F489094

General Info

Members Datasets Scaffolds Average Seq Length
1052 457 819 334

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1000959|Ga0209676_100095917
Length 380
Sequence MSEPLLITGYEHVCEKSDVSGLINCLAPKRRVKCRSPRFARGSTMNQSFDIAVIGATGTVGETLVQILEERDFPIANLHLLASSESAGHSVPFRGKNVRVREVDEFDFSKVQLAFFAAGPAVTLSFAPRATAANCAVIDLSGALPSAQAPNLVPEANERVLAGLKKPVQLSSPSAAATSLAVVLAPLQALFEIQRVNLTASLAVSTQGREAVTELARQTAELLNARPLEPRFFDRQMAFNLLAQVGTPDEHGHTLLEKRLVRELREVLAQPLLKISVTCVQAPVFFGDSYSVTLQSATAIDLDAVNAALEAAPGIELVEAGDYPTAVGDAVGQDVVYVGRVRGGIDDPAELNLWLTSDNVRKGAALNAVQLAELLIKDLL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231024 Pseudomonas sp. GM84 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
22 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
23 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
24 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
25 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
26 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
27 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
28 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
29 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
30 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
31 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
32 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
33 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
34 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
35 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
36 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
37 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
38 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
39 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
40 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
41 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
42 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
43 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
44 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
45 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
46 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
47 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
48 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
49 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
50 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
51 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
52 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
53 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
54 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
55 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
56 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
57 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
58 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
59 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
60 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
61 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
62 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
63 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
64 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
65 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
66 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
67 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
68 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
69 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
70 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
71 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
72 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
73 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
74 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
75 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
76 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
77 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
78 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
79 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
80 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
81 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
82 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
83 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
84 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
85 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
86 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
87 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
88 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
89 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
90 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
91 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
92 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
93 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
94 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
95 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
96 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
97 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
98 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
99 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
100 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
101 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
102 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
103 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
104 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
105 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
106 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
107 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
108 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
109 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
110 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
111 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
112 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
113 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
114 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
115 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
116 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
117 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
118 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
119 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
120 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
121 2765235841 Pseudomonas putida AA7 Isolate Unclassified
122 2773857670 Pseudomonas sp. 478 Isolate Unclassified
123 2773857673 Pseudomonas sp. 443 Isolate Unclassified
124 2784132063 Pseudomonas sp. 424 Isolate Unclassified
125 2784132072 Pseudomonas sp. 460 Isolate Unclassified
126 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
127 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
128 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
129 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
130 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
131 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
132 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
133 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
134 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
135 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
136 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
137 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
138 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
139 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
140 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
141 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
142 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
143 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
144 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
145 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
146 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
147 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
148 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
149 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
150 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
151 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
152 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
153 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
154 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
155 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
156 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
157 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
158 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
159 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
160 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
161 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
162 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
163 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
164 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
165 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
166 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
167 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
168 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
169 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
170 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
171 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
172 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
173 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
174 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
175 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
176 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
177 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
178 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
179 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
180 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
181 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
182 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
183 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
184 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
185 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
186 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
187 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
188 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
189 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
190 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
191 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
192 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
193 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
194 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
195 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
196 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
197 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
198 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
199 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
200 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
201 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
202 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
203 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
204 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
205 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
206 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
207 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
208 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
209 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
210 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
211 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
212 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
213 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
214 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
215 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
216 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
217 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
218 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
219 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
220 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
221 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
222 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
223 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
224 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
225 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
226 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
227 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
228 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
229 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
230 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
231 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
232 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
233 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
234 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
235 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
236 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
237 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
238 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
239 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
240 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
241 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
242 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
243 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
244 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
245 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
246 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
247 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
248 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
249 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
250 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
251 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
252 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
253 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
254 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
255 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
256 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
257 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
258 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
259 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
265 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
266 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
268 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
270 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
271 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
288 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
290 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
291 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
293 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
294 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
295 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
296 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
297 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
298 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
299 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
300 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
301 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
302 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
303 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
304 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
305 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
306 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
307 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
308 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
309 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
310 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
311 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
312 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
313 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
314 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
315 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
316 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
317 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
318 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
319 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
320 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
321 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
322 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
323 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
324 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
325 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
326 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
327 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
328 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
329 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
330 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
331 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
332 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
336 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
337 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
338 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
339 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
340 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
341 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
342 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
343 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
344 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
345 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
346 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
347 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
348 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
349 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
352 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
353 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
356 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
357 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
358 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
359 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
360 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
361 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
364 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
365 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
366 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
373 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
374 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
375 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
376 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
377 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
378 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
379 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
380 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
381 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
382 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
383 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
384 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
385 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
388 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
389 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
390 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
391 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
392 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
393 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
394 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
395 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
396 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
397 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
398 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
399 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
400 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
401 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
402 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
406 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
407 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
408 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
409 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
410 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
411 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
412 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
413 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
414 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
415 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
416 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
417 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
418 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
419 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
420 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
421 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
426 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
427 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
428 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
429 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
430 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
431 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
432 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
433 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
434 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
435 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
436 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
437 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
438 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
439 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
440 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
441 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
442 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
443 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
444 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
445 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
446 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
447 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
448 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
449 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
450 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
451 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
452 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
453 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
454 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
455 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
456 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
457 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.85
Metatranscriptomes 0
Isolates 22.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 2.47
Rhizoplane 6.94
Rhizosphere 72.81
Stem 0
Stem Tuber 0
Unclassified 11.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2198927 2162886007 Bacteria 1514
2 SwRhRL2b_contig_391535 2162886007 Bacteria 2256
3 JGI25162J39368_1000824 3300002737 Bacteria 20443
4 JGI25163J39215_1000875 3300002771 Bacteria 7064
5 JGI25163J39215_1000897 3300002771 Bacteria 6898
6 JGI25164J39214_1000456 3300002772 Bacteria 21062
7 JGI25164J39214_1000464 3300002772 Bacteria 20573
8 JGI25165J46597_1000888 3300003214 Bacteria 21062
9 JGI25165J46597_1000906 3300003214 Bacteria 20573
10 Ga0055538_1000093 3300003751 Bacteria 75896
11 Ga0055539_1000138 3300003752 Bacteria 75896
12 Ga0055533_1000142 3300003756 Bacteria 75896
13 Ga0055532_1000152 3300003758 Bacteria 61495
14 Ga0055525_1000342 3300003759 Bacteria 34036
15 Ga0055535_1005444 3300003761 Bacteria 2788
16 Ga0055536_1002321 3300003781 Bacteria 10765
17 Ga0055536_1021517 3300003781 Bacteria 1954
18 Ga0055536_1022172 3300003781 Bacteria 1904
19 Ga0055530_10003078 3300003791 Bacteria 9915
20 Ga0055530_10004122 3300003791 Bacteria 7713
21 Ga0055540_1001801 3300003792 Bacteria 12179
22 Ga0055540_1002628 3300003792 Bacteria 9324
23 Ga0055540_1003748 3300003792 Bacteria 7184
24 Ga0055531_10004937 3300003794 Bacteria 7931
25 Ga0055541_1000091 3300003841 Bacteria 75896
26 Ga0065714_10010949 3300005288 Bacteria 2523
27 Ga0065714_10011409 3300005288 Bacteria 2115
28 Ga0065714_10013394 3300005288 Bacteria 1892
29 Ga0065714_10024810 3300005288 Bacteria 1166
30 Ga0065714_10065334 3300005288 Bacteria 10809
31 Ga0065714_10078549 3300005288 Bacteria 2589
32 Ga0065714_10102247 3300005288 Bacteria 1626
33 Ga0065714_10116954 3300005288 Bacteria 1394
34 Ga0065714_10129798 3300005288 Bacteria 1261
35 Ga0065704_10094931 3300005289 Bacteria 2516
36 Ga0065712_10010845 3300005290 Bacteria 2474
37 Ga0065712_10012266 3300005290 Bacteria 3001
38 Ga0065712_10070056 3300005290 Bacteria 6368
39 Ga0070670_100005617 3300005331 Bacteria 10584
40 Ga0070670_100021712 3300005331 Bacteria 5520
41 Ga0070661_100000961 3300005344 Bacteria 20513
42 Ga0070669_100000904 3300005353 Bacteria 21597
43 Ga0070662_100002124 3300005457 Bacteria 12146
44 Ga0070665_100038532 3300005548 Bacteria 4805
45 Ga0070664_100010006 3300005564 Bacteria 7686
46 Ga0068851_10014826 3300005834 Bacteria 3707
47 Ga0075364_10071685 3300006051 Bacteria 2282
48 Ga0075364_10138861 3300006051 Bacteria 1633
49 Ga0075432_10004969 3300006058 Bacteria 4534
50 Ga0075432_10044344 3300006058 Bacteria 1559
51 Ga0075362_10104722 3300006177 Bacteria 1326
52 Ga0075436_100115975 3300006914 Bacteria 1871
53 Ga0075436_100149651 3300006914 Bacteria 1642
54 Ga0079104_1000375 3300006946 Bacteria 52652
55 Ga0099826_10001328 3300006948 Bacteria 14629
56 Ga0105251_10001251 3300009011 Bacteria 22007
57 Ga0105251_10019667 3300009011 Bacteria 3561
58 Ga0105251_10023608 3300009011 Bacteria 3170
59 Ga0105251_10032414 3300009011 Bacteria 2604
60 Ga0105251_10036841 3300009011 Bacteria 2404
61 Ga0105251_10046794 3300009011 Bacteria 2081
62 Ga0105251_10109388 3300009011 Bacteria 1260
63 Ga0105244_10000709 3300009036 Bacteria 28850
64 Ga0105244_10005465 3300009036 Bacteria 8445
65 Ga0105244_10017555 3300009036 Bacteria 4040
66 Ga0105244_10036386 3300009036 Bacteria 2579
67 Ga0105244_10039151 3300009036 Bacteria 2469
68 Ga0105244_10067870 3300009036 Bacteria 1783
69 Ga0105244_10075941 3300009036 Bacteria 1669
70 Ga0105244_10080984 3300009036 Bacteria 1607
71 Ga0105244_10082295 3300009036 Bacteria 1592
72 Ga0105250_10001909 3300009092 Bacteria 10814
73 Ga0105250_10002486 3300009092 Bacteria 9247
74 Ga0105250_10006952 3300009092 Bacteria 4896
75 Ga0105250_10019711 3300009092 Bacteria 2727
76 Ga0105250_10021777 3300009092 Bacteria 2586
77 Ga0105243_10001321 3300009148 Bacteria 22100
78 Ga0105243_10002510 3300009148 Bacteria 15315
79 Ga0105243_10045098 3300009148 Bacteria 3463
80 Ga0105243_10104937 3300009148 Bacteria 2353
81 Ga0105243_10146696 3300009148 Bacteria 2019
82 Ga0105243_10159491 3300009148 Bacteria 1944
83 Ga0105242_10019163 3300009176 Bacteria 5360
84 Ga0105237_10000335 3300009545 Bacteria 66335
85 Ga0105246_10045141 3300011119 Bacteria 2999
86 Ga0105246_10074065 3300011119 Bacteria 2406
87 Ga0157345_1001267 3300012498 Bacteria 1788
88 Ga0157345_1002153 3300012498 Bacteria 1385
89 Ga0157373_10009179 3300013100 Bacteria 7314
90 Ga0157373_10060199 3300013100 Bacteria 2690
91 Ga0157373_10080681 3300013100 Bacteria 2294
92 Ga0157373_10124741 3300013100 Bacteria 1811
93 Ga0157373_10144747 3300013100 Bacteria 1671
94 Ga0157373_10153025 3300013100 Bacteria 1622
95 Ga0157373_10249403 3300013100 Bacteria 1255
96 Ga0157373_10302776 3300013100 Bacteria 1135
97 Ga0157371_10000406 3300013102 Bacteria 53786
98 Ga0157371_10120923 3300013102 Bacteria 1862
99 Ga0157371_10130430 3300013102 Bacteria 1788
100 Ga0157371_10138029 3300013102 Bacteria 1737
101 Ga0157370_10020721 3300013104 Bacteria 6561
102 Ga0157370_10091733 3300013104 Bacteria 2852
103 Ga0157370_10214766 3300013104 Bacteria 1782
104 Ga0157370_10347389 3300013104 Bacteria 1367
105 Ga0157370_10475684 3300013104 Bacteria 1148
106 Ga0157369_10269111 3300013105 Bacteria 1776
107 Ga0157369_10288243 3300013105 Bacteria 1709
108 Ga0157369_10298840 3300013105 Bacteria 1675
109 Ga0157369_10352523 3300013105 Bacteria 1528
110 Ga0157369_10676826 3300013105 Bacteria 1063
111 Ga0157369_10676827 3300013105 Bacteria 1063
112 Ga0163162_10018412 3300013306 Bacteria 6843
113 Ga0163162_10020389 3300013306 Bacteria 6514
114 Ga0163162_10337700 3300013306 Bacteria 1639
115 Ga0157372_10065328 3300013307 Bacteria 4085
116 Ga0157372_10425118 3300013307 Bacteria 1548
117 Ga0157375_10035628 3300013308 Bacteria 4752
118 Ga0157375_10320551 3300013308 Bacteria 1714
119 Ga0157375_10424722 3300013308 Bacteria 1495
120 Ga0182008_10002836 3300014497 Bacteria 10718
121 Ga0182008_10006570 3300014497 Bacteria 6489
122 Ga0182008_10009892 3300014497 Bacteria 5128
123 Ga0182008_10009961 3300014497 Bacteria 5107
124 Ga0182008_10015133 3300014497 Bacteria 4032
125 Ga0182008_10083276 3300014497 Bacteria 1575
126 Ga0182008_10088068 3300014497 Bacteria 1530
127 Ga0182008_10089508 3300014497 Bacteria 1517
128 Ga0182006_1004944 3300015261 Bacteria 6443
129 Ga0182006_1005306 3300015261 Bacteria 6160
130 Ga0182006_1007062 3300015261 Bacteria 5166
131 Ga0182006_1028858 3300015261 Bacteria 2252
132 Ga0182006_1038810 3300015261 Bacteria 1881
133 Ga0182006_1041644 3300015261 Bacteria 1802
134 Ga0182006_1051013 3300015261 Bacteria 1593
135 Ga0182006_1051728 3300015261 Bacteria 1579
136 Ga0182006_1058685 3300015261 Bacteria 1458
137 Ga0182006_1077032 3300015261 Bacteria 1224
138 Ga0182007_10004376 3300015262 Bacteria 6412
139 Ga0182007_10034435 3300015262 Bacteria 1711
140 Ga0182005_1009818 3300015265 Bacteria 2769
141 Ga0163161_10010497 3300017792 Bacteria 6414
142 Ga0163161_10014495 3300017792 Bacteria 5488
143 Ga0163161_10029171 3300017792 Bacteria 3922
144 Ga0163161_10087968 3300017792 Bacteria 2296
145 Ga0163161_10177392 3300017792 Bacteria 1632
146 Ga0163161_10186954 3300017792 Bacteria 1591
147 Ga0209760_100079 3300025207 Bacteria 77345
148 Ga0209760_100211 3300025207 Bacteria 26630
149 Ga0209784_100128 3300025224 Bacteria 76497
150 Ga0209566_100157 3300025225 Bacteria 76430
151 Ga0209674_100180 3300025226 Bacteria 76497
152 Ga0209147_100183 3300025229 Bacteria 75926
153 Ga0209563_100144 3300025230 Bacteria 76497
154 Ga0209563_100667 3300025230 Bacteria 10926
155 Ga0207427_100001 3300025231 Bacteria 1410763
156 Ga0207427_100048 3300025231 Bacteria 238464
157 Ga0209437_100003 3300025233 Bacteria 1517827
158 Ga0209437_100094 3300025233 Bacteria 238465
159 Ga0209258_100310 3300025242 Bacteria 76430
160 Ga0209646_1000355 3300025246 Bacteria 32593
161 Ga0209677_100127 3300025253 Bacteria 76548
162 Ga0209759_1004030 3300025256 Bacteria 5628
163 Ga0209759_1009505 3300025256 Bacteria 2935
164 Ga0209233_1000007 3300025261 Bacteria 1411234
165 Ga0209233_1000106 3300025261 Bacteria 268795
166 Ga0209676_1000055 3300025292 Bacteria 361565
167 Ga0209676_1000950 3300025292 Bacteria 35488
168 Ga0209676_1000959 3300025292 Bacteria 34915
169 Ga0209676_1005690 3300025292 Bacteria 6411
170 Ga0209676_1005768 3300025292 Bacteria 6342
171 Ga0209050_1000079 3300025298 Bacteria 277803
172 Ga0209050_1000606 3300025298 Bacteria 57003
173 Ga0209050_1000941 3300025298 Bacteria 37976
174 Ga0209050_1000970 3300025298 Bacteria 36710
175 Ga0209051_1000054 3300025303 Bacteria 280804
176 Ga0209051_1000083 3300025303 Bacteria 192732
177 Ga0209051_1000429 3300025303 Bacteria 57551
178 Ga0209051_1006446 3300025303 Bacteria 6605
179 Ga0209257_1000175 3300025304 Bacteria 165070
180 Ga0207656_10001116 3300025321 Bacteria 8827
181 Ga0207696_1000175 3300025711 Bacteria 102142
182 Ga0207696_1000426 3300025711 Bacteria 38552
183 Ga0207696_1001872 3300025711 Bacteria 10780
184 Ga0207696_1008252 3300025711 Bacteria 4006
185 Ga0207696_1014646 3300025711 Bacteria 2683
186 Ga0207655_1000019 3300025728 Bacteria 536324
187 Ga0207655_1000434 3300025728 Bacteria 56142
188 Ga0207655_1000972 3300025728 Bacteria 29527
189 Ga0207655_1001801 3300025728 Bacteria 18589
190 Ga0207655_1006273 3300025728 Bacteria 7906
191 Ga0207655_1023065 3300025728 Bacteria 3098
192 Ga0207655_1025232 3300025728 Bacteria 2891
193 Ga0207655_1027485 3300025728 Bacteria 2709
194 Ga0207655_1035409 3300025728 Bacteria 2229
195 Ga0207655_1036326 3300025728 Bacteria 2186
196 Ga0207655_1038777 3300025728 Bacteria 2078
197 Ga0207655_1041165 3300025728 Bacteria 1982
198 Ga0207655_1041298 3300025728 Bacteria 1978
199 Ga0207655_1051689 3300025728 Bacteria 1659
200 Ga0207713_1000207 3300025735 Bacteria 79895
201 Ga0207713_1000299 3300025735 Bacteria 56880
202 Ga0207713_1010436 3300025735 Bacteria 5138
203 Ga0207713_1014958 3300025735 Bacteria 4002
204 Ga0207713_1018119 3300025735 Bacteria 3496
205 Ga0207713_1019469 3300025735 Bacteria 3319
206 Ga0207713_1022978 3300025735 Bacteria 2946
207 Ga0207713_1041210 3300025735 Bacteria 1929
208 Ga0207671_10000018 3300025914 Bacteria 318130
209 Ga0207649_10000008 3300025920 Bacteria 315683
210 Ga0207681_10002297 3300025923 Bacteria 12156
211 Ga0207681_10038297 3300025923 Bacteria 3176
212 Ga0207650_10002243 3300025925 Bacteria 13495
213 Ga0207650_10004740 3300025925 Bacteria 9292
214 Ga0207706_10001633 3300025933 Bacteria 22226
215 Ga0207706_10175056 3300025933 Bacteria 1885
216 Ga0207686_10010975 3300025934 Bacteria 4943
217 Ga0207709_10000089 3300025935 Bacteria 149139
218 Ga0207709_10001814 3300025935 Bacteria 14255
219 Ga0207709_10034506 3300025935 Bacteria 2982
220 Ga0207709_10049233 3300025935 Bacteria 2571
221 Ga0207709_10097434 3300025935 Bacteria 1937
222 Ga0207679_10000008 3300025945 Bacteria 412057
223 Ga0209281_1000018 3300027111 Bacteria 579091
224 Ga0209281_1000391 3300027111 Bacteria 68959
225 Ga0209281_1002058 3300027111 Bacteria 9059
226 Ga0209371_1002020 3300027312 Bacteria 12176
227 Ga0209371_1006324 3300027312 Bacteria 4415
228 Ga0209282_1053271 3300027666 Bacteria 2304
229 Ga0207428_10017124 3300027907 Bacteria 6227
230 Ga0207428_10036996 3300027907 Bacteria 3975
231 Ga0207428_10048629 3300027907 Bacteria 3401
232 Ga0207428_10088086 3300027907 Bacteria 2415
233 Ga0207428_10141635 3300027907 Bacteria 1835
234 Ga0268266_10018069 3300028379 Bacteria 6010
235 Ga0268266_10409160 3300028379 Bacteria 1284
236 Ga0268256_1000683 3300030500 Bacteria 25530
237 Ga0268256_1006351 3300030500 Bacteria 4415
238 Ga0307511_10146258 3300030521 Bacteria 1372
239 Ga0316178_1087112 3300030735 Bacteria 7323
240 Ga0307509_10350081 3300031507 Bacteria 1201
241 Ga0307408_100032542 3300031548 Bacteria 3636
242 Ga0307408_100168323 3300031548 Bacteria 1747
243 Ga0307408_100210264 3300031548 Bacteria 1580
244 Ga0307408_100277403 3300031548 Bacteria 1394
245 Ga0307405_10005822 3300031731 Bacteria 5998
246 Ga0307405_10326306 3300031731 Bacteria 1174
247 Ga0307405_10338071 3300031731 Bacteria 1156
248 Ga0307413_10033819 3300031824 Bacteria 2915
249 Ga0307412_10043004 3300031911 Bacteria 2939
250 Ga0307411_10105635 3300032005 Bacteria 2002
251 Ga0307411_10216229 3300032005 Bacteria 1483
252 Ga0307411_10398097 3300032005 Bacteria 1137
253 Ga0237819_00787 3300038705 Bacteria 10146
254 Ga0439436_0020880 3300041404 Bacteria 1948
255 Ga0439438_003520 3300041405 Bacteria 6313
256 Ga0439438_003556 3300041405 Bacteria 6257
257 Ga0439438_006717 3300041405 Bacteria 4015
258 Ga0439438_023509 3300041405 Bacteria 1697
259 Ga0439438_044922 3300041405 Bacteria 1137
260 Ga0439438_044925 3300041405 Bacteria 1137
261 Ga0439447_002687 3300041407 Bacteria 6435
262 Ga0439447_006607 3300041407 Bacteria 3747
263 Ga0439447_010193 3300041407 Bacteria 2801
264 Ga0439447_029983 3300041407 Bacteria 1373
265 Ga0439466_0002047 3300041411 Bacteria 7900
266 Ga0439466_0003072 3300041411 Bacteria 6494
267 Ga0439466_0003320 3300041411 Bacteria 6258
268 Ga0439466_0005230 3300041411 Bacteria 4968
269 Ga0439466_0016551 3300041411 Bacteria 2663
270 Ga0439466_0019313 3300041411 Bacteria 2438
271 Ga0439466_0022042 3300041411 Bacteria 2251
272 Ga0439466_0036490 3300041411 Bacteria 1659
273 Ga0439432_002614 3300042006 Bacteria 6768
274 Ga0439432_024748 3300042006 Bacteria 1973
275 Ga0439432_024769 3300042006 Bacteria 1971
276 Ga0439432_028123 3300042006 Bacteria 1832
277 Ga0439432_031194 3300042006 Bacteria 1725
278 Ga0439432_032284 3300042006 Bacteria 1688
279 Ga0439432_035906 3300042006 Bacteria 1587
280 Ga0439451_004081 3300042009 Bacteria 2965
281 Ga0439451_009331 3300042009 Bacteria 1985
282 Ga0439451_013552 3300042009 Bacteria 1648
283 Ga0439452_001971 3300042010 Bacteria 7849
284 Ga0439452_002234 3300042010 Bacteria 7264
285 Ga0439452_002717 3300042010 Bacteria 6415
286 Ga0439452_004105 3300042010 Bacteria 4951
287 Ga0439452_008840 3300042010 Bacteria 3005
288 Ga0439452_021368 3300042010 Bacteria 1687
289 Ga0439456_000724 3300042013 Bacteria 6771
290 Ga0439456_028210 3300042013 Bacteria 1197
291 Ga0439463_018850 3300042016 Bacteria 1718
292 Ga0450911_000989 3300042115 Bacteria 7366
293 Ga0450911_004391 3300042115 Bacteria 2318
294 Ga0450920_000323 3300042122 Bacteria 7279
295 Ga0450922_000233 3300042124 Bacteria 6000
296 Ga0450900_004893 3300042136 Bacteria 1561
297 Ga0450902_001495 3300042137 Bacteria 3192
298 Ga0450902_004873 3300042137 Bacteria 2009
299 Ga0450902_011205 3300042137 Bacteria 1423
300 Ga0450903_007661 3300042138 Bacteria 1772
301 Ga0450903_008463 3300042138 Bacteria 1681
302 Ga0450903_008565 3300042138 Bacteria 1672
303 Ga0450905_000259 3300042142 Bacteria 6215
304 Ga0450905_009588 3300042142 Bacteria 1333
305 Ga0450906_001792 3300042145 Bacteria 4711
306 Ga0450906_002154 3300042145 Bacteria 4304
307 Ga0450906_011162 3300042145 Bacteria 1684
308 Ga0450907_002371 3300042146 Bacteria 3626
309 Ga0450907_007775 3300042146 Bacteria 1786
310 Ga0439446_0002125 3300042156 Bacteria 4700
311 Ga0439446_0036822 3300042156 Bacteria 1431
312 Ga0450909_003369 3300042185 Bacteria 2279
313 Ga0439434_0001684 3300042435 Bacteria 6404
314 Ga0439464_0026244 3300042439 Bacteria 1615
315 Ga0439460_0007945 3300042461 Bacteria 2669
316 Ga0439460_0013457 3300042461 Bacteria 2140
317 Ga0439460_0025082 3300042461 Bacteria 1657
318 Ga0450901_000068 3300042533 Bacteria 10539
319 Ga0450901_005614 3300042533 Bacteria 1287
320 Ga0451577_0128905 3300042876 Bacteria 2268
321 Ga0439440_0013194 3300042993 Bacteria 1767
322 Ga0439440_0014683 3300042993 Bacteria 1693
323 Ga0495617_001724 3300046452 Bacteria 9363
324 Ga0495617_004628 3300046452 Bacteria 4977
325 Ga0495617_029422 3300046452 Bacteria 1846
326 Ga0495617_042260 3300046452 Bacteria 1523
327 Ga0495617_045241 3300046452 Bacteria 1467
328 Ga0495617_058550 3300046452 Bacteria 1277
329 Ga0495627_000423 3300046453 Bacteria 36816
330 Ga0495627_002133 3300046453 Bacteria 9968
331 Ga0495627_003667 3300046453 Bacteria 6665
332 Ga0495627_003943 3300046453 Bacteria 6346
333 Ga0495627_015523 3300046453 Bacteria 2628
334 Ga0495627_018704 3300046453 Bacteria 2331
335 Ga0495627_022260 3300046453 Bacteria 2087
336 Ga0495627_041647 3300046453 Bacteria 1410
337 Ga0495603_0061569 3300046455 Bacteria 2216
338 Ga0495590_0001676 3300046457 Bacteria 9432
339 Ga0495590_0003517 3300046457 Bacteria 6392
340 Ga0495590_0030223 3300046457 Bacteria 1898
341 Ga0495590_0041994 3300046457 Bacteria 1594
342 Ga0495590_0045216 3300046457 Bacteria 1535
343 Ga0495590_0046488 3300046457 Bacteria 1514
344 Ga0495591_000822 3300046458 Bacteria 21997
345 Ga0495591_004666 3300046458 Bacteria 6587
346 Ga0495591_005344 3300046458 Bacteria 5973
347 Ga0495591_007846 3300046458 Bacteria 4459
348 Ga0495591_010629 3300046458 Bacteria 3550
349 Ga0495591_028972 3300046458 Bacteria 1687
350 Ga0495591_038371 3300046458 Bacteria 1379
351 Ga0495591_038867 3300046458 Bacteria 1367
352 Ga0495591_043902 3300046458 Bacteria 1255
353 Ga0495629_0068187 3300046459 Bacteria 2482
354 Ga0495638_0005430 3300046460 Bacteria 9483
355 Ga0495638_0005848 3300046460 Bacteria 9043
356 Ga0495638_0010061 3300046460 Bacteria 6592
357 Ga0495638_0018580 3300046460 Bacteria 4613
358 Ga0495638_0019444 3300046460 Bacteria 4494
359 Ga0495638_0048358 3300046460 Bacteria 2662
360 Ga0495638_0057118 3300046460 Bacteria 2421
361 Ga0495638_0073971 3300046460 Bacteria 2078
362 Ga0495638_0097232 3300046460 Bacteria 1765
363 Ga0495653_0015817 3300046463 Bacteria 6150
364 Ga0495653_0086183 3300046463 Bacteria 2308
365 Ga0495653_0090701 3300046463 Bacteria 2235
366 Ga0495653_0094466 3300046463 Bacteria 2178
367 Ga0495653_0128863 3300046463 Bacteria 1793
368 Ga0495650_0004871 3300046471 Bacteria 8979
369 Ga0495650_0005972 3300046471 Bacteria 7715
370 Ga0495650_0011996 3300046471 Bacteria 4691
371 Ga0495650_0028924 3300046471 Bacteria 2533
372 Ga0495650_0053647 3300046471 Bacteria 1649
373 Ga0495650_0070991 3300046471 Bacteria 1366
374 Ga0495582_0011028 3300046473 Bacteria 4975
375 Ga0495605_0000373 3300046474 Bacteria 42328
376 Ga0495605_0000903 3300046474 Bacteria 20403
377 Ga0495605_0006937 3300046474 Bacteria 6469
378 Ga0495605_0010769 3300046474 Bacteria 5110
379 Ga0495605_0024099 3300046474 Bacteria 3189
380 Ga0495605_0038058 3300046474 Bacteria 2415
381 Ga0495605_0049954 3300046474 Bacteria 2041
382 Ga0495605_0075133 3300046474 Bacteria 1589
383 Ga0495605_0117966 3300046474 Bacteria 1205
384 Ga0495639_0003160 3300046475 Bacteria 7157
385 Ga0495639_0063909 3300046475 Bacteria 1690
386 Ga0495584_0002893 3300046491 Bacteria 9586
387 Ga0495584_0005772 3300046491 Bacteria 6529
388 Ga0495584_0009399 3300046491 Bacteria 5035
389 Ga0495584_0014317 3300046491 Bacteria 4041
390 Ga0495584_0020834 3300046491 Bacteria 3328
391 Ga0495584_0065445 3300046491 Bacteria 1828
392 Ga0495584_0067250 3300046491 Bacteria 1801
393 Ga0495584_0090224 3300046491 Bacteria 1545
394 Ga0495584_0114151 3300046491 Bacteria 1367
395 Ga0495585_0005462 3300046492 Bacteria 8009
396 Ga0495585_0056406 3300046492 Bacteria 2169
397 Ga0495585_0079795 3300046492 Bacteria 1774
398 Ga0495585_0104055 3300046492 Bacteria 1515
399 Ga0495585_0122837 3300046492 Bacteria 1372
400 Ga0495594_0000612 3300046499 Bacteria 18385
401 Ga0495594_0141212 3300046499 Bacteria 1366
402 Ga0495596_0002729 3300046500 Bacteria 9274
403 Ga0495607_0000869 3300046501 Bacteria 28344
404 Ga0495607_0001054 3300046501 Bacteria 25166
405 Ga0495607_0001549 3300046501 Bacteria 20131
406 Ga0495607_0005710 3300046501 Bacteria 8864
407 Ga0495607_0010013 3300046501 Bacteria 6387
408 Ga0495607_0012035 3300046501 Bacteria 5725
409 Ga0495607_0039152 3300046501 Bacteria 2833
410 Ga0495607_0042916 3300046501 Bacteria 2678
411 Ga0495607_0044219 3300046501 Bacteria 2627
412 Ga0495607_0046493 3300046501 Bacteria 2548
413 Ga0495607_0047200 3300046501 Bacteria 2524
414 Ga0495607_0052897 3300046501 Bacteria 2349
415 Ga0495607_0080678 3300046501 Bacteria 1788
416 Ga0495607_0087870 3300046501 Bacteria 1690
417 Ga0495607_0088674 3300046501 Bacteria 1681
418 Ga0495607_0098462 3300046501 Bacteria 1570
419 Ga0495607_0116347 3300046501 Bacteria 1410
420 Ga0495607_0125150 3300046501 Bacteria 1344
421 Ga0495607_0168164 3300046501 Bacteria 1109
422 Ga0495583_0000521 3300046506 Bacteria 54646
423 Ga0495583_0004447 3300046506 Bacteria 10026
424 Ga0495583_0007969 3300046506 Bacteria 6551
425 Ga0495583_0008745 3300046506 Bacteria 6144
426 Ga0495583_0011128 3300046506 Bacteria 5184
427 Ga0495583_0075473 3300046506 Bacteria 1474
428 Ga0495606_0013204 3300046507 Bacteria 6552
429 Ga0495606_0021286 3300046507 Bacteria 4752
430 Ga0495606_0022176 3300046507 Bacteria 4634
431 Ga0495606_0024326 3300046507 Bacteria 4367
432 Ga0495606_0071066 3300046507 Bacteria 2192
433 Ga0495606_0119885 3300046507 Bacteria 1575
434 Ga0495606_0120810 3300046507 Bacteria 1568
435 Ga0495606_0122553 3300046507 Bacteria 1554
436 Ga0495606_0137015 3300046507 Bacteria 1448
437 Ga0495610_0009426 3300046512 Bacteria 6175
438 Ga0495610_0009546 3300046512 Bacteria 6120
439 Ga0495610_0011113 3300046512 Bacteria 5528
440 Ga0495610_0037183 3300046512 Bacteria 2479
441 Ga0495610_0045652 3300046512 Bacteria 2166
442 Ga0495610_0047722 3300046512 Bacteria 2105
443 Ga0495610_0055655 3300046512 Bacteria 1905
444 Ga0495610_0057052 3300046512 Bacteria 1874
445 Ga0495610_0059293 3300046512 Bacteria 1827
446 Ga0495610_0069724 3300046512 Bacteria 1644
447 Ga0495610_0070255 3300046512 Bacteria 1636
448 Ga0495610_0087206 3300046512 Bacteria 1420
449 Ga0495616_0006310 3300046513 Bacteria 7193
450 Ga0495616_0022827 3300046513 Bacteria 3374
451 Ga0495616_0049434 3300046513 Bacteria 2108
452 Ga0495616_0049887 3300046513 Bacteria 2095
453 Ga0495616_0061425 3300046513 Bacteria 1842
454 Ga0495616_0090295 3300046513 Bacteria 1451
455 Ga0495620_0000054 3300046515 Bacteria 100835
456 Ga0495620_0000413 3300046515 Bacteria 28516
457 Ga0495620_0010881 3300046515 Bacteria 4778
458 Ga0495620_0015204 3300046515 Bacteria 3890
459 Ga0495620_0018753 3300046515 Bacteria 3420
460 Ga0495620_0032485 3300046515 Bacteria 2377
461 Ga0495620_0051232 3300046515 Bacteria 1758
462 Ga0495620_0064370 3300046515 Bacteria 1516
463 Ga0495620_0100048 3300046515 Bacteria 1156
464 Ga0495630_0024127 3300046517 Bacteria 4497
465 Ga0495630_0269642 3300046517 Bacteria 1300
466 Ga0495631_0002466 3300046518 Bacteria 10426
467 Ga0495631_0004944 3300046518 Bacteria 7024
468 Ga0495631_0005089 3300046518 Bacteria 6925
469 Ga0495631_0025617 3300046518 Bacteria 2714
470 Ga0495631_0040347 3300046518 Bacteria 2068
471 Ga0495631_0052427 3300046518 Bacteria 1782
472 Ga0495631_0053722 3300046518 Bacteria 1758
473 Ga0495632_0003472 3300046519 Bacteria 11151
474 Ga0495632_0004992 3300046519 Bacteria 8892
475 Ga0495632_0012246 3300046519 Bacteria 4952
476 Ga0495632_0013231 3300046519 Bacteria 4717
477 Ga0495632_0013697 3300046519 Bacteria 4615
478 Ga0495632_0015762 3300046519 Bacteria 4224
479 Ga0495632_0020156 3300046519 Bacteria 3617
480 Ga0495632_0036607 3300046519 Bacteria 2495
481 Ga0495632_0037199 3300046519 Bacteria 2471
482 Ga0495632_0046625 3300046519 Bacteria 2152
483 Ga0495632_0050615 3300046519 Bacteria 2047
484 Ga0495632_0106254 3300046519 Bacteria 1320
485 Ga0495632_0113206 3300046519 Bacteria 1272
486 Ga0495637_0002741 3300046520 Bacteria 9595
487 Ga0495637_0003263 3300046520 Bacteria 8628
488 Ga0495637_0005290 3300046520 Bacteria 6600
489 Ga0495637_0006328 3300046520 Bacteria 5950
490 Ga0495637_0009393 3300046520 Bacteria 4772
491 Ga0495637_0012337 3300046520 Bacteria 4090
492 Ga0495637_0023908 3300046520 Bacteria 2767
493 Ga0495637_0024815 3300046520 Bacteria 2710
494 Ga0495637_0033820 3300046520 Bacteria 2243
495 Ga0495637_0057538 3300046520 Bacteria 1605
496 Ga0495637_0060365 3300046520 Bacteria 1557
497 Ga0495637_0065269 3300046520 Bacteria 1482
498 Ga0495637_0076639 3300046520 Bacteria 1339
499 Ga0495637_0118018 3300046520 Bacteria 1023
500 Ga0495643_0039177 3300046522 Bacteria 2593
501 Ga0495644_0002733 3300046523 Bacteria 6996
502 Ga0495644_0038306 3300046523 Bacteria 1808
503 Ga0495644_0066537 3300046523 Bacteria 1353
504 Ga0495644_0073859 3300046523 Bacteria 1282
505 Ga0495648_0004518 3300046524 Bacteria 11860
506 Ga0495648_0009694 3300046524 Bacteria 7422
507 Ga0495648_0009969 3300046524 Bacteria 7290
508 Ga0495648_0012209 3300046524 Bacteria 6420
509 Ga0495648_0014500 3300046524 Bacteria 5766
510 Ga0495648_0016463 3300046524 Bacteria 5332
511 Ga0495648_0020195 3300046524 Bacteria 4656
512 Ga0495648_0029376 3300046524 Bacteria 3649
513 Ga0495648_0052930 3300046524 Bacteria 2462
514 Ga0495648_0094378 3300046524 Bacteria 1666
515 Ga0495648_0102480 3300046524 Bacteria 1576
516 Ga0495648_0126557 3300046524 Bacteria 1364
517 Ga0495648_0136205 3300046524 Bacteria 1298
518 Ga0495666_0065511 3300046526 Bacteria 1732
519 Ga0495666_0071680 3300046526 Bacteria 1646
520 Ga0495666_0071910 3300046526 Bacteria 1643
521 Ga0495642_0001528 3300046528 Bacteria 10274
522 Ga0495642_0005239 3300046528 Bacteria 4984
523 Ga0495642_0005299 3300046528 Bacteria 4948
524 Ga0495654_0000875 3300046530 Bacteria 22618
525 Ga0495654_0003407 3300046530 Bacteria 9760
526 Ga0495654_0003646 3300046530 Bacteria 9355
527 Ga0495654_0006655 3300046530 Bacteria 6539
528 Ga0495654_0006951 3300046530 Bacteria 6377
529 Ga0495654_0007007 3300046530 Bacteria 6348
530 Ga0495654_0007541 3300046530 Bacteria 6068
531 Ga0495654_0010594 3300046530 Bacteria 5012
532 Ga0495654_0011143 3300046530 Bacteria 4881
533 Ga0495654_0017168 3300046530 Bacteria 3809
534 Ga0495654_0023656 3300046530 Bacteria 3180
535 Ga0495654_0030072 3300046530 Bacteria 2765
536 Ga0495654_0031304 3300046530 Bacteria 2701
537 Ga0495654_0037907 3300046530 Bacteria 2413
538 Ga0495654_0066012 3300046530 Bacteria 1726
539 Ga0495654_0075480 3300046530 Bacteria 1590
540 Ga0495586_0064336 3300046535 Bacteria 1998
541 Ga0495587_0054967 3300046536 Bacteria 2345
542 Ga0495609_0000349 3300046538 Bacteria 40285
543 Ga0495609_0009175 3300046538 Bacteria 4796
544 Ga0495609_0051324 3300046538 Bacteria 1836
545 Ga0495609_0057953 3300046538 Bacteria 1713
546 Ga0495597_0000221 3300046542 Bacteria 52360
547 Ga0495597_0002355 3300046542 Bacteria 12161
548 Ga0495597_0012109 3300046542 Bacteria 4168
549 Ga0495597_0013605 3300046542 Bacteria 3892
550 Ga0495597_0014265 3300046542 Bacteria 3786
551 Ga0495597_0031972 3300046542 Bacteria 2390
552 Ga0495597_0061745 3300046542 Bacteria 1631
553 Ga0495597_0092758 3300046542 Bacteria 1280
554 Ga0495597_0102937 3300046542 Bacteria 1202
555 Ga0495645_0064600 3300046543 Bacteria 2648
556 Ga0495622_0000853 3300046557 Bacteria 16756
557 Ga0495622_0004796 3300046557 Bacteria 6267
558 Ga0495622_0007565 3300046557 Bacteria 5044
559 Ga0495622_0021031 3300046557 Bacteria 3039
560 Ga0495622_0057181 3300046557 Bacteria 1808
561 Ga0495622_0071880 3300046557 Bacteria 1596
562 Ga0495622_0091676 3300046557 Bacteria 1396
563 Ga0495633_0000287 3300046558 Bacteria 58020
564 Ga0495633_0008482 3300046558 Bacteria 5779
565 Ga0495633_0030817 3300046558 Bacteria 2603
566 Ga0495633_0076620 3300046558 Bacteria 1557
567 Ga0495668_0007362 3300046616 Bacteria 7052
568 Ga0495668_0012376 3300046616 Bacteria 5059
569 Ga0495634_0005385 3300046642 Bacteria 9859
570 Ga0495611_0001725 3300046648 Bacteria 10580
571 Ga0495611_0001973 3300046648 Bacteria 9731
572 Ga0495625_0007564 3300046660 Bacteria 9432
573 Ga0495625_0007957 3300046660 Bacteria 9109
574 Ga0495625_0025133 3300046660 Bacteria 4520
575 Ga0495625_0090428 3300046660 Bacteria 2117
576 Ga0495625_0136668 3300046660 Bacteria 1656
577 Ga0495625_0182755 3300046660 Bacteria 1393
578 Ga0495625_0206178 3300046660 Bacteria 1294
579 Ga0495635_0040495 3300046663 Bacteria 3219
580 Ga0495659_0001232 3300046664 Bacteria 8857
581 Ga0495659_0003330 3300046664 Bacteria 5154
582 Ga0495659_0034077 3300046664 Bacteria 1789
583 Ga0495661_0000596 3300046665 Bacteria 37123
584 Ga0495661_0008587 3300046665 Bacteria 7060
585 Ga0495661_0013929 3300046665 Bacteria 5392
586 Ga0495661_0080628 3300046665 Bacteria 1877
587 Ga0495661_0095387 3300046665 Bacteria 1684
588 Ga0495661_0115717 3300046665 Bacteria 1488
589 Ga0495588_0013670 3300046674 Bacteria 3870
590 Ga0495588_0107683 3300046674 Bacteria 1467
591 Ga0495588_0109244 3300046674 Bacteria 1456
592 Ga0495657_0054525 3300046675 Bacteria 2670
593 Ga0495623_0007248 3300046679 Bacteria 7197
594 Ga0495623_0134893 3300046679 Bacteria 1474
595 Ga0495646_0014970 3300046680 Bacteria 4927
596 Ga0495646_0019790 3300046680 Bacteria 4256
597 Ga0495669_0030582 3300046684 Bacteria 2363
598 Ga0495613_0020114 3300046689 Bacteria 4974
599 Ga0495613_0150417 3300046689 Bacteria 1660
600 Ga0495613_0340449 3300046689 Bacteria 1032
601 Ga0495624_0100430 3300046690 Bacteria 1781
602 Ga0495670_0004673 3300046691 Bacteria 6717
603 Ga0495670_0005284 3300046691 Bacteria 6353
604 Ga0495670_0027015 3300046691 Bacteria 2841
605 Ga0495670_0033496 3300046691 Bacteria 2556
606 Ga0495670_0126809 3300046691 Bacteria 1329
607 Ga0495670_0132343 3300046691 Bacteria 1300
608 Ga0495671_0006050 3300046692 Bacteria 7033
609 Ga0495671_0006650 3300046692 Bacteria 6660
610 Ga0495671_0006995 3300046692 Bacteria 6466
611 Ga0495671_0013093 3300046692 Bacteria 4507
612 Ga0495671_0018380 3300046692 Bacteria 3712
613 Ga0495671_0020305 3300046692 Bacteria 3500
614 Ga0495671_0027399 3300046692 Bacteria 2943
615 Ga0495671_0067046 3300046692 Bacteria 1765
616 Ga0495671_0075065 3300046692 Bacteria 1658
617 Ga0495671_0121613 3300046692 Bacteria 1273
618 Ga0495649_0007229 3300046694 Bacteria 6802
619 Ga0495649_0007817 3300046694 Bacteria 6481
620 Ga0495649_0007878 3300046694 Bacteria 6445
621 Ga0495649_0011400 3300046694 Bacteria 5212
622 Ga0495649_0016250 3300046694 Bacteria 4220
623 Ga0495649_0020620 3300046694 Bacteria 3695
624 Ga0495649_0063981 3300046694 Bacteria 1976
625 Ga0495649_0070843 3300046694 Bacteria 1869
626 Ga0495649_0079830 3300046694 Bacteria 1750
627 Ga0495649_0104495 3300046694 Bacteria 1504
628 Ga0495589_0002065 3300046794 Bacteria 11371
629 Ga0495589_0002775 3300046794 Bacteria 9691
630 Ga0495589_0009137 3300046794 Bacteria 5154
631 Ga0495589_0009752 3300046794 Bacteria 4987
632 Ga0495589_0020860 3300046794 Bacteria 3349
633 Ga0495589_0071184 3300046794 Bacteria 1700
634 Ga0495589_0108816 3300046794 Bacteria 1338
635 Ga0495589_0114953 3300046794 Bacteria 1297
636 Ga0495660_0001754 3300046810 Bacteria 14453
637 Ga0495660_0012183 3300046810 Bacteria 4989
638 Ga0495660_0020994 3300046810 Bacteria 3742
639 Ga0495660_0045614 3300046810 Bacteria 2405
640 Ga0495660_0046409 3300046810 Bacteria 2382
641 Ga0495660_0059306 3300046810 Bacteria 2058
642 Ga0495660_0074849 3300046810 Bacteria 1787
643 Ga0495660_0079382 3300046810 Bacteria 1723
644 Ga0495660_0109969 3300046810 Bacteria 1407
645 Ga0495660_0124729 3300046810 Bacteria 1298
646 Ga0495660_0136139 3300046810 Bacteria 1227
647 Ga0495604_0008431 3300047317 Bacteria 8139
648 Ga0495604_0032318 3300047317 Bacteria 4149
649 Ga0495604_0150745 3300047317 Bacteria 1652
650 Ga0495604_0240064 3300047317 Bacteria 1239
651 Ga0495636_0012407 3300047318 Bacteria 3373
652 Ga0495672_0009375 3300047320 Bacteria 7099
653 Ga0495672_0010252 3300047320 Bacteria 6694
654 Ga0495672_0014602 3300047320 Bacteria 5369
655 Ga0495672_0015264 3300047320 Bacteria 5221
656 Ga0495672_0021286 3300047320 Bacteria 4231
657 Ga0495672_0032112 3300047320 Bacteria 3270
658 Ga0495672_0056206 3300047320 Bacteria 2291
659 Ga0495672_0078044 3300047320 Bacteria 1854
660 Ga0495672_0082132 3300047320 Bacteria 1793
661 Ga0495672_0091413 3300047320 Bacteria 1670
662 Ga0495672_0120048 3300047320 Bacteria 1398
663 Ga0495672_0140043 3300047320 Bacteria 1264
664 Ga0495676_0002177 3300047321 Bacteria 17357
665 Ga0495676_0114051 3300047321 Bacteria 1977
666 Ga0495680_0018118 3300047322 Bacteria 5988
667 Ga0495680_0100413 3300047322 Bacteria 2156
668 Ga0495683_0000053 3300047323 Bacteria 121769
669 Ga0495683_0000129 3300047323 Bacteria 75590
670 Ga0495683_0003047 3300047323 Bacteria 9849
671 Ga0495683_0025899 3300047323 Bacteria 3003
672 Ga0495683_0040230 3300047323 Bacteria 2361
673 Ga0495683_0045261 3300047323 Bacteria 2211
674 Ga0495683_0074262 3300047323 Bacteria 1666
675 Ga0495683_0075746 3300047323 Bacteria 1647
676 Ga0495683_0113688 3300047323 Bacteria 1290
677 Ga0495687_004396 3300047443 Bacteria 9556
678 Ga0495687_012633 3300047443 Bacteria 4451
679 Ga0495687_029964 3300047443 Bacteria 2510
680 Ga0495677_0005671 3300047445 Bacteria 4731
681 Ga0495679_000381 3300047446 Bacteria 34012
682 Ga0495679_007117 3300047446 Bacteria 4711
683 Ga0495679_031487 3300047446 Bacteria 1710
684 Ga0495679_033014 3300047446 Bacteria 1655
685 Ga0495685_066942 3300047447 Bacteria 1206
686 Ga0495673_0001495 3300047469 Bacteria 18488
687 Ga0495673_0003834 3300047469 Bacteria 9708
688 Ga0495673_0004508 3300047469 Bacteria 8694
689 Ga0495673_0006177 3300047469 Bacteria 7094
690 Ga0495673_0007246 3300047469 Bacteria 6407
691 Ga0495673_0011850 3300047469 Bacteria 4659
692 Ga0495673_0014045 3300047469 Bacteria 4178
693 Ga0495673_0014292 3300047469 Bacteria 4131
694 Ga0495673_0051462 3300047469 Bacteria 1803
695 Ga0495673_0059813 3300047469 Bacteria 1636
696 Ga0495673_0083476 3300047469 Bacteria 1318
697 Ga0495681_0007254 3300047470 Bacteria 7124
698 Ga0495681_0007399 3300047470 Bacteria 7023
699 Ga0495681_0007889 3300047470 Bacteria 6731
700 Ga0495681_0008428 3300047470 Bacteria 6468
701 Ga0495681_0009708 3300047470 Bacteria 5898
702 Ga0495681_0009797 3300047470 Bacteria 5860
703 Ga0495681_0010583 3300047470 Bacteria 5576
704 Ga0495681_0024197 3300047470 Bacteria 3207
705 Ga0495681_0031033 3300047470 Bacteria 2712
706 Ga0495681_0048603 3300047470 Bacteria 2009
707 Ga0495681_0049170 3300047470 Bacteria 1994
708 Ga0495681_0063619 3300047470 Bacteria 1692
709 Ga0495681_0070803 3300047470 Bacteria 1580
710 Ga0495681_0077408 3300047470 Bacteria 1492
711 Ga0495681_0093330 3300047470 Bacteria 1325
712 Ga0495684_0048621 3300047471 Bacteria 3242
713 Ga0495686_0011491 3300047472 Bacteria 6235
714 Ga0495686_0090130 3300047472 Bacteria 1863
715 Ga0495686_0118000 3300047472 Bacteria 1584
716 Ga0495593_0016169 3300047673 Bacteria 4211
717 Ga0495593_0072910 3300047673 Bacteria 1781
718 Ga0495593_0077797 3300047673 Bacteria 1718
719 Ga0495602_0155161 3300048088 Bacteria 1794
720 Ga0495626_0003380 3300048091 Bacteria 10269
721 Ga0495626_0005884 3300048091 Bacteria 7063
722 Ga0495626_0006281 3300048091 Bacteria 6783
723 Ga0495626_0006409 3300048091 Bacteria 6700
724 Ga0495626_0006683 3300048091 Bacteria 6535
725 Ga0495626_0045371 3300048091 Bacteria 2052
726 Ga0495626_0067379 3300048091 Bacteria 1616
727 Ga0496102_0006510 3300048905 Bacteria 9963
728 Ga0496106_0292765 3300048909 Bacteria 1305
729 Ga0496110_0085009 3300048913 Bacteria 2824
730 Ga0496110_0141939 3300048913 Bacteria 2171
731 Ga0496110_0262335 3300048913 Bacteria 1572
732 Ga0496110_0338370 3300048913 Bacteria 1371
733 Ga0496112_0094542 3300048915 Bacteria 2959
734 Ga0496114_0016215 3300048917 Bacteria 5999
735 Ga0496116_0000677 3300048919 Bacteria 44238
736 Ga0496116_0012788 3300048919 Bacteria 6818
737 Ga0496116_0015011 3300048919 Bacteria 6145
738 Ga0496117_0008203 3300048920 Bacteria 9961
739 Ga0496117_0013703 3300048920 Bacteria 7046
740 Ga0496117_0016210 3300048920 Bacteria 6297
741 Ga0496117_0050588 3300048920 Bacteria 2945
742 Ga0496117_0128213 3300048920 Bacteria 1543
743 Ga0496117_0137191 3300048920 Bacteria 1471
744 Ga0496118_0038509 3300048921 Bacteria 3830
745 Ga0496118_0041108 3300048921 Bacteria 3665
746 Ga0496118_0091756 3300048921 Bacteria 2087
747 Ga0496118_0131595 3300048921 Bacteria 1605
748 Ga0496118_0133596 3300048921 Bacteria 1587
749 Ga0496118_0164863 3300048921 Bacteria 1363
750 Ga0496118_0165040 3300048921 Bacteria 1362
751 Ga0496119_0000943 3300048922 Bacteria 37460
752 Ga0496119_0101893 3300048922 Bacteria 1610
753 Ga0496119_0119559 3300048922 Bacteria 1450
754 Ga0496120_0011781 3300048923 Bacteria 5985
755 Ga0496120_0026440 3300048923 Bacteria 3583
756 Ga0496120_0089472 3300048923 Bacteria 1648
757 Ga0496121_0000299 3300048924 Bacteria 103000
758 Ga0496121_0055715 3300048924 Bacteria 3290
759 Ga0496121_0183679 3300048924 Bacteria 1506
760 Ga0496121_0224722 3300048924 Bacteria 1319
761 Ga0496122_0016635 3300048925 Bacteria 6939
762 Ga0496122_0019422 3300048925 Bacteria 6208
763 Ga0496122_0028672 3300048925 Bacteria 4715
764 Ga0496122_0113805 3300048925 Bacteria 1766
765 Ga0496122_0223678 3300048925 Bacteria 1077
766 Ga0496123_0012802 3300048926 Bacteria 7112
767 Ga0496123_0050022 3300048926 Bacteria 2796
768 Ga0496123_0098187 3300048926 Bacteria 1713
769 Ga0496123_0098744 3300048926 Bacteria 1706
770 Ga0496123_0113632 3300048926 Bacteria 1541
771 Ga0496124_0019636 3300048927 Bacteria 6279
772 Ga0496124_0019995 3300048927 Bacteria 6206
773 Ga0496124_0029500 3300048927 Bacteria 4886
774 Ga0496124_0073159 3300048927 Bacteria 2836
775 Ga0496124_0083573 3300048927 Bacteria 2619
776 Ga0496124_0099998 3300048927 Bacteria 2351
777 Ga0496124_0120560 3300048927 Bacteria 2096
778 Ga0496124_0180725 3300048927 Bacteria 1623
779 Ga0496124_0181964 3300048927 Bacteria 1616
780 Ga0496124_0319419 3300048927 Bacteria 1112
781 Ga0496125_0020199 3300048928 Bacteria 6260
782 Ga0496125_0021517 3300048928 Bacteria 6014
783 Ga0496125_0026196 3300048928 Bacteria 5320
784 Ga0496125_0037940 3300048928 Bacteria 4181
785 Ga0496125_0126058 3300048928 Bacteria 1814
786 Ga0496125_0152334 3300048928 Bacteria 1585
787 Ga0496125_0158973 3300048928 Bacteria 1538
788 Ga0496125_0170707 3300048928 Bacteria 1462
789 Ga0496126_0022913 3300048929 Bacteria 6063
790 Ga0496126_0098318 3300048929 Bacteria 2564
791 Ga0496126_0208875 3300048929 Bacteria 1644
792 Ga0496126_0227378 3300048929 Bacteria 1564
793 Ga0495678_000362 3300049459 Bacteria 46331
794 Ga0495678_003571 3300049459 Bacteria 9521
795 Ga0495678_006194 3300049459 Bacteria 6399
796 Ga0495678_006317 3300049459 Bacteria 6322
797 Ga0495678_010485 3300049459 Bacteria 4505
798 Ga0495678_041162 3300049459 Bacteria 1851
799 Ga0495678_042941 3300049459 Bacteria 1798
800 Ga0495678_046888 3300049459 Bacteria 1695
801 Ga0495678_052247 3300049459 Bacteria 1574
802 Ga0495678_062445 3300049459 Bacteria 1394
803 Ga0495682_0000268 3300049460 Bacteria 41058
804 Ga0495682_0030321 3300049460 Bacteria 2000
805 Ga0495682_0034371 3300049460 Bacteria 1869
806 Ga0495682_0038797 3300049460 Bacteria 1749
807 Ga0495682_0045771 3300049460 Bacteria 1598
808 Ga0495682_0068366 3300049460 Bacteria 1279
809 Ga0501032_0016840 3300049569 Bacteria 5136
810 Ga0501034_0047016 3300049571 Bacteria 4359
811 Ga0501034_0206785 3300049571 Bacteria 1919
812 Ga0501037_0034086 3300049573 Bacteria 3759
813 Ga0501038_0102187 3300049574 Bacteria 2386
814 Ga0501241_000589 3300049758 Bacteria 7808
815 nmdc:mga03683_90883_c1 3300050489 Bacteria 1331
816 nmdc:mga00v17_131060_c1 3300050491 Bacteria 1602
817 nmdc:mga00v17_327807_c1 3300050491 Bacteria 995
818 Ga0500572_036297 3300053111 Bacteria 1406
819 Ga0500634_0055203 3300053161 Bacteria 2125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 3007315729 3007317717 275
2 3300046520 Ga0495637_0118018 Ga0495637_0118018_117_989 290
3 3300046689 Ga0495613_0340449 Ga0495613_0340449_11_883 290
4 iso_pu_bacteria 3007803356 3007807821 290
5 3300012498 Ga0157345_1001267 Ga0157345_10012672 315
6 3300013306 Ga0163162_10018412 Ga0163162_100184122 315
7 3300017792 Ga0163161_10087968 Ga0163161_100879682 315
8 3300025728 Ga0207655_1035409 Ga0207655_10354092 315
9 3300025728 Ga0207655_1051689 Ga0207655_10516891 315
10 3300046453 Ga0495627_003667 Ga0495627_003667_904_1914 315
11 3300046453 Ga0495627_003943 Ga0495627_003943_4771_5781 315
12 3300046460 Ga0495638_0073971 Ga0495638_0073971_261_1271 315
13 3300046501 Ga0495607_0046493 Ga0495607_0046493_1488_2498 315
14 3300046501 Ga0495607_0098462 Ga0495607_0098462_247_1257 315
15 3300046506 Ga0495583_0011128 Ga0495583_0011128_784_1794 315
16 3300046507 Ga0495606_0022176 Ga0495606_0022176_2975_3976 315
17 3300046507 Ga0495606_0137015 Ga0495606_0137015_25_1035 315
18 3300046512 Ga0495610_0047722 Ga0495610_0047722_837_1847 315
19 3300046512 Ga0495610_0069724 Ga0495610_0069724_67_1077 315
20 3300046513 Ga0495616_0090295 Ga0495616_0090295_195_1205 315
21 3300046515 Ga0495620_0100048 Ga0495620_0100048_81_1091 315
22 3300046518 Ga0495631_0052427 Ga0495631_0052427_519_1529 315
23 3300046519 Ga0495632_0004992 Ga0495632_0004992_47_1057 315
24 3300046519 Ga0495632_0013697 Ga0495632_0013697_3559_4569 315
25 3300046524 Ga0495648_0052930 Ga0495648_0052930_1206_2216 315
26 3300046530 Ga0495654_0010594 Ga0495654_0010594_3930_4940 315
27 3300046538 Ga0495609_0051324 Ga0495609_0051324_726_1736 315
28 3300046542 Ga0495597_0061745 Ga0495597_0061745_253_1263 315
29 3300046557 Ga0495622_0007565 Ga0495622_0007565_3579_4589 315
30 3300046648 Ga0495611_0001973 Ga0495611_0001973_7839_8849 315
31 3300046660 Ga0495625_0007957 Ga0495625_0007957_7849_8859 315
32 3300046665 Ga0495661_0095387 Ga0495661_0095387_215_1225 315
33 3300046691 Ga0495670_0004673 Ga0495670_0004673_816_1826 315
34 3300047320 Ga0495672_0082132 Ga0495672_0082132_534_1544 315
35 3300047469 Ga0495673_0083476 Ga0495673_0083476_258_1268 315
36 3300047470 Ga0495681_0007889 Ga0495681_0007889_4872_5882 315
37 3300047472 Ga0495686_0090130 Ga0495686_0090130_602_1612 315
38 3300048919 Ga0496116_0012788 Ga0496116_0012788_4910_5920 315
39 3300049459 Ga0495678_010485 Ga0495678_010485_549_1550 315
40 3300049459 Ga0495678_042941 Ga0495678_042941_734_1744 315
41 3300049460 Ga0495682_0030321 Ga0495682_0030321_252_1262 315
42 3300014497 Ga0182008_10009961 Ga0182008_100099612 316
43 3300015261 Ga0182006_1058685 Ga0182006_10586852 316
44 3300046458 Ga0495591_043902 Ga0495591_043902_288_1238 316
45 3300050491 nmdc:mga00v17_327807_c1 nmdc:mga00v17_327807_c1_20_970 316
46 3300009011 Ga0105251_10001251 Ga0105251_1000125114 318
47 3300009092 Ga0105250_10001909 Ga0105250_100019093 318
48 3300025711 Ga0207696_1000175 Ga0207696_100017593 318
49 3300025735 Ga0207713_1000207 Ga0207713_10002079 318
50 3300013105 Ga0157369_10288243 Ga0157369_102882431 321
51 3300042156 Ga0439446_0002125 Ga0439446_0002125_752_1762 321
52 3300046492 Ga0495585_0079795 Ga0495585_0079795_514_1524 321
53 3300046501 Ga0495607_0088674 Ga0495607_0088674_118_1128 322
54 3300046542 Ga0495597_0000221 Ga0495597_0000221_12131_13141 322
55 3300046692 Ga0495671_0018380 Ga0495671_0018380_2515_3525 322
56 3300046810 Ga0495660_0020994 Ga0495660_0020994_2354_3364 322
57 3300049460 Ga0495682_0000268 Ga0495682_0000268_534_1535 322
58 3300006051 Ga0075364_10138861 Ga0075364_101388612 323
59 3300009148 Ga0105243_10002510 Ga0105243_100025106 323
60 3300013102 Ga0157371_10130430 Ga0157371_101304301 323
61 3300014497 Ga0182008_10002836 Ga0182008_100028369 323
62 3300025935 Ga0207709_10001814 Ga0207709_100018145 323
63 3300046507 Ga0495606_0071066 Ga0495606_0071066_261_1271 323
64 3300046558 Ga0495633_0076620 Ga0495633_0076620_95_1105 323
65 3300047320 Ga0495672_0009375 Ga0495672_0009375_5581_6591 323
66 3300048919 Ga0496116_0000677 Ga0496116_0000677_37632_38642 323
67 3300048920 Ga0496117_0013703 Ga0496117_0013703_5592_6602 323
68 3300048924 Ga0496121_0000299 Ga0496121_0000299_96385_97395 323
69 3300048925 Ga0496122_0016635 Ga0496122_0016635_5560_6570 323
70 3300048926 Ga0496123_0012802 Ga0496123_0012802_503_1513 323
71 3300005290 Ga0065712_10070056 Ga0065712_100700567 324
72 3300009036 Ga0105244_10000709 Ga0105244_1000070916 324
73 3300009148 Ga0105243_10146696 Ga0105243_101466962 324
74 3300011119 Ga0105246_10045141 Ga0105246_100451412 324
75 3300013100 Ga0157373_10009179 Ga0157373_100091792 324
76 3300015261 Ga0182006_1077032 Ga0182006_10770321 324
77 3300025728 Ga0207655_1006273 Ga0207655_10062732 324
78 3300046471 Ga0495650_0004871 Ga0495650_0004871_2826_3836 324
79 3300046474 Ga0495605_0000373 Ga0495605_0000373_37795_38805 324
80 3300046499 Ga0495594_0000612 Ga0495594_0000612_12277_13287 324
81 3300046501 Ga0495607_0042916 Ga0495607_0042916_231_1241 324
82 3300046506 Ga0495583_0000521 Ga0495583_0000521_40366_41376 324
83 3300046515 Ga0495620_0000413 Ga0495620_0000413_23914_24924 324
84 3300046518 Ga0495631_0005089 Ga0495631_0005089_3388_4398 324
85 3300046524 Ga0495648_0016463 Ga0495648_0016463_2269_3279 324
86 3300046530 Ga0495654_0000875 Ga0495654_0000875_8312_9322 324
87 3300046538 Ga0495609_0000349 Ga0495609_0000349_13298_14308 324
88 3300046542 Ga0495597_0002355 Ga0495597_0002355_7736_8746 324
89 3300046558 Ga0495633_0000287 Ga0495633_0000287_13276_14286 324
90 3300046648 Ga0495611_0001725 Ga0495611_0001725_5987_6997 324
91 3300046665 Ga0495661_0000596 Ga0495661_0000596_13290_14300 324
92 3300046794 Ga0495589_0002065 Ga0495589_0002065_8487_9497 324
93 3300046810 Ga0495660_0001754 Ga0495660_0001754_4539_5549 324
94 3300047323 Ga0495683_0000053 Ga0495683_0000053_107465_108475 324
95 3300047446 Ga0495679_000381 Ga0495679_000381_3532_4542 324
96 3300048927 Ga0496124_0083573 Ga0496124_0083573_16_1029 324
97 3300049459 Ga0495678_000362 Ga0495678_000362_13289_14299 324
98 3300048927 Ga0496124_0099998 Ga0496124_0099998_1092_2096 325
99 iso_pu_bacteria 2728369097 2729148196 325
100 3300009036 Ga0105244_10039151 Ga0105244_100391512 326
101 3300042137 Ga0450902_001495 Ga0450902_001495_455_1459 326
102 3300042142 Ga0450905_000259 Ga0450905_000259_175_1179 326
103 3300042533 Ga0450901_000068 Ga0450901_000068_715_1719 326
104 3300009092 Ga0105250_10021777 Ga0105250_100217772 328
105 3300013307 Ga0157372_10425118 Ga0157372_104251181 328
106 3300025711 Ga0207696_1000426 Ga0207696_100042626 328
107 3300025735 Ga0207713_1041210 Ga0207713_10412102 328
108 3300025933 Ga0207706_10175056 Ga0207706_101750562 328
109 3300046457 Ga0495590_0046488 Ga0495590_0046488_278_1288 328
110 3300046463 Ga0495653_0094466 Ga0495653_0094466_945_1955 328
111 3300046492 Ga0495585_0056406 Ga0495585_0056406_905_1915 328
112 3300046616 Ga0495668_0012376 Ga0495668_0012376_532_1542 328
113 3300046810 Ga0495660_0124729 Ga0495660_0124729_102_1112 328
114 3300047321 Ga0495676_0114051 Ga0495676_0114051_253_1263 328
115 3300047446 Ga0495679_033014 Ga0495679_033014_233_1243 328
116 3300048920 Ga0496117_0137191 Ga0496117_0137191_77_1087 328
117 3300048921 Ga0496118_0133596 Ga0496118_0133596_191_1201 328
118 3300048926 Ga0496123_0113632 Ga0496123_0113632_343_1353 328
119 3300048927 Ga0496124_0181964 Ga0496124_0181964_222_1232 328
120 3300053111 Ga0500572_036297 Ga0500572_036297_242_1252 328
121 3300042876 Ga0451577_0128905 Ga0451577_0128905_669_1661 329
122 iso_pu_bacteria 3007419365 3007421600 329
123 3300005289 Ga0065704_10094931 Ga0065704_100949312 330
124 iso_pu_bacteria 2511231024 2511373237 330
125 iso_pu_bacteria 2554235231 2555244895 330
126 iso_pu_bacteria 2765235841 2765585224 330
127 iso_pu_bacteria 2919155634 2919157321 330
128 iso_pu_bacteria 8054929484 8054932869 330
129 iso_pu_bacteria 8056137416 8056139073 330
130 3300046810 Ga0495660_0059306 Ga0495660_0059306_793_1803 331
131 iso_pu_bacteria 2806310737 2807407432 331
132 iso_pu_bacteria 2806310745 2807455760 331
133 iso_pu_bacteria 8056115690 8056117867 331
134 iso_pu_bacteria 8056120720 8056124424 331
135 3300025256 Ga0209759_1004030 Ga0209759_10040304 332
136 3300047470 Ga0495681_0009797 Ga0495681_0009797_2916_3914 332
137 3300049571 Ga0501034_0047016 Ga0501034_0047016_1488_2492 332
138 3300049574 Ga0501038_0102187 Ga0501038_0102187_937_1941 332
139 iso_pu_bacteria 2511231004 2511257602 332
140 iso_pu_bacteria 2511231006 2511263660 332
141 iso_pu_bacteria 2511231007 2511270262 332
142 iso_pu_bacteria 2511231008 2511276452 332
143 iso_pu_bacteria 2511231010 2511291004 332
144 iso_pu_bacteria 2511231011 2511294249 332
145 iso_pu_bacteria 2511231012 2511302439 332
146 iso_pu_bacteria 2511231014 2511314036 332
147 iso_pu_bacteria 2511231015 2511319995 332
148 iso_pu_bacteria 2511231016 2511324784 332
149 iso_pu_bacteria 2511231017 2511330329 332
150 iso_pu_bacteria 2511231018 2511338017 332
151 iso_pu_bacteria 2511231019 2511342828 332
152 iso_pu_bacteria 2511231020 2511348796 332
153 iso_pu_bacteria 2511231021 2511354864 332
154 iso_pu_bacteria 2511231022 2511365897 332
155 iso_pu_bacteria 2511231023 2511369957 332
156 iso_pu_bacteria 2511231031 2511413254 332
157 iso_pu_bacteria 2511231156 2511823899 332
158 iso_pu_bacteria 2512047018 2512326842 332
159 iso_pu_bacteria 2554235132 2554814230 332
160 iso_pu_bacteria 2554235341 2555669058 332
161 iso_pu_bacteria 2582580891 2583791474 332
162 iso_pu_bacteria 2597489887 2597857198 332
163 iso_pu_bacteria 2597489888 2597864879 332
164 iso_pu_bacteria 2597489889 2597870755 332
165 iso_pu_bacteria 2599185155 2599328642 332
166 iso_pu_bacteria 2599185160 2599358050 332
167 iso_pu_bacteria 2599185161 2599361808 332
168 iso_pu_bacteria 2599185162 2599368129 332
169 iso_pu_bacteria 2599185163 2599374918 332
170 iso_pu_bacteria 2599185164 2599383215 332
171 iso_pu_bacteria 2599185165 2599389402 332
172 iso_pu_bacteria 2599185166 2599393776 332
173 iso_pu_bacteria 2599185167 2599398061 332
174 iso_pu_bacteria 2599185168 2599405543 332
175 iso_pu_bacteria 2599185179 2599452518 332
176 iso_pu_bacteria 2599185181 2599464865 332
177 iso_pu_bacteria 2599185182 2599468417 332
178 iso_pu_bacteria 2599185185 2599484220 332
179 iso_pu_bacteria 2599185186 2599493889 332
180 iso_pu_bacteria 2599185188 2599503148 332
181 iso_pu_bacteria 2599185189 2599507064 332
182 iso_pu_bacteria 2599185190 2599516184 332
183 iso_pu_bacteria 2599185191 2599518386 332
184 iso_pu_bacteria 2599185212 2599614834 332
185 iso_pu_bacteria 2599185248 2599769709 332
186 iso_pu_bacteria 2599185257 2599801870 332
187 iso_pu_bacteria 2599185288 2599878220 332
188 iso_pu_bacteria 2599185289 2599889029 332
189 iso_pu_bacteria 2599185290 2599895518 332
190 iso_pu_bacteria 2599185291 2599901609 332
191 iso_pu_bacteria 2599185300 2599933654 332
192 iso_pu_bacteria 2599185303 2599947413 332
193 iso_pu_bacteria 2599185304 2599953582 332
194 iso_pu_bacteria 2599185305 2599959268 332
195 iso_pu_bacteria 2599185306 2599967425 332
196 iso_pu_bacteria 2599185308 2599978665 332
197 iso_pu_bacteria 2599185309 2599982159 332
198 iso_pu_bacteria 2599185310 2599988962 332
199 iso_pu_bacteria 2599185311 2599994715 332
200 iso_pu_bacteria 2599185312 2599999575 332
201 iso_pu_bacteria 2599185313 2600007316 332
202 iso_pu_bacteria 2599185314 2600012733 332
203 iso_pu_bacteria 2599185315 2600020509 332
204 iso_pu_bacteria 2599185316 2600025240 332
205 iso_pu_bacteria 2599185317 2600029749 332
206 iso_pu_bacteria 2599185318 2600037819 332
207 iso_pu_bacteria 2599185319 2600042004 332
208 iso_pu_bacteria 2599185320 2600046911 332
209 iso_pu_bacteria 2599185321 2600055022 332
210 iso_pu_bacteria 2599185322 2600057770 332
211 iso_pu_bacteria 2599185323 2600064785 332
212 iso_pu_bacteria 2599185324 2600071672 332
213 iso_pu_bacteria 2599185325 2600076035 332
214 iso_pu_bacteria 2599185356 2600217596 332
215 iso_pu_bacteria 2600254930 2600359344 332
216 iso_pu_bacteria 2600254931 2600365447 332
217 iso_pu_bacteria 2600255296 2601689844 332
218 iso_pu_bacteria 2600255313 2601777764 332
219 iso_pu_bacteria 2600255318 2601795821 332
220 iso_pu_bacteria 2600255389 2602010047 332
221 iso_pu_bacteria 2603880185 2606075332 332
222 iso_pu_bacteria 2603880199 2606128195 332
223 iso_pu_bacteria 2606217733 2608381629 332
224 iso_pu_bacteria 2619619299 2621298528 332
225 iso_pu_bacteria 2623620443 2624479758 332
226 iso_pu_bacteria 2623620446 2624491413 332
227 iso_pu_bacteria 2643221565 2643842572 332
228 iso_pu_bacteria 2643221571 2643871582 332
229 iso_pu_bacteria 2643221589 2643952951 332
230 iso_pu_bacteria 2643221602 2644022713 332
231 iso_pu_bacteria 2643221633 2644188886 332
232 iso_pu_bacteria 2643221650 2644284961 332
233 iso_pu_bacteria 2643221713 2644621637 332
234 iso_pu_bacteria 2651869719 2652543896 332
235 iso_pu_bacteria 2667528170 2671093480 332
236 iso_pu_bacteria 2667528171 2671098447 332
237 iso_pu_bacteria 2667528176 2671128310 332
238 iso_pu_bacteria 2671180172 2671768819 332
239 iso_pu_bacteria 2675903420 2677899636 332
240 iso_pu_bacteria 2675903515 2678264259 332
241 iso_pu_bacteria 2713897148 2715752529 332
242 iso_pu_bacteria 2713897149 2715758026 332
243 iso_pu_bacteria 2718217725 2718633430 332
244 iso_pu_bacteria 2721755607 2723249636 332
245 iso_pu_bacteria 2738541265 2738674562 332
246 iso_pu_bacteria 2738541282 2738752955 332
247 iso_pu_bacteria 2738541294 2738809706 332
248 iso_pu_bacteria 2738541303 2738861996 332
249 iso_pu_bacteria 2738541309 2738897066 332
250 iso_pu_bacteria 2738543004 2739199796 332
251 iso_pu_bacteria 2738543015 2739259437 332
252 iso_pu_bacteria 2738543025 2739315785 332
253 iso_pu_bacteria 2740892503 2743736614 332
254 iso_pu_bacteria 2744054620 2745004714 332
255 iso_pu_bacteria 2773857670 2774121002 332
256 iso_pu_bacteria 2773857673 2774137339 332
257 iso_pu_bacteria 2784132063 2784263649 332
258 iso_pu_bacteria 2784132072 2784314074 332
259 iso_pu_bacteria 2791355520 2794596654 332
260 iso_pu_bacteria 2808606361 2808857647 332
261 iso_pu_bacteria 2808606376 2808924737 332
262 iso_pu_bacteria 2808606377 2808927742 332
263 iso_pu_bacteria 2808606378 2808937817 332
264 iso_pu_bacteria 2808606380 2808946839 332
265 iso_pu_bacteria 2808606381 2808949718 332
266 iso_pu_bacteria 2808606382 2808960254 332
267 iso_pu_bacteria 2808606383 2808966131 332
268 iso_pu_bacteria 2808606385 2808977168 332
269 iso_pu_bacteria 2808606388 2808992323 332
270 iso_pu_bacteria 2808606389 2809000979 332
271 iso_pu_bacteria 2808606445 2809216709 332
272 iso_pu_bacteria 2816332298 2817492324 332
273 iso_pu_bacteria 2818991456 2819656459 332
274 iso_pu_bacteria 2818991464 2819703527 332
275 iso_pu_bacteria 2823421272 2823424119 332
276 iso_pu_bacteria 2825651385 2825656801 332
277 iso_pu_bacteria 2826581358 2826583639 332
278 iso_pu_bacteria 2834028612 2834033740 332
279 iso_pu_bacteria 2842815866 2842818135 332
280 iso_pu_bacteria 2842826826 2842831125 332
281 iso_pu_bacteria 2842832357 2842832369 332
282 iso_pu_bacteria 2842837860 2842842384 332
283 iso_pu_bacteria 2842843487 2842848650 332
284 iso_pu_bacteria 2842849001 2842849230 332
285 iso_pu_bacteria 2842854478 2842854794 332
286 iso_pu_bacteria 2844665904 2844669497 332
287 iso_pu_bacteria 2852612431 2852613478 332
288 iso_pu_bacteria 2852657418 2852658275 332
289 iso_pu_bacteria 2852667396 2852668786 332
290 iso_pu_bacteria 2860339153 2860339627 332
291 iso_pu_bacteria 2860867994 2860871389 332
292 iso_pu_bacteria 2878029506 2878031770 332
293 iso_pu_bacteria 2880230671 2880234279 332
294 iso_pu_bacteria 2904518522 2904523605 332
295 iso_pu_bacteria 2904550169 2904554299 332
296 iso_pu_bacteria 2908446538 2908450764 332
297 iso_pu_bacteria 2912963787 2912967488 332
298 iso_pu_bacteria 2913036834 2913040736 332
299 iso_pu_bacteria 2917070673 2917072855 332
300 iso_pu_bacteria 2919063839 2919068244 332
301 iso_pu_bacteria 2919385768 2919386736 332
302 iso_pu_bacteria 2919456309 2919456719 332
303 iso_pu_bacteria 2919481497 2919482146 332
304 iso_pu_bacteria 2919487758 2919491517 332
305 iso_pu_bacteria 2919697872 2919701028 332
306 iso_pu_bacteria 2923153595 2923155630 332
307 iso_pu_bacteria 2923586266 2923587711 332
308 iso_pu_bacteria 2929144301 2929148232 332
309 iso_pu_bacteria 2929189879 2929193409 332
310 iso_pu_bacteria 2931369376 2931374355 332
311 iso_pu_bacteria 2931390751 2931394719 332
312 iso_pu_bacteria 2931396565 2931400488 332
313 iso_pu_bacteria 2935353572 2935359283 332
314 iso_pu_bacteria 2939636861 2939639268 332
315 iso_pu_bacteria 2939651529 2939652996 332
316 iso_pu_bacteria 2945928738 2945932570 332
317 iso_pu_bacteria 2945961074 2945962477 332
318 iso_pu_bacteria 2946006987 2946008813 332
319 iso_pu_bacteria 2946027586 2946031883 332
320 iso_pu_bacteria 2947233263 2947238711 332
321 iso_pu_bacteria 2969304461 2969306564 332
322 iso_pu_bacteria 2974289157 2974291749 332
323 iso_pu_bacteria 2984286254 2984290389 332
324 iso_pu_bacteria 2988728565 2988729879 332
325 iso_pu_bacteria 2998139840 2998141950 332
326 iso_pu_bacteria 3007395558 3007401214 332
327 iso_pu_bacteria 3007511990 3007513370 332
328 iso_pu_bacteria 3007614139 3007618395 332
329 iso_pu_bacteria 3007619802 3007619864 332
330 iso_pu_bacteria 3007718800 3007723778 332
331 iso_pu_bacteria 3007855910 3007860668 332
332 iso_pu_bacteria 3007861166 3007862823 332
333 iso_pu_bacteria 3007866637 3007868309 332
334 iso_pu_bacteria 637000220 637319407 332
335 iso_pu_bacteria 640427133 640487728 332
336 iso_pu_bacteria 8015687852 8015689888 332
337 iso_pu_bacteria 8019769354 8019775265 332
338 iso_pu_bacteria 8019775933 8019778308 332
339 iso_pu_bacteria 8029995093 8029998748 332
340 iso_pu_bacteria 8034962539 8034965866 332
341 iso_pu_bacteria 8054285046 8054288217 332
342 iso_pu_bacteria 8054347763 8054349183 332
343 iso_pu_bacteria 8054503363 8054507258 332
344 iso_pu_bacteria 8055770955 8055772993 332
345 iso_pu_bacteria 8055817908 8055822163 332
346 iso_pu_bacteria 8055878733 8055879636 332
347 iso_pu_bacteria 8056125926 8056127920 332
348 iso_pu_bacteria 8056131705 8056135648 332
349 iso_pu_bacteria 8056143049 8056147120 332
350 iso_pu_bacteria 8056148874 8056152949 332
351 iso_pu_bacteria 8056155041 8056155980 332
352 iso_pu_bacteria 8056161164 8056161847 332
353 iso_pu_bacteria 8056166840 8056169051 332
354 iso_pu_bacteria 8056172158 8056175199 332
355 iso_pu_bacteria 8056177738 8056183523 332
356 iso_pu_bacteria 8056569372 8056573006 332
357 iso_pu_bacteria 8057798959 8057799424 332
358 3300009011 Ga0105251_10036841 Ga0105251_100368412 333
359 3300009036 Ga0105244_10005465 Ga0105244_100054656 333
360 3300009148 Ga0105243_10045098 Ga0105243_100450982 333
361 3300025728 Ga0207655_1000019 Ga0207655_10000199 333
362 3300025735 Ga0207713_1022978 Ga0207713_10229782 333
363 3300025935 Ga0207709_10034506 Ga0207709_100345063 333
364 3300046501 Ga0495607_0010013 Ga0495607_0010013_792_1793 333
365 3300046513 Ga0495616_0022827 Ga0495616_0022827_1962_2963 333
366 3300046520 Ga0495637_0009393 Ga0495637_0009393_325_1326 333
367 3300046694 Ga0495649_0007229 Ga0495649_0007229_3214_4233 333
368 3300047321 Ga0495676_0002177 Ga0495676_0002177_7337_8356 333
369 3300047323 Ga0495683_0000129 Ga0495683_0000129_39937_40938 333
370 2162886007 SwRhRL2b_contig_391535 SwRhRL2b_0890.00000010 334
371 3300009011 Ga0105251_10019667 Ga0105251_100196672 334
372 3300009036 Ga0105244_10036386 Ga0105244_100363862 334
373 3300009148 Ga0105243_10104937 Ga0105243_101049372 334
374 3300013307 Ga0157372_10065328 Ga0157372_100653282 334
375 3300025711 Ga0207696_1008252 Ga0207696_10082522 334
376 3300025728 Ga0207655_1023065 Ga0207655_10230652 334
377 3300025735 Ga0207713_1018119 Ga0207713_10181192 334
378 3300025935 Ga0207709_10049233 Ga0207709_100492332 334
379 3300027312 Ga0209371_1002020 Ga0209371_100202010 334
380 3300027312 Ga0209371_1006324 Ga0209371_10063244 334
381 3300030500 Ga0268256_1000683 Ga0268256_100068316 334
382 3300030500 Ga0268256_1006351 Ga0268256_10063512 334
383 3300046515 Ga0495620_0000054 Ga0495620_0000054_42132_43136 334
384 3300046519 Ga0495632_0003472 Ga0495632_0003472_9640_10644 334
385 3300046524 Ga0495648_0004518 Ga0495648_0004518_7934_8938 334
386 3300048913 Ga0496110_0141939 Ga0496110_0141939_997_2001 334
387 3300048917 Ga0496114_0016215 Ga0496114_0016215_4745_5749 334
388 3300048920 Ga0496117_0008203 Ga0496117_0008203_8277_9281 334
389 3300048922 Ga0496119_0000943 Ga0496119_0000943_24149_25153 334
390 3300048923 Ga0496120_0011781 Ga0496120_0011781_4597_5601 334
391 3300048926 Ga0496123_0098187 Ga0496123_0098187_70_1074 334
392 3300048927 Ga0496124_0019995 Ga0496124_0019995_1595_2599 334
393 3300048927 Ga0496124_0120560 Ga0496124_0120560_804_1811 334
394 3300048928 Ga0496125_0037940 Ga0496125_0037940_223_1227 334
395 3300009011 Ga0105251_10046794 Ga0105251_100467942 335
396 3300015261 Ga0182006_1007062 Ga0182006_10070623 335
397 3300042006 Ga0439432_024748 Ga0439432_024748_564_1571 335
398 3300042010 Ga0439452_008840 Ga0439452_008840_1488_2495 335
399 3300042439 Ga0439464_0026244 Ga0439464_0026244_538_1545 335
400 3300046501 Ga0495607_0001054 Ga0495607_0001054_16286_17326 335
401 2162886007 SwRhRL2b_contig_2198927 SwRhRL2b_0122.00001520 336
402 3300002737 JGI25162J39368_1000824 JGI25162J39368_100082415 336
403 3300002771 JGI25163J39215_1000875 JGI25163J39215_10008755 336
404 3300002771 JGI25163J39215_1000897 JGI25163J39215_10008975 336
405 3300002772 JGI25164J39214_1000456 JGI25164J39214_100045617 336
406 3300002772 JGI25164J39214_1000464 JGI25164J39214_100046416 336
407 3300003214 JGI25165J46597_1000888 JGI25165J46597_100088817 336
408 3300003214 JGI25165J46597_1000906 JGI25165J46597_100090616 336
409 3300003751 Ga0055538_1000093 Ga0055538_100009351 336
410 3300003752 Ga0055539_1000138 Ga0055539_100013851 336
411 3300003756 Ga0055533_1000142 Ga0055533_100014251 336
412 3300003758 Ga0055532_1000152 Ga0055532_100015224 336
413 3300003759 Ga0055525_1000342 Ga0055525_100034219 336
414 3300003761 Ga0055535_1005444 Ga0055535_10054442 336
415 3300003781 Ga0055536_1002321 Ga0055536_10023219 336
416 3300003781 Ga0055536_1021517 Ga0055536_10215172 336
417 3300003781 Ga0055536_1022172 Ga0055536_10221722 336
418 3300003791 Ga0055530_10003078 Ga0055530_100030788 336
419 3300003791 Ga0055530_10004122 Ga0055530_100041226 336
420 3300003792 Ga0055540_1001801 Ga0055540_10018015 336
421 3300003792 Ga0055540_1002628 Ga0055540_10026282 336
422 3300003792 Ga0055540_1003748 Ga0055540_10037486 336
423 3300003794 Ga0055531_10004937 Ga0055531_100049372 336
424 3300003841 Ga0055541_1000091 Ga0055541_100009141 336
425 3300005288 Ga0065714_10010949 Ga0065714_100109492 336
426 3300005288 Ga0065714_10011409 Ga0065714_100114092 336
427 3300005288 Ga0065714_10013394 Ga0065714_100133942 336
428 3300005288 Ga0065714_10024810 Ga0065714_100248101 336
429 3300005288 Ga0065714_10065334 Ga0065714_100653348 336
430 3300005288 Ga0065714_10078549 Ga0065714_100785492 336
431 3300005288 Ga0065714_10102247 Ga0065714_101022472 336
432 3300005288 Ga0065714_10116954 Ga0065714_101169542 336
433 3300005288 Ga0065714_10129798 Ga0065714_101297981 336
434 3300005290 Ga0065712_10010845 Ga0065712_100108452 336
435 3300005290 Ga0065712_10012266 Ga0065712_100122662 336
436 3300005331 Ga0070670_100005617 Ga0070670_1000056172 336
437 3300005331 Ga0070670_100021712 Ga0070670_1000217122 336
438 3300005344 Ga0070661_100000961 Ga0070661_1000009619 336
439 3300005353 Ga0070669_100000904 Ga0070669_10000090410 336
440 3300005457 Ga0070662_100002124 Ga0070662_1000021244 336
441 3300005548 Ga0070665_100038532 Ga0070665_1000385322 336
442 3300005564 Ga0070664_100010006 Ga0070664_1000100067 336
443 3300005834 Ga0068851_10014826 Ga0068851_100148262 336
444 3300006051 Ga0075364_10071685 Ga0075364_100716852 336
445 3300006058 Ga0075432_10004969 Ga0075432_100049693 336
446 3300006058 Ga0075432_10044344 Ga0075432_100443442 336
447 3300006177 Ga0075362_10104722 Ga0075362_101047221 336
448 3300006914 Ga0075436_100115975 Ga0075436_1001159752 336
449 3300006914 Ga0075436_100149651 Ga0075436_1001496512 336
450 3300006946 Ga0079104_1000375 Ga0079104_100037516 336
451 3300006948 Ga0099826_10001328 Ga0099826_1000132812 336
452 3300009011 Ga0105251_10023608 Ga0105251_100236082 336
453 3300009011 Ga0105251_10032414 Ga0105251_100324141 336
454 3300009011 Ga0105251_10109388 Ga0105251_101093881 336
455 3300009036 Ga0105244_10017555 Ga0105244_100175552 336
456 3300009036 Ga0105244_10067870 Ga0105244_100678702 336
457 3300009036 Ga0105244_10075941 Ga0105244_100759411 336
458 3300009036 Ga0105244_10080984 Ga0105244_100809842 336
459 3300009036 Ga0105244_10082295 Ga0105244_100822952 336
460 3300009092 Ga0105250_10002486 Ga0105250_100024862 336
461 3300009092 Ga0105250_10006952 Ga0105250_100069522 336
462 3300009092 Ga0105250_10019711 Ga0105250_100197112 336
463 3300009148 Ga0105243_10001321 Ga0105243_1000132120 336
464 3300009148 Ga0105243_10159491 Ga0105243_101594912 336
465 3300009176 Ga0105242_10019163 Ga0105242_100191632 336
466 3300009545 Ga0105237_10000335 Ga0105237_1000033546 336
467 3300011119 Ga0105246_10074065 Ga0105246_100740651 336
468 3300012498 Ga0157345_1002153 Ga0157345_10021531 336
469 3300013100 Ga0157373_10060199 Ga0157373_100601992 336
470 3300013100 Ga0157373_10080681 Ga0157373_100806812 336
471 3300013100 Ga0157373_10124741 Ga0157373_101247411 336
472 3300013100 Ga0157373_10144747 Ga0157373_101447471 336
473 3300013100 Ga0157373_10153025 Ga0157373_101530251 336
474 3300013100 Ga0157373_10249403 Ga0157373_102494031 336
475 3300013100 Ga0157373_10302776 Ga0157373_103027761 336
476 3300013102 Ga0157371_10000406 Ga0157371_1000040636 336
477 3300013102 Ga0157371_10120923 Ga0157371_101209231 336
478 3300013102 Ga0157371_10138029 Ga0157371_101380291 336
479 3300013104 Ga0157370_10020721 Ga0157370_100207215 336
480 3300013104 Ga0157370_10091733 Ga0157370_100917332 336
481 3300013104 Ga0157370_10214766 Ga0157370_102147662 336
482 3300013104 Ga0157370_10347389 Ga0157370_103473892 336
483 3300013104 Ga0157370_10475684 Ga0157370_104756841 336
484 3300013105 Ga0157369_10269111 Ga0157369_102691112 336
485 3300013105 Ga0157369_10298840 Ga0157369_102988402 336
486 3300013105 Ga0157369_10352523 Ga0157369_103525232 336
487 3300013105 Ga0157369_10676826 Ga0157369_106768261 336
488 3300013105 Ga0157369_10676827 Ga0157369_106768271 336
489 3300013306 Ga0163162_10020389 Ga0163162_100203892 336
490 3300013306 Ga0163162_10337700 Ga0163162_103377001 336
491 3300013308 Ga0157375_10035628 Ga0157375_100356282 336
492 3300013308 Ga0157375_10320551 Ga0157375_103205513 336
493 3300013308 Ga0157375_10424722 Ga0157375_104247221 336
494 3300014497 Ga0182008_10006570 Ga0182008_100065705 336
495 3300014497 Ga0182008_10009892 Ga0182008_100098922 336
496 3300014497 Ga0182008_10015133 Ga0182008_100151332 336
497 3300014497 Ga0182008_10083276 Ga0182008_100832762 336
498 3300014497 Ga0182008_10088068 Ga0182008_100880681 336
499 3300014497 Ga0182008_10089508 Ga0182008_100895082 336
500 3300015261 Ga0182006_1004944 Ga0182006_10049444 336
501 3300015261 Ga0182006_1005306 Ga0182006_10053064 336
502 3300015261 Ga0182006_1028858 Ga0182006_10288582 336
503 3300015261 Ga0182006_1038810 Ga0182006_10388101 336
504 3300015261 Ga0182006_1041644 Ga0182006_10416441 336
505 3300015261 Ga0182006_1051013 Ga0182006_10510132 336
506 3300015261 Ga0182006_1051728 Ga0182006_10517281 336
507 3300015262 Ga0182007_10004376 Ga0182007_100043765 336
508 3300015262 Ga0182007_10034435 Ga0182007_100344351 336
509 3300015265 Ga0182005_1009818 Ga0182005_10098182 336
510 3300017792 Ga0163161_10010497 Ga0163161_100104972 336
511 3300017792 Ga0163161_10014495 Ga0163161_100144954 336
512 3300017792 Ga0163161_10029171 Ga0163161_100291712 336
513 3300017792 Ga0163161_10177392 Ga0163161_101773921 336
514 3300017792 Ga0163161_10186954 Ga0163161_101869542 336
515 3300025207 Ga0209760_100079 Ga0209760_10007916 336
516 3300025207 Ga0209760_100211 Ga0209760_10021115 336
517 3300025224 Ga0209784_100128 Ga0209784_10012841 336
518 3300025225 Ga0209566_100157 Ga0209566_10015740 336
519 3300025226 Ga0209674_100180 Ga0209674_10018041 336
520 3300025229 Ga0209147_100183 Ga0209147_10018350 336
521 3300025230 Ga0209563_100144 Ga0209563_10014441 336
522 3300025230 Ga0209563_100667 Ga0209563_1006678 336
523 3300025231 Ga0207427_100001 Ga0207427_1000011325 336
524 3300025231 Ga0207427_100048 Ga0207427_10004810 336
525 3300025233 Ga0209437_100003 Ga0209437_10000347 336
526 3300025233 Ga0209437_100094 Ga0209437_10009410 336
527 3300025242 Ga0209258_100310 Ga0209258_10031040 336
528 3300025246 Ga0209646_1000355 Ga0209646_100035520 336
529 3300025253 Ga0209677_100127 Ga0209677_10012741 336
530 3300025256 Ga0209759_1009505 Ga0209759_10095052 336
531 3300025261 Ga0209233_1000007 Ga0209233_10000071325 336
532 3300025261 Ga0209233_1000106 Ga0209233_1000106247 336
533 3300025292 Ga0209676_1000055 Ga0209676_1000055149 336
534 3300025292 Ga0209676_1000950 Ga0209676_10009502 336
535 3300025292 Ga0209676_1000959 Ga0209676_100095917 336
536 3300025292 Ga0209676_1005690 Ga0209676_10056902 336
537 3300025292 Ga0209676_1005768 Ga0209676_10057684 336
538 3300025298 Ga0209050_1000079 Ga0209050_1000079184 336
539 3300025298 Ga0209050_1000606 Ga0209050_100060614 336
540 3300025298 Ga0209050_1000941 Ga0209050_10009412 336
541 3300025298 Ga0209050_1000970 Ga0209050_10009702 336
542 3300025303 Ga0209051_1000054 Ga0209051_1000054187 336
543 3300025303 Ga0209051_1000083 Ga0209051_100008343 336
544 3300025303 Ga0209051_1000429 Ga0209051_100042919 336
545 3300025303 Ga0209051_1006446 Ga0209051_10064462 336
546 3300025304 Ga0209257_1000175 Ga0209257_100017596 336
547 3300025321 Ga0207656_10001116 Ga0207656_100011162 336
548 3300025711 Ga0207696_1001872 Ga0207696_10018722 336
549 3300025711 Ga0207696_1014646 Ga0207696_10146462 336
550 3300025728 Ga0207655_1000434 Ga0207655_100043448 336
551 3300025728 Ga0207655_1000972 Ga0207655_10009722 336
552 3300025728 Ga0207655_1001801 Ga0207655_10018014 336
553 3300025728 Ga0207655_1025232 Ga0207655_10252321 336
554 3300025728 Ga0207655_1027485 Ga0207655_10274851 336
555 3300025728 Ga0207655_1036326 Ga0207655_10363262 336
556 3300025728 Ga0207655_1038777 Ga0207655_10387772 336
557 3300025728 Ga0207655_1041165 Ga0207655_10411652 336
558 3300025728 Ga0207655_1041298 Ga0207655_10412982 336
559 3300025735 Ga0207713_1000299 Ga0207713_100029954 336
560 3300025735 Ga0207713_1010436 Ga0207713_10104362 336
561 3300025735 Ga0207713_1014958 Ga0207713_10149582 336
562 3300025735 Ga0207713_1019469 Ga0207713_10194692 336
563 3300025914 Ga0207671_10000018 Ga0207671_10000018287 336
564 3300025920 Ga0207649_10000008 Ga0207649_10000008276 336
565 3300025923 Ga0207681_10002297 Ga0207681_100022979 336
566 3300025923 Ga0207681_10038297 Ga0207681_100382972 336
567 3300025925 Ga0207650_10002243 Ga0207650_100022438 336
568 3300025925 Ga0207650_10004740 Ga0207650_100047402 336
569 3300025933 Ga0207706_10001633 Ga0207706_1000163310 336
570 3300025934 Ga0207686_10010975 Ga0207686_100109752 336
571 3300025935 Ga0207709_10000089 Ga0207709_1000008975 336
572 3300025935 Ga0207709_10097434 Ga0207709_100974342 336
573 3300025945 Ga0207679_10000008 Ga0207679_10000008113 336
574 3300027111 Ga0209281_1000018 Ga0209281_1000018170 336
575 3300027111 Ga0209281_1000391 Ga0209281_100039117 336
576 3300027111 Ga0209281_1002058 Ga0209281_10020586 336
577 3300027666 Ga0209282_1053271 Ga0209282_10532712 336
578 3300027907 Ga0207428_10017124 Ga0207428_100171242 336
579 3300027907 Ga0207428_10036996 Ga0207428_100369962 336
580 3300027907 Ga0207428_10048629 Ga0207428_100486292 336
581 3300027907 Ga0207428_10088086 Ga0207428_100880862 336
582 3300027907 Ga0207428_10141635 Ga0207428_101416352 336
583 3300028379 Ga0268266_10018069 Ga0268266_100180694 336
584 3300028379 Ga0268266_10409160 Ga0268266_104091602 336
585 3300030521 Ga0307511_10146258 Ga0307511_101462581 336
586 3300030735 Ga0316178_1087112 Ga0316178_10871122 336
587 3300031507 Ga0307509_10350081 Ga0307509_103500811 336
588 3300031548 Ga0307408_100032542 Ga0307408_1000325422 336
589 3300031548 Ga0307408_100168323 Ga0307408_1001683232 336
590 3300031548 Ga0307408_100210264 Ga0307408_1002102642 336
591 3300031548 Ga0307408_100277403 Ga0307408_1002774032 336
592 3300031731 Ga0307405_10005822 Ga0307405_100058224 336
593 3300031731 Ga0307405_10326306 Ga0307405_103263061 336
594 3300031731 Ga0307405_10338071 Ga0307405_103380711 336
595 3300031824 Ga0307413_10033819 Ga0307413_100338192 336
596 3300031911 Ga0307412_10043004 Ga0307412_100430043 336
597 3300032005 Ga0307411_10105635 Ga0307411_101056352 336
598 3300032005 Ga0307411_10216229 Ga0307411_102162292 336
599 3300032005 Ga0307411_10398097 Ga0307411_103980971 336
600 3300038705 Ga0237819_00787 Ga0237819_00787_1129_2139 336
601 3300041404 Ga0439436_0020880 Ga0439436_0020880_656_1684 336
602 3300041405 Ga0439438_003520 Ga0439438_003520_424_1434 336
603 3300041405 Ga0439438_003556 Ga0439438_003556_471_1481 336
604 3300041405 Ga0439438_006717 Ga0439438_006717_555_1565 336
605 3300041405 Ga0439438_023509 Ga0439438_023509_482_1492 336
606 3300041405 Ga0439438_044922 Ga0439438_044922_86_1096 336
607 3300041405 Ga0439438_044925 Ga0439438_044925_42_1052 336
608 3300041407 Ga0439447_002687 Ga0439447_002687_4854_5864 336
609 3300041407 Ga0439447_006607 Ga0439447_006607_2297_3307 336
610 3300041407 Ga0439447_010193 Ga0439447_010193_710_1738 336
611 3300041407 Ga0439447_029983 Ga0439447_029983_101_1111 336
612 3300041411 Ga0439466_0002047 Ga0439466_0002047_5921_6931 336
613 3300041411 Ga0439466_0003072 Ga0439466_0003072_4942_5952 336
614 3300041411 Ga0439466_0003320 Ga0439466_0003320_384_1394 336
615 3300041411 Ga0439466_0005230 Ga0439466_0005230_3569_4579 336
616 3300041411 Ga0439466_0016551 Ga0439466_0016551_206_1234 336
617 3300041411 Ga0439466_0019313 Ga0439466_0019313_545_1555 336
618 3300041411 Ga0439466_0022042 Ga0439466_0022042_545_1555 336
619 3300041411 Ga0439466_0036490 Ga0439466_0036490_406_1416 336
620 3300042006 Ga0439432_002614 Ga0439432_002614_4647_5657 336
621 3300042006 Ga0439432_024769 Ga0439432_024769_544_1554 336
622 3300042006 Ga0439432_028123 Ga0439432_028123_517_1527 336
623 3300042006 Ga0439432_031194 Ga0439432_031194_477_1487 336
624 3300042006 Ga0439432_032284 Ga0439432_032284_86_1096 336
625 3300042006 Ga0439432_035906 Ga0439432_035906_86_1096 336
626 3300042009 Ga0439451_004081 Ga0439451_004081_1895_2905 336
627 3300042009 Ga0439451_009331 Ga0439451_009331_417_1427 336
628 3300042009 Ga0439451_013552 Ga0439451_013552_168_1178 336
629 3300042010 Ga0439452_001971 Ga0439452_001971_1836_2846 336
630 3300042010 Ga0439452_002234 Ga0439452_002234_587_1597 336
631 3300042010 Ga0439452_002717 Ga0439452_002717_5011_6021 336
632 3300042010 Ga0439452_004105 Ga0439452_004105_411_1439 336
633 3300042010 Ga0439452_021368 Ga0439452_021368_555_1565 336
634 3300042013 Ga0439456_000724 Ga0439456_000724_5196_6206 336
635 3300042013 Ga0439456_028210 Ga0439456_028210_85_1095 336
636 3300042016 Ga0439463_018850 Ga0439463_018850_215_1225 336
637 3300042115 Ga0450911_000989 Ga0450911_000989_5856_6866 336
638 3300042115 Ga0450911_004391 Ga0450911_004391_778_1788 336
639 3300042122 Ga0450920_000323 Ga0450920_000323_5197_6207 336
640 3300042124 Ga0450922_000233 Ga0450922_000233_138_1148 336
641 3300042136 Ga0450900_004893 Ga0450900_004893_512_1522 336
642 3300042137 Ga0450902_004873 Ga0450902_004873_505_1515 336
643 3300042137 Ga0450902_011205 Ga0450902_011205_273_1283 336
644 3300042138 Ga0450903_007661 Ga0450903_007661_468_1478 336
645 3300042138 Ga0450903_008463 Ga0450903_008463_509_1519 336
646 3300042138 Ga0450903_008565 Ga0450903_008565_352_1362 336
647 3300042142 Ga0450905_009588 Ga0450905_009588_287_1297 336
648 3300042145 Ga0450906_001792 Ga0450906_001792_3546_4556 336
649 3300042145 Ga0450906_002154 Ga0450906_002154_457_1467 336
650 3300042145 Ga0450906_011162 Ga0450906_011162_400_1410 336
651 3300042146 Ga0450907_002371 Ga0450907_002371_423_1433 336
652 3300042146 Ga0450907_007775 Ga0450907_007775_212_1222 336
653 3300042156 Ga0439446_0036822 Ga0439446_0036822_315_1343 336
654 3300042185 Ga0450909_003369 Ga0450909_003369_492_1502 336
655 3300042435 Ga0439434_0001684 Ga0439434_0001684_4958_5968 336
656 3300042461 Ga0439460_0007945 Ga0439460_0007945_155_1165 336
657 3300042461 Ga0439460_0013457 Ga0439460_0013457_523_1533 336
658 3300042461 Ga0439460_0025082 Ga0439460_0025082_342_1352 336
659 3300042533 Ga0450901_005614 Ga0450901_005614_251_1261 336
660 3300042993 Ga0439440_0013194 Ga0439440_0013194_526_1536 336
661 3300042993 Ga0439440_0014683 Ga0439440_0014683_413_1423 336
662 3300046452 Ga0495617_001724 Ga0495617_001724_7778_8788 336
663 3300046452 Ga0495617_004628 Ga0495617_004628_494_1504 336
664 3300046452 Ga0495617_029422 Ga0495617_029422_607_1617 336
665 3300046452 Ga0495617_042260 Ga0495617_042260_331_1341 336
666 3300046452 Ga0495617_045241 Ga0495617_045241_279_1289 336
667 3300046452 Ga0495617_058550 Ga0495617_058550_237_1247 336
668 3300046453 Ga0495627_000423 Ga0495627_000423_12918_13928 336
669 3300046453 Ga0495627_002133 Ga0495627_002133_753_1763 336
670 3300046453 Ga0495627_015523 Ga0495627_015523_1413_2423 336
671 3300046453 Ga0495627_018704 Ga0495627_018704_454_1464 336
672 3300046453 Ga0495627_022260 Ga0495627_022260_142_1152 336
673 3300046453 Ga0495627_041647 Ga0495627_041647_265_1275 336
674 3300046455 Ga0495603_0061569 Ga0495603_0061569_589_1599 336
675 3300046457 Ga0495590_0001676 Ga0495590_0001676_572_1582 336
676 3300046457 Ga0495590_0003517 Ga0495590_0003517_4873_5883 336
677 3300046457 Ga0495590_0030223 Ga0495590_0030223_282_1292 336
678 3300046457 Ga0495590_0041994 Ga0495590_0041994_203_1213 336
679 3300046457 Ga0495590_0045216 Ga0495590_0045216_376_1386 336
680 3300046458 Ga0495591_000822 Ga0495591_000822_8748_9758 336
681 3300046458 Ga0495591_004666 Ga0495591_004666_4870_5880 336
682 3300046458 Ga0495591_005344 Ga0495591_005344_51_1061 336
683 3300046458 Ga0495591_007846 Ga0495591_007846_3037_4047 336
684 3300046458 Ga0495591_010629 Ga0495591_010629_1855_2865 336
685 3300046458 Ga0495591_028972 Ga0495591_028972_149_1159 336
686 3300046458 Ga0495591_038371 Ga0495591_038371_268_1278 336
687 3300046458 Ga0495591_038867 Ga0495591_038867_112_1122 336
688 3300046459 Ga0495629_0068187 Ga0495629_0068187_522_1532 336
689 3300046460 Ga0495638_0005430 Ga0495638_0005430_3596_4606 336
690 3300046460 Ga0495638_0005848 Ga0495638_0005848_54_1064 336
691 3300046460 Ga0495638_0010061 Ga0495638_0010061_5065_6075 336
692 3300046460 Ga0495638_0018580 Ga0495638_0018580_217_1227 336
693 3300046460 Ga0495638_0019444 Ga0495638_0019444_318_1328 336
694 3300046460 Ga0495638_0048358 Ga0495638_0048358_869_1879 336
695 3300046460 Ga0495638_0057118 Ga0495638_0057118_999_2009 336
696 3300046460 Ga0495638_0097232 Ga0495638_0097232_503_1513 336
697 3300046463 Ga0495653_0015817 Ga0495653_0015817_524_1534 336
698 3300046463 Ga0495653_0086183 Ga0495653_0086183_791_1801 336
699 3300046463 Ga0495653_0090701 Ga0495653_0090701_540_1550 336
700 3300046463 Ga0495653_0128863 Ga0495653_0128863_195_1205 336
701 3300046471 Ga0495650_0005972 Ga0495650_0005972_561_1571 336
702 3300046471 Ga0495650_0011996 Ga0495650_0011996_3114_4124 336
703 3300046471 Ga0495650_0028924 Ga0495650_0028924_302_1312 336
704 3300046471 Ga0495650_0053647 Ga0495650_0053647_583_1593 336
705 3300046471 Ga0495650_0070991 Ga0495650_0070991_66_1076 336
706 3300046473 Ga0495582_0011028 Ga0495582_0011028_3741_4751 336
707 3300046474 Ga0495605_0000903 Ga0495605_0000903_10981_11991 336
708 3300046474 Ga0495605_0006937 Ga0495605_0006937_4841_5851 336
709 3300046474 Ga0495605_0010769 Ga0495605_0010769_824_1834 336
710 3300046474 Ga0495605_0024099 Ga0495605_0024099_197_1207 336
711 3300046474 Ga0495605_0038058 Ga0495605_0038058_826_1836 336
712 3300046474 Ga0495605_0049954 Ga0495605_0049954_582_1592 336
713 3300046474 Ga0495605_0075133 Ga0495605_0075133_464_1474 336
714 3300046474 Ga0495605_0117966 Ga0495605_0117966_176_1186 336
715 3300046475 Ga0495639_0003160 Ga0495639_0003160_432_1442 336
716 3300046475 Ga0495639_0063909 Ga0495639_0063909_483_1493 336
717 3300046491 Ga0495584_0002893 Ga0495584_0002893_423_1433 336
718 3300046491 Ga0495584_0005772 Ga0495584_0005772_412_1422 336
719 3300046491 Ga0495584_0009399 Ga0495584_0009399_3627_4637 336
720 3300046491 Ga0495584_0014317 Ga0495584_0014317_167_1177 336
721 3300046491 Ga0495584_0020834 Ga0495584_0020834_1746_2756 336
722 3300046491 Ga0495584_0065445 Ga0495584_0065445_432_1538 336
723 3300046491 Ga0495584_0067250 Ga0495584_0067250_735_1745 336
724 3300046491 Ga0495584_0090224 Ga0495584_0090224_438_1448 336
725 3300046491 Ga0495584_0114151 Ga0495584_0114151_241_1251 336
726 3300046492 Ga0495585_0005462 Ga0495585_0005462_1169_2179 336
727 3300046492 Ga0495585_0104055 Ga0495585_0104055_10_1020 336
728 3300046492 Ga0495585_0122837 Ga0495585_0122837_156_1166 336
729 3300046499 Ga0495594_0141212 Ga0495594_0141212_246_1256 336
730 3300046500 Ga0495596_0002729 Ga0495596_0002729_8072_9082 336
731 3300046501 Ga0495607_0000869 Ga0495607_0000869_11951_12961 336
732 3300046501 Ga0495607_0001549 Ga0495607_0001549_13969_14979 336
733 3300046501 Ga0495607_0005710 Ga0495607_0005710_564_1574 336
734 3300046501 Ga0495607_0012035 Ga0495607_0012035_563_1573 336
735 3300046501 Ga0495607_0039152 Ga0495607_0039152_546_1556 336
736 3300046501 Ga0495607_0044219 Ga0495607_0044219_968_1978 336
737 3300046501 Ga0495607_0047200 Ga0495607_0047200_287_1297 336
738 3300046501 Ga0495607_0052897 Ga0495607_0052897_1196_2206 336
739 3300046501 Ga0495607_0080678 Ga0495607_0080678_178_1188 336
740 3300046501 Ga0495607_0087870 Ga0495607_0087870_164_1174 336
741 3300046501 Ga0495607_0116347 Ga0495607_0116347_263_1273 336
742 3300046501 Ga0495607_0125150 Ga0495607_0125150_205_1215 336
743 3300046501 Ga0495607_0168164 Ga0495607_0168164_78_1088 336
744 3300046506 Ga0495583_0004447 Ga0495583_0004447_6938_7948 336
745 3300046506 Ga0495583_0007969 Ga0495583_0007969_489_1499 336
746 3300046506 Ga0495583_0008745 Ga0495583_0008745_4724_5734 336
747 3300046506 Ga0495583_0075473 Ga0495583_0075473_382_1392 336
748 3300046507 Ga0495606_0013204 Ga0495606_0013204_665_1675 336
749 3300046507 Ga0495606_0021286 Ga0495606_0021286_506_1516 336
750 3300046507 Ga0495606_0024326 Ga0495606_0024326_2757_3767 336
751 3300046507 Ga0495606_0119885 Ga0495606_0119885_26_1036 336
752 3300046507 Ga0495606_0120810 Ga0495606_0120810_534_1544 336
753 3300046507 Ga0495606_0122553 Ga0495606_0122553_485_1495 336
754 3300046512 Ga0495610_0009426 Ga0495610_0009426_293_1303 336
755 3300046512 Ga0495610_0009546 Ga0495610_0009546_380_1390 336
756 3300046512 Ga0495610_0011113 Ga0495610_0011113_573_1583 336
757 3300046512 Ga0495610_0037183 Ga0495610_0037183_435_1445 336
758 3300046512 Ga0495610_0045652 Ga0495610_0045652_415_1425 336
759 3300046512 Ga0495610_0055655 Ga0495610_0055655_282_1292 336
760 3300046512 Ga0495610_0057052 Ga0495610_0057052_46_1056 336
761 3300046512 Ga0495610_0059293 Ga0495610_0059293_536_1546 336
762 3300046512 Ga0495610_0070255 Ga0495610_0070255_269_1279 336
763 3300046512 Ga0495610_0087206 Ga0495610_0087206_237_1247 336
764 3300046513 Ga0495616_0006310 Ga0495616_0006310_522_1532 336
765 3300046513 Ga0495616_0049434 Ga0495616_0049434_844_1854 336
766 3300046513 Ga0495616_0049887 Ga0495616_0049887_835_1845 336
767 3300046513 Ga0495616_0061425 Ga0495616_0061425_618_1628 336
768 3300046515 Ga0495620_0010881 Ga0495620_0010881_3240_4250 336
769 3300046515 Ga0495620_0015204 Ga0495620_0015204_2487_3497 336
770 3300046515 Ga0495620_0018753 Ga0495620_0018753_283_1293 336
771 3300046515 Ga0495620_0032485 Ga0495620_0032485_940_1950 336
772 3300046515 Ga0495620_0051232 Ga0495620_0051232_491_1501 336
773 3300046515 Ga0495620_0064370 Ga0495620_0064370_325_1335 336
774 3300046517 Ga0495630_0024127 Ga0495630_0024127_2902_3912 336
775 3300046517 Ga0495630_0269642 Ga0495630_0269642_250_1260 336
776 3300046518 Ga0495631_0002466 Ga0495631_0002466_8834_9844 336
777 3300046518 Ga0495631_0004944 Ga0495631_0004944_589_1599 336
778 3300046518 Ga0495631_0025617 Ga0495631_0025617_356_1366 336
779 3300046518 Ga0495631_0040347 Ga0495631_0040347_542_1552 336
780 3300046518 Ga0495631_0053722 Ga0495631_0053722_550_1560 336
781 3300046519 Ga0495632_0012246 Ga0495632_0012246_560_1570 336
782 3300046519 Ga0495632_0013231 Ga0495632_0013231_3001_4011 336
783 3300046519 Ga0495632_0015762 Ga0495632_0015762_287_1297 336
784 3300046519 Ga0495632_0020156 Ga0495632_0020156_1491_2501 336
785 3300046519 Ga0495632_0036607 Ga0495632_0036607_408_1418 336
786 3300046519 Ga0495632_0037199 Ga0495632_0037199_1424_2434 336
787 3300046519 Ga0495632_0046625 Ga0495632_0046625_926_1936 336
788 3300046519 Ga0495632_0050615 Ga0495632_0050615_582_1592 336
789 3300046519 Ga0495632_0106254 Ga0495632_0106254_71_1081 336
790 3300046519 Ga0495632_0113206 Ga0495632_0113206_25_1035 336
791 3300046520 Ga0495637_0002741 Ga0495637_0002741_8070_9080 336
792 3300046520 Ga0495637_0003263 Ga0495637_0003263_5153_6163 336
793 3300046520 Ga0495637_0005290 Ga0495637_0005290_4968_5978 336
794 3300046520 Ga0495637_0006328 Ga0495637_0006328_4870_5880 336
795 3300046520 Ga0495637_0012337 Ga0495637_0012337_2934_3944 336
796 3300046520 Ga0495637_0023908 Ga0495637_0023908_364_1374 336
797 3300046520 Ga0495637_0024815 Ga0495637_0024815_477_1487 336
798 3300046520 Ga0495637_0033820 Ga0495637_0033820_235_1245 336
799 3300046520 Ga0495637_0057538 Ga0495637_0057538_344_1354 336
800 3300046520 Ga0495637_0060365 Ga0495637_0060365_196_1206 336
801 3300046520 Ga0495637_0065269 Ga0495637_0065269_228_1238 336
802 3300046520 Ga0495637_0076639 Ga0495637_0076639_180_1190 336
803 3300046522 Ga0495643_0039177 Ga0495643_0039177_1003_2013 336
804 3300046523 Ga0495644_0002733 Ga0495644_0002733_1149_2159 336
805 3300046523 Ga0495644_0038306 Ga0495644_0038306_523_1533 336
806 3300046523 Ga0495644_0066537 Ga0495644_0066537_104_1114 336
807 3300046523 Ga0495644_0073859 Ga0495644_0073859_22_1032 336
808 3300046524 Ga0495648_0009694 Ga0495648_0009694_5731_6741 336
809 3300046524 Ga0495648_0009969 Ga0495648_0009969_5106_6116 336
810 3300046524 Ga0495648_0012209 Ga0495648_0012209_4850_5860 336
811 3300046524 Ga0495648_0014500 Ga0495648_0014500_4257_5267 336
812 3300046524 Ga0495648_0020195 Ga0495648_0020195_2991_4001 336
813 3300046524 Ga0495648_0029376 Ga0495648_0029376_816_1826 336
814 3300046524 Ga0495648_0094378 Ga0495648_0094378_561_1571 336
815 3300046524 Ga0495648_0102480 Ga0495648_0102480_38_1048 336
816 3300046524 Ga0495648_0126557 Ga0495648_0126557_282_1292 336
817 3300046524 Ga0495648_0136205 Ga0495648_0136205_14_1024 336
818 3300046526 Ga0495666_0065511 Ga0495666_0065511_202_1212 336
819 3300046526 Ga0495666_0071680 Ga0495666_0071680_537_1547 336
820 3300046526 Ga0495666_0071910 Ga0495666_0071910_531_1541 336
821 3300046528 Ga0495642_0001528 Ga0495642_0001528_1254_2264 336
822 3300046528 Ga0495642_0005239 Ga0495642_0005239_3404_4414 336
823 3300046528 Ga0495642_0005299 Ga0495642_0005299_626_1636 336
824 3300046530 Ga0495654_0003407 Ga0495654_0003407_7847_8857 336
825 3300046530 Ga0495654_0003646 Ga0495654_0003646_466_1476 336
826 3300046530 Ga0495654_0006655 Ga0495654_0006655_643_1653 336
827 3300046530 Ga0495654_0006951 Ga0495654_0006951_4843_5853 336
828 3300046530 Ga0495654_0007007 Ga0495654_0007007_4979_5989 336
829 3300046530 Ga0495654_0007541 Ga0495654_0007541_4761_5771 336
830 3300046530 Ga0495654_0011143 Ga0495654_0011143_529_1539 336
831 3300046530 Ga0495654_0017168 Ga0495654_0017168_1863_2873 336
832 3300046530 Ga0495654_0023656 Ga0495654_0023656_343_1353 336
833 3300046530 Ga0495654_0030072 Ga0495654_0030072_1111_2217 336
834 3300046530 Ga0495654_0031304 Ga0495654_0031304_1151_2161 336
835 3300046530 Ga0495654_0037907 Ga0495654_0037907_995_2005 336
836 3300046530 Ga0495654_0066012 Ga0495654_0066012_514_1524 336
837 3300046530 Ga0495654_0075480 Ga0495654_0075480_406_1416 336
838 3300046535 Ga0495586_0064336 Ga0495586_0064336_26_1036 336
839 3300046536 Ga0495587_0054967 Ga0495587_0054967_560_1570 336
840 3300046538 Ga0495609_0009175 Ga0495609_0009175_573_1583 336
841 3300046538 Ga0495609_0057953 Ga0495609_0057953_445_1455 336
842 3300046542 Ga0495597_0012109 Ga0495597_0012109_1960_2970 336
843 3300046542 Ga0495597_0013605 Ga0495597_0013605_161_1171 336
844 3300046542 Ga0495597_0014265 Ga0495597_0014265_2333_3343 336
845 3300046542 Ga0495597_0031972 Ga0495597_0031972_1130_2140 336
846 3300046542 Ga0495597_0092758 Ga0495597_0092758_239_1249 336
847 3300046542 Ga0495597_0102937 Ga0495597_0102937_73_1179 336
848 3300046543 Ga0495645_0064600 Ga0495645_0064600_1292_2302 336
849 3300046557 Ga0495622_0000853 Ga0495622_0000853_7684_8694 336
850 3300046557 Ga0495622_0004796 Ga0495622_0004796_4835_5845 336
851 3300046557 Ga0495622_0021031 Ga0495622_0021031_423_1433 336
852 3300046557 Ga0495622_0057181 Ga0495622_0057181_240_1250 336
853 3300046557 Ga0495622_0071880 Ga0495622_0071880_324_1334 336
854 3300046557 Ga0495622_0091676 Ga0495622_0091676_108_1118 336
855 3300046558 Ga0495633_0008482 Ga0495633_0008482_509_1519 336
856 3300046558 Ga0495633_0030817 Ga0495633_0030817_1294_2304 336
857 3300046616 Ga0495668_0007362 Ga0495668_0007362_4887_5897 336
858 3300046642 Ga0495634_0005385 Ga0495634_0005385_8453_9463 336
859 3300046660 Ga0495625_0007564 Ga0495625_0007564_560_1570 336
860 3300046660 Ga0495625_0025133 Ga0495625_0025133_246_1256 336
861 3300046660 Ga0495625_0090428 Ga0495625_0090428_868_1878 336
862 3300046660 Ga0495625_0136668 Ga0495625_0136668_242_1252 336
863 3300046660 Ga0495625_0182755 Ga0495625_0182755_49_1059 336
864 3300046660 Ga0495625_0206178 Ga0495625_0206178_156_1166 336
865 3300046663 Ga0495635_0040495 Ga0495635_0040495_1882_2892 336
866 3300046664 Ga0495659_0001232 Ga0495659_0001232_237_1247 336
867 3300046664 Ga0495659_0003330 Ga0495659_0003330_418_1428 336
868 3300046664 Ga0495659_0034077 Ga0495659_0034077_144_1154 336
869 3300046665 Ga0495661_0008587 Ga0495661_0008587_4672_5682 336
870 3300046665 Ga0495661_0013929 Ga0495661_0013929_3536_4546 336
871 3300046665 Ga0495661_0080628 Ga0495661_0080628_21_1031 336
872 3300046665 Ga0495661_0115717 Ga0495661_0115717_228_1238 336
873 3300046674 Ga0495588_0013670 Ga0495588_0013670_299_1309 336
874 3300046674 Ga0495588_0107683 Ga0495588_0107683_394_1404 336
875 3300046674 Ga0495588_0109244 Ga0495588_0109244_191_1201 336
876 3300046675 Ga0495657_0054525 Ga0495657_0054525_610_1620 336
877 3300046679 Ga0495623_0007248 Ga0495623_0007248_5801_6811 336
878 3300046679 Ga0495623_0134893 Ga0495623_0134893_195_1205 336
879 3300046680 Ga0495646_0014970 Ga0495646_0014970_573_1583 336
880 3300046680 Ga0495646_0019790 Ga0495646_0019790_3222_4232 336
881 3300046684 Ga0495669_0030582 Ga0495669_0030582_727_1737 336
882 3300046689 Ga0495613_0020114 Ga0495613_0020114_579_1589 336
883 3300046689 Ga0495613_0150417 Ga0495613_0150417_138_1148 336
884 3300046690 Ga0495624_0100430 Ga0495624_0100430_585_1595 336
885 3300046691 Ga0495670_0005284 Ga0495670_0005284_542_1552 336
886 3300046691 Ga0495670_0027015 Ga0495670_0027015_661_1671 336
887 3300046691 Ga0495670_0033496 Ga0495670_0033496_316_1326 336
888 3300046691 Ga0495670_0126809 Ga0495670_0126809_236_1246 336
889 3300046691 Ga0495670_0132343 Ga0495670_0132343_221_1231 336
890 3300046692 Ga0495671_0006050 Ga0495671_0006050_4880_5890 336
891 3300046692 Ga0495671_0006650 Ga0495671_0006650_5108_6118 336
892 3300046692 Ga0495671_0006995 Ga0495671_0006995_4878_5888 336
893 3300046692 Ga0495671_0013093 Ga0495671_0013093_2976_3986 336
894 3300046692 Ga0495671_0020305 Ga0495671_0020305_360_1370 336
895 3300046692 Ga0495671_0027399 Ga0495671_0027399_1208_2218 336
896 3300046692 Ga0495671_0067046 Ga0495671_0067046_260_1270 336
897 3300046692 Ga0495671_0075065 Ga0495671_0075065_536_1546 336
898 3300046692 Ga0495671_0121613 Ga0495671_0121613_123_1229 336
899 3300046694 Ga0495649_0007817 Ga0495649_0007817_580_1590 336
900 3300046694 Ga0495649_0007878 Ga0495649_0007878_4864_5874 336
901 3300046694 Ga0495649_0011400 Ga0495649_0011400_3158_4168 336
902 3300046694 Ga0495649_0016250 Ga0495649_0016250_3049_4059 336
903 3300046694 Ga0495649_0020620 Ga0495649_0020620_71_1081 336
904 3300046694 Ga0495649_0063981 Ga0495649_0063981_243_1253 336
905 3300046694 Ga0495649_0070843 Ga0495649_0070843_607_1617 336
906 3300046694 Ga0495649_0079830 Ga0495649_0079830_485_1495 336
907 3300046694 Ga0495649_0104495 Ga0495649_0104495_115_1125 336
908 3300046794 Ga0495589_0002775 Ga0495589_0002775_577_1587 336
909 3300046794 Ga0495589_0009137 Ga0495589_0009137_3655_4665 336
910 3300046794 Ga0495589_0009752 Ga0495589_0009752_490_1500 336
911 3300046794 Ga0495589_0020860 Ga0495589_0020860_658_1668 336
912 3300046794 Ga0495589_0071184 Ga0495589_0071184_265_1275 336
913 3300046794 Ga0495589_0108816 Ga0495589_0108816_185_1195 336
914 3300046794 Ga0495589_0114953 Ga0495589_0114953_249_1259 336
915 3300046810 Ga0495660_0012183 Ga0495660_0012183_1278_2288 336
916 3300046810 Ga0495660_0045614 Ga0495660_0045614_1145_2155 336
917 3300046810 Ga0495660_0046409 Ga0495660_0046409_1216_2226 336
918 3300046810 Ga0495660_0074849 Ga0495660_0074849_538_1548 336
919 3300046810 Ga0495660_0079382 Ga0495660_0079382_246_1256 336
920 3300046810 Ga0495660_0109969 Ga0495660_0109969_379_1389 336
921 3300046810 Ga0495660_0136139 Ga0495660_0136139_101_1111 336
922 3300047317 Ga0495604_0008431 Ga0495604_0008431_551_1561 336
923 3300047317 Ga0495604_0032318 Ga0495604_0032318_132_1142 336
924 3300047317 Ga0495604_0150745 Ga0495604_0150745_519_1529 336
925 3300047317 Ga0495604_0240064 Ga0495604_0240064_179_1189 336
926 3300047318 Ga0495636_0012407 Ga0495636_0012407_571_1581 336
927 3300047320 Ga0495672_0010252 Ga0495672_0010252_746_1756 336
928 3300047320 Ga0495672_0014602 Ga0495672_0014602_3214_4320 336
929 3300047320 Ga0495672_0015264 Ga0495672_0015264_628_1638 336
930 3300047320 Ga0495672_0021286 Ga0495672_0021286_72_1082 336
931 3300047320 Ga0495672_0032112 Ga0495672_0032112_655_1665 336
932 3300047320 Ga0495672_0056206 Ga0495672_0056206_208_1218 336
933 3300047320 Ga0495672_0078044 Ga0495672_0078044_591_1601 336
934 3300047320 Ga0495672_0091413 Ga0495672_0091413_159_1169 336
935 3300047320 Ga0495672_0120048 Ga0495672_0120048_164_1174 336
936 3300047320 Ga0495672_0140043 Ga0495672_0140043_20_1030 336
937 3300047322 Ga0495680_0018118 Ga0495680_0018118_3742_4752 336
938 3300047322 Ga0495680_0100413 Ga0495680_0100413_170_1180 336
939 3300047323 Ga0495683_0003047 Ga0495683_0003047_708_1718 336
940 3300047323 Ga0495683_0025899 Ga0495683_0025899_821_1831 336
941 3300047323 Ga0495683_0040230 Ga0495683_0040230_17_1027 336
942 3300047323 Ga0495683_0045261 Ga0495683_0045261_286_1296 336
943 3300047323 Ga0495683_0074262 Ga0495683_0074262_639_1649 336
944 3300047323 Ga0495683_0075746 Ga0495683_0075746_398_1408 336
945 3300047323 Ga0495683_0113688 Ga0495683_0113688_145_1155 336
946 3300047443 Ga0495687_004396 Ga0495687_004396_492_1502 336
947 3300047443 Ga0495687_012633 Ga0495687_012633_420_1430 336
948 3300047443 Ga0495687_029964 Ga0495687_029964_285_1295 336
949 3300047445 Ga0495677_0005671 Ga0495677_0005671_3106_4116 336
950 3300047446 Ga0495679_007117 Ga0495679_007117_361_1371 336
951 3300047446 Ga0495679_031487 Ga0495679_031487_200_1210 336
952 3300047447 Ga0495685_066942 Ga0495685_066942_150_1160 336
953 3300047469 Ga0495673_0001495 Ga0495673_0001495_12272_13282 336
954 3300047469 Ga0495673_0003834 Ga0495673_0003834_462_1472 336
955 3300047469 Ga0495673_0004508 Ga0495673_0004508_820_1830 336
956 3300047469 Ga0495673_0006177 Ga0495673_0006177_550_1560 336
957 3300047469 Ga0495673_0007246 Ga0495673_0007246_570_1580 336
958 3300047469 Ga0495673_0011850 Ga0495673_0011850_387_1397 336
959 3300047469 Ga0495673_0014045 Ga0495673_0014045_3029_4039 336
960 3300047469 Ga0495673_0014292 Ga0495673_0014292_137_1147 336
961 3300047469 Ga0495673_0051462 Ga0495673_0051462_344_1354 336
962 3300047469 Ga0495673_0059813 Ga0495673_0059813_450_1460 336
963 3300047470 Ga0495681_0007254 Ga0495681_0007254_491_1501 336
964 3300047470 Ga0495681_0007399 Ga0495681_0007399_1138_2148 336
965 3300047470 Ga0495681_0008428 Ga0495681_0008428_4815_5825 336
966 3300047470 Ga0495681_0009708 Ga0495681_0009708_4856_5866 336
967 3300047470 Ga0495681_0010583 Ga0495681_0010583_3929_4939 336
968 3300047470 Ga0495681_0024197 Ga0495681_0024197_1341_2351 336
969 3300047470 Ga0495681_0031033 Ga0495681_0031033_1529_2539 336
970 3300047470 Ga0495681_0048603 Ga0495681_0048603_753_1763 336
971 3300047470 Ga0495681_0049170 Ga0495681_0049170_618_1628 336
972 3300047470 Ga0495681_0063619 Ga0495681_0063619_408_1418 336
973 3300047470 Ga0495681_0070803 Ga0495681_0070803_83_1093 336
974 3300047470 Ga0495681_0077408 Ga0495681_0077408_106_1116 336
975 3300047470 Ga0495681_0093330 Ga0495681_0093330_23_1033 336
976 3300047471 Ga0495684_0048621 Ga0495684_0048621_740_1750 336
977 3300047472 Ga0495686_0011491 Ga0495686_0011491_4937_5947 336
978 3300047472 Ga0495686_0118000 Ga0495686_0118000_448_1458 336
979 3300047673 Ga0495593_0016169 Ga0495593_0016169_175_1185 336
980 3300047673 Ga0495593_0072910 Ga0495593_0072910_185_1195 336
981 3300047673 Ga0495593_0077797 Ga0495593_0077797_548_1558 336
982 3300048088 Ga0495602_0155161 Ga0495602_0155161_584_1594 336
983 3300048091 Ga0495626_0003380 Ga0495626_0003380_8078_9088 336
984 3300048091 Ga0495626_0005884 Ga0495626_0005884_4876_5886 336
985 3300048091 Ga0495626_0006281 Ga0495626_0006281_5584_6594 336
986 3300048091 Ga0495626_0006409 Ga0495626_0006409_4878_5888 336
987 3300048091 Ga0495626_0006683 Ga0495626_0006683_630_1640 336
988 3300048091 Ga0495626_0045371 Ga0495626_0045371_796_1806 336
989 3300048091 Ga0495626_0067379 Ga0495626_0067379_190_1200 336
990 3300048905 Ga0496102_0006510 Ga0496102_0006510_8468_9478 336
991 3300048909 Ga0496106_0292765 Ga0496106_0292765_170_1180 336
992 3300048913 Ga0496110_0085009 Ga0496110_0085009_1719_2729 336
993 3300048913 Ga0496110_0262335 Ga0496110_0262335_370_1380 336
994 3300048913 Ga0496110_0338370 Ga0496110_0338370_263_1273 336
995 3300048915 Ga0496112_0094542 Ga0496112_0094542_1893_2903 336
996 3300048919 Ga0496116_0015011 Ga0496116_0015011_305_1315 336
997 3300048920 Ga0496117_0016210 Ga0496117_0016210_4740_5750 336
998 3300048920 Ga0496117_0050588 Ga0496117_0050588_1515_2525 336
999 3300048920 Ga0496117_0128213 Ga0496117_0128213_24_1034 336
1000 3300048921 Ga0496118_0038509 Ga0496118_0038509_2793_3803 336
1001 3300048921 Ga0496118_0041108 Ga0496118_0041108_439_1449 336
1002 3300048921 Ga0496118_0091756 Ga0496118_0091756_504_1514 336
1003 3300048921 Ga0496118_0131595 Ga0496118_0131595_85_1095 336
1004 3300048921 Ga0496118_0164863 Ga0496118_0164863_95_1105 336
1005 3300048921 Ga0496118_0165040 Ga0496118_0165040_258_1268 336
1006 3300048922 Ga0496119_0101893 Ga0496119_0101893_119_1129 336
1007 3300048922 Ga0496119_0119559 Ga0496119_0119559_426_1436 336
1008 3300048923 Ga0496120_0026440 Ga0496120_0026440_503_1513 336
1009 3300048923 Ga0496120_0089472 Ga0496120_0089472_482_1492 336
1010 3300048924 Ga0496121_0055715 Ga0496121_0055715_414_1424 336
1011 3300048924 Ga0496121_0183679 Ga0496121_0183679_45_1055 336
1012 3300048924 Ga0496121_0224722 Ga0496121_0224722_78_1088 336
1013 3300048925 Ga0496122_0019422 Ga0496122_0019422_4844_5854 336
1014 3300048925 Ga0496122_0028672 Ga0496122_0028672_486_1496 336
1015 3300048925 Ga0496122_0113805 Ga0496122_0113805_234_1244 336
1016 3300048925 Ga0496122_0223678 Ga0496122_0223678_15_1025 336
1017 3300048926 Ga0496123_0050022 Ga0496123_0050022_1405_2415 336
1018 3300048926 Ga0496123_0098744 Ga0496123_0098744_502_1512 336
1019 3300048927 Ga0496124_0019636 Ga0496124_0019636_572_1582 336
1020 3300048927 Ga0496124_0029500 Ga0496124_0029500_948_1958 336
1021 3300048927 Ga0496124_0073159 Ga0496124_0073159_1045_2055 336
1022 3300048927 Ga0496124_0180725 Ga0496124_0180725_280_1290 336
1023 3300048927 Ga0496124_0319419 Ga0496124_0319419_85_1095 336
1024 3300048928 Ga0496125_0020199 Ga0496125_0020199_4717_5727 336
1025 3300048928 Ga0496125_0021517 Ga0496125_0021517_4747_5757 336
1026 3300048928 Ga0496125_0026196 Ga0496125_0026196_538_1548 336
1027 3300048928 Ga0496125_0126058 Ga0496125_0126058_547_1557 336
1028 3300048928 Ga0496125_0152334 Ga0496125_0152334_497_1507 336
1029 3300048928 Ga0496125_0158973 Ga0496125_0158973_329_1357 336
1030 3300048928 Ga0496125_0170707 Ga0496125_0170707_170_1198 336
1031 3300048929 Ga0496126_0022913 Ga0496126_0022913_4633_5643 336
1032 3300048929 Ga0496126_0098318 Ga0496126_0098318_1261_2271 336
1033 3300048929 Ga0496126_0208875 Ga0496126_0208875_502_1512 336
1034 3300048929 Ga0496126_0227378 Ga0496126_0227378_204_1214 336
1035 3300049459 Ga0495678_003571 Ga0495678_003571_7896_8906 336
1036 3300049459 Ga0495678_006194 Ga0495678_006194_4984_5994 336
1037 3300049459 Ga0495678_006317 Ga0495678_006317_641_1651 336
1038 3300049459 Ga0495678_041162 Ga0495678_041162_339_1349 336
1039 3300049459 Ga0495678_046888 Ga0495678_046888_401_1411 336
1040 3300049459 Ga0495678_052247 Ga0495678_052247_272_1282 336
1041 3300049459 Ga0495678_062445 Ga0495678_062445_177_1187 336
1042 3300049460 Ga0495682_0034371 Ga0495682_0034371_258_1268 336
1043 3300049460 Ga0495682_0038797 Ga0495682_0038797_628_1638 336
1044 3300049460 Ga0495682_0045771 Ga0495682_0045771_575_1585 336
1045 3300049460 Ga0495682_0068366 Ga0495682_0068366_245_1255 336
1046 3300049569 Ga0501032_0016840 Ga0501032_0016840_576_1604 336
1047 3300049571 Ga0501034_0206785 Ga0501034_0206785_240_1268 336
1048 3300049573 Ga0501037_0034086 Ga0501037_0034086_532_1560 336
1049 3300049758 Ga0501241_000589 Ga0501241_000589_1340_2350 336
1050 3300050489 nmdc:mga03683_90883_c1 nmdc:mga03683_90883_c1_194_1204 336
1051 3300050491 nmdc:mga00v17_131060_c1 nmdc:mga00v17_131060_c1_319_1329 336
1052 3300053161 Ga0500634_0055203 Ga0500634_0055203_273_1283 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

184

362

0.98

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

50

164

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hjs-assembly1.cif.gz_A-2 the structure of a probable aspartate-semialdehyde dehydrogenase from pseudomonas aeruginosa 0.9796 3 336
2hjs-assembly1.cif.gz_A-2 the structure of a probable aspartate-semialdehyde dehydrogenase from pseudomonas aeruginosa 0.9768 3 336
2qz9-assembly2.cif.gz_B-2 crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae 0.9679 3 336
2qz9-assembly2.cif.gz_B-2 crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae 0.9623 3 336
2r00-assembly2.cif.gz_C-2 crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae 0.9587 2 336
ID Description Score Start End Superfamily
2hjsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9704 3 129 3.40.50.720
2hjsA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9649 132 314 3.30.360.10
2r00C02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9548 129 315 3.30.360.10
2hjsA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9546 132 314 3.30.360.10
af_P08390_5_140_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9524 6 137 3.40.50.720
ID Description Score Start End GO Terms
AF-S6UPA0-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 0.9998 1 91 GO:0004073
GO:0051287
AF-A0A850QRE1-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9984 1 74 GO:0016620
GO:0051287
AF-A0A7Y8B711-F1-model_v4 deleted 0.9947 50 336
AF-A0A3M4H714-F1-model_v4 deleted 0.9939 154 336
AF-U3MIP2-F1-model_v4 Aspartate semialdehyde dehydrogenase 0.993 1 123 GO:0016620
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.26 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map