E8UYI9-F1-model_v4 Regulatory protein LysR 0.9586 1 78 GO:0003700
AF-A0A5N7Y677-F1-model_v4 deleted 0.9565 1 91
AF-A0A2R7KHJ9-F1-model_v4 deleted 0.9558 1 86
AF-A0A539DKP0-F1-model_v4 LysR family transcriptional regulator 0.9532 6 80 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
90.69 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map