F488052
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1007 | 808 | 398 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300048914|Ga0496111_0015511|Ga0496111_0015511_3804_4757 |
| Length | 317 |
| Sequence | MATITMMVPTAPVTVMTMDMITATITMAATMLLRRSRERGAAMLDDFFIRALVAGIGVALTAGPLGCFVVWRRMAYFGDTMAHSALLGVALSLFFEVNLLLSVFGVAVLVSGLLLLLQRRQSLSADALLGILSHSALAIGLVLVAFMTWVRIDLIAFLFGDILAVTPSDIALIWGGGALVVLAMVFLWRPLIASTVSEDVAEAEGMRPAQAKLFFMLLMALVIAIAMKIVGIMLITSLLIIPAATARRFSASPEWMAVFASLIGALAVIGGLFGSLTYDTPSGPSIVVAALLLFIMSLVPAFGRNSAERAANKGVRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 11 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 14 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 15 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 16 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 17 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 18 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 19 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 20 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 21 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 22 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 23 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 24 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 25 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 26 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 27 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 28 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 29 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 30 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 31 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 32 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 33 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 34 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 35 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 36 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 37 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 38 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 39 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 40 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 41 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 42 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 43 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 44 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 45 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 46 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 47 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 48 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 49 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 50 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 51 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 52 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 53 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 54 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 55 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 56 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 57 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 58 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 59 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 60 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 61 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 62 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 63 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 64 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 65 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 66 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 67 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 68 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 69 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 70 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 71 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 72 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 73 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 74 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 75 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 76 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 77 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 78 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 79 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 80 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 81 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 82 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 83 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 84 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 85 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 86 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 87 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 88 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 89 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 90 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 91 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 92 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 93 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 94 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 95 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 96 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 97 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 98 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 99 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 100 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 101 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 102 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 103 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 104 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 105 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 106 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 107 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 108 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 109 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 110 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 111 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 112 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 113 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 114 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 115 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 116 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 117 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 118 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 119 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 120 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 121 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 122 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 123 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 124 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 125 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 126 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 127 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 128 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 129 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 130 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 131 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 132 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 133 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 134 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 135 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 136 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 137 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 138 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 139 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 140 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 141 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 142 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 143 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 144 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 145 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 146 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 147 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 148 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 149 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 150 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 151 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 152 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 153 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 154 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 155 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 156 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 157 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 158 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 159 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 160 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 161 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 162 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 163 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 164 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 165 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 166 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 167 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 168 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 169 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 170 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 171 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 172 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 173 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 174 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 175 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 176 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 177 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 178 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 179 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 180 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 181 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 182 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 183 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 184 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 185 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 186 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 187 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 188 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 189 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 190 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 191 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 192 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 193 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 194 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 195 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 196 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 197 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 198 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 199 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 200 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 201 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 202 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 203 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 204 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 205 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 206 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 207 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 208 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 209 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 210 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 211 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 212 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 213 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 214 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 215 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 216 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 217 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 218 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 219 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 220 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 221 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 222 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 223 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 224 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 225 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 226 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 227 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 228 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 229 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 230 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 231 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 232 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 233 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 234 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 235 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 236 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 237 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 238 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 239 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 240 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 241 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 242 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 243 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 244 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 245 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 246 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 247 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 248 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 249 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 250 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 251 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 252 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 253 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 254 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 255 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 256 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 257 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 258 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 259 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 260 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 261 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 262 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 263 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 264 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 265 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 266 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 267 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 268 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 269 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 270 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 271 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 272 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 273 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 274 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 275 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 276 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 277 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 278 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 279 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 280 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 281 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 282 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 283 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 284 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 285 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 286 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 287 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 288 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 289 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 290 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 291 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 292 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 293 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 294 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 295 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 296 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 297 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 298 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 299 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 300 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 301 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 302 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 303 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 304 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 305 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 306 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 307 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 308 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 309 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 310 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 311 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 312 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 313 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 314 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 315 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 316 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 317 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 318 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 319 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 320 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 321 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 322 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 323 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 324 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 325 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 326 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 327 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 328 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 329 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 330 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 331 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 332 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 333 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 334 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 335 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 336 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 337 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 338 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 339 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 340 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 341 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 342 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 343 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 344 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 345 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 346 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 347 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 348 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 349 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 350 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 351 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 352 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 353 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 354 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 355 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 356 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 357 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 358 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 359 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 360 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 361 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 362 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 363 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 364 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 365 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 366 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 367 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 368 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 369 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 370 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 371 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 372 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 373 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 374 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 375 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 376 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 377 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 378 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 379 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 380 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 381 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 382 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 383 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 384 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 385 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 386 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 387 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 388 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 389 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 390 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 391 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 392 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 393 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 394 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 395 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 396 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 397 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 398 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 399 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 400 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 401 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 402 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 403 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 404 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 405 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 406 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 407 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 408 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 409 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 410 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 411 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 412 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 413 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 414 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 415 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 416 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 417 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 418 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 419 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 420 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 421 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 422 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 423 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 424 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 425 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 426 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 427 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 428 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 429 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 430 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 431 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 432 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 433 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 434 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 435 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 436 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 437 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 438 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 439 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 440 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 441 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 442 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 443 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 444 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 445 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 446 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 447 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 448 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 449 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 450 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 451 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 452 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 453 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 454 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 455 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 456 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 457 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 458 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 459 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 460 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 461 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 462 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 463 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 464 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 465 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 466 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 467 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 468 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 469 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 470 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 471 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 472 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 473 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 474 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 475 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 476 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 477 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 478 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 479 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 480 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 481 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 482 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 483 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 484 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 485 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 486 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 487 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 488 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 489 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 490 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 491 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 492 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 493 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 494 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 495 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 496 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 497 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 498 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 499 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 500 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 501 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 502 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 503 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 504 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 505 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 506 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 507 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 508 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 509 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 510 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 511 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 512 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 513 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 514 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 515 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 516 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 517 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 518 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 519 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 520 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 521 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 522 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 523 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 524 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 525 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 526 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 527 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 528 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 529 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 530 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 531 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 532 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 533 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 534 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 535 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 536 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 537 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 538 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 539 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 540 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 541 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 542 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 543 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 544 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 545 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 546 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 547 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 548 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 549 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 550 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 551 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 552 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 553 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 554 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 555 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 556 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 557 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 558 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 559 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 560 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 561 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 562 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 563 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 564 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 565 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 566 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 567 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 568 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 569 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 570 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 571 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 572 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 573 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 574 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 575 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 576 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 577 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 578 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 579 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 580 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 581 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 582 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 583 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 584 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 585 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 586 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 587 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 588 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 589 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 590 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 591 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 592 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 593 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 594 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 595 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 596 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 597 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 598 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 599 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 600 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 601 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 602 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 603 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 604 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 605 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 606 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 607 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 608 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 609 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 610 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 611 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 612 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 613 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 614 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 615 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 616 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 617 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 618 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 619 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 620 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 621 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 622 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 623 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 624 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 625 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 626 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 627 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 628 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 629 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 630 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 631 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 632 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 633 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 634 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 635 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 644 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 646 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 647 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 649 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 650 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 651 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 652 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 653 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 654 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 655 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 656 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 657 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 658 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 659 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 660 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 661 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 662 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 663 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 664 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 665 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 666 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 667 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 668 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 669 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 670 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 671 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 672 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 673 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 674 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 675 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 676 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 677 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 678 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 704 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 705 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 706 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 707 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 708 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 709 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 710 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 711 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 712 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 713 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 714 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 715 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 716 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 717 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 718 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 719 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 720 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 721 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 724 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 725 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 726 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 727 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 728 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 729 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 730 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 731 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 732 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 733 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 734 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 735 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 736 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 737 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 738 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 739 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 740 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 741 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 742 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 743 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 744 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 745 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 746 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 747 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 748 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 749 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 750 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 751 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 752 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 753 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 754 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 755 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 756 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 757 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 758 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 759 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 760 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 761 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 762 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 763 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 764 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 765 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 766 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 767 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 768 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 769 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 770 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 771 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 772 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 773 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 774 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 775 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 776 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 777 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 778 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 779 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 780 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 781 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 782 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 783 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 784 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 785 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 786 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 787 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 788 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 789 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 790 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 791 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 792 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 793 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 794 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 795 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 796 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 797 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 798 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 799 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 800 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 801 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 802 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 803 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 804 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 805 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 806 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 807 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 808 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 39.42 |
| Metatranscriptomes | 0.1 |
| Isolates | 60.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.7 |
| Bulb | 0.1 |
| Endosphere | 14.6 |
| Nodule | 42.9 |
| Rhizoplane | 1.99 |
| Rhizosphere | 19.66 |
| Stem | 0 |
| Stem Tuber | 0.4 |
| Unclassified | 19.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000001 | 3300002704 | Bacteria | 354543 |
| 2 | JGI25156J39149_1000001 | 3300002705 | Bacteria | 354557 |
| 3 | JGI25162J39368_1000209 | 3300002737 | Bacteria | 61889 |
| 4 | JGI25162J39368_1000245 | 3300002737 | Bacteria | 54142 |
| 5 | JGI25154J39366_1000011 | 3300002738 | Bacteria | 296007 |
| 6 | JGI25158J39367_1000764 | 3300002739 | Bacteria | 6158 |
| 7 | JGI25157J39369_1000030 | 3300002741 | Bacteria | 146112 |
| 8 | JGI25152J39213_1000570 | 3300002773 | Bacteria | 20104 |
| 9 | JGI25152J39213_1004071 | 3300002773 | Bacteria | 4746 |
| 10 | JGI25152J39213_1011917 | 3300002773 | Bacteria | 1897 |
| 11 | JGI25150J39212_1000326 | 3300002774 | Bacteria | 23479 |
| 12 | JGI25150J39212_1005593 | 3300002774 | Bacteria | 2668 |
| 13 | JGI25159J45721_1000078 | 3300002987 | Bacteria | 46708 |
| 14 | JGI25159J45721_1000199 | 3300002987 | Bacteria | 27917 |
| 15 | JGI25159J45721_1000530 | 3300002987 | Bacteria | 17359 |
| 16 | JGI25151J46595_10000083 | 3300003187 | Bacteria | 130658 |
| 17 | JGI25165J46597_1000302 | 3300003214 | Bacteria | 61889 |
| 18 | JGI25165J46597_1000682 | 3300003214 | Bacteria | 27253 |
| 19 | JGI25153J46596_10000377 | 3300003215 | Bacteria | 30499 |
| 20 | JGI25153J46596_10005215 | 3300003215 | Bacteria | 6840 |
| 21 | JGI25153J46596_10008879 | 3300003215 | Bacteria | 4746 |
| 22 | rootH2_10150379 | 3300003320 | Bacteria | 1788 |
| 23 | JGI25160J50197_1000087 | 3300003354 | Bacteria | 93379 |
| 24 | JGI25160J50197_1000216 | 3300003354 | Bacteria | 46708 |
| 25 | JGI25161J50226_1000066 | 3300003374 | Bacteria | 94505 |
| 26 | JGI25161J50226_1000207 | 3300003374 | Bacteria | 38350 |
| 27 | JGI25161J50226_1000412 | 3300003374 | Bacteria | 20844 |
| 28 | Ga0055526_1000594 | 3300003771 | Bacteria | 28489 |
| 29 | Ga0055526_1003679 | 3300003771 | Bacteria | 9591 |
| 30 | Ga0055526_1028194 | 3300003771 | Bacteria | 1706 |
| 31 | Ga0055524_1001754 | 3300003775 | Bacteria | 11976 |
| 32 | Ga0055524_1001805 | 3300003775 | Bacteria | 11731 |
| 33 | Ga0055524_1025058 | 3300003775 | Bacteria | 1875 |
| 34 | Ga0055528_1000358 | 3300003790 | Bacteria | 37118 |
| 35 | Ga0055528_1019378 | 3300003790 | Bacteria | 2257 |
| 36 | Ga0055540_1012253 | 3300003792 | Bacteria | 2705 |
| 37 | Ga0058692_1000085 | 3300003856 | Bacteria | 65543 |
| 38 | Ga0058692_1000167 | 3300003856 | Bacteria | 40623 |
| 39 | Ga0058692_1000350 | 3300003856 | Bacteria | 22460 |
| 40 | Ga0058692_1006447 | 3300003856 | Bacteria | 3219 |
| 41 | Ga0055543_1000053 | 3300004625 | Bacteria | 104589 |
| 42 | Ga0055543_1000068 | 3300004625 | Bacteria | 94795 |
| 43 | Ga0055543_1000301 | 3300004625 | Bacteria | 35189 |
| 44 | Ga0055543_1001883 | 3300004625 | Bacteria | 7624 |
| 45 | Ga0065165_1000717 | 3300005262 | Bacteria | 46746 |
| 46 | Ga0065165_1000839 | 3300005262 | Bacteria | 40355 |
| 47 | Ga0065165_1005533 | 3300005262 | Bacteria | 7050 |
| 48 | Ga0070668_100205064 | 3300005347 | Bacteria | 1620 |
| 49 | Ga0070669_100215989 | 3300005353 | Bacteria | 1515 |
| 50 | Ga0070671_100084132 | 3300005355 | Bacteria | 2661 |
| 51 | Ga0070667_100245343 | 3300005367 | Bacteria | 1600 |
| 52 | Ga0070665_100543480 | 3300005548 | Bacteria | 1174 |
| 53 | Ga0068854_100046155 | 3300005578 | Bacteria | 3101 |
| 54 | Ga0068856_100035514 | 3300005614 | Bacteria | 4886 |
| 55 | Ga0068851_10061721 | 3300005834 | Bacteria | 1922 |
| 56 | Ga0075365_10000404 | 3300006038 | Bacteria | 15855 |
| 57 | Ga0075365_10040694 | 3300006038 | Bacteria | 3032 |
| 58 | Ga0075364_10224605 | 3300006051 | Bacteria | 1275 |
| 59 | Ga0075362_10094396 | 3300006177 | Bacteria | 1392 |
| 60 | Ga0075367_10006190 | 3300006178 | Bacteria | 6026 |
| 61 | Ga0075367_10014267 | 3300006178 | Bacteria | 4297 |
| 62 | Ga0075367_10130254 | 3300006178 | Bacteria | 1554 |
| 63 | Ga0075367_10277944 | 3300006178 | Bacteria | 1052 |
| 64 | Ga0075369_10000812 | 3300006186 | Bacteria | 10265 |
| 65 | Ga0075369_10014994 | 3300006186 | Bacteria | 3103 |
| 66 | Ga0079104_1000610 | 3300006946 | Bacteria | 35237 |
| 67 | Ga0079104_1013531 | 3300006946 | Bacteria | 2509 |
| 68 | Ga0099826_10000091 | 3300006948 | Bacteria | 44824 |
| 69 | Ga0099826_10012274 | 3300006948 | Bacteria | 6455 |
| 70 | Ga0105250_10003428 | 3300009092 | Bacteria | 7517 |
| 71 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 72 | Ga0105243_10023405 | 3300009148 | Bacteria | 4704 |
| 73 | Ga0105237_10000766 | 3300009545 | Bacteria | 44044 |
| 74 | Ga0123342_1012633 | 3300009766 | Bacteria | 8735 |
| 75 | Ga0105239_10001069 | 3300010375 | Bacteria | 38061 |
| 76 | Ga0105246_10009831 | 3300011119 | Bacteria | 5898 |
| 77 | Ga0105246_10017249 | 3300011119 | Bacteria | 4587 |
| 78 | Ga0157373_10000137 | 3300013100 | Bacteria | 57817 |
| 79 | Ga0157373_10007245 | 3300013100 | Bacteria | 8273 |
| 80 | Ga0157371_10000015 | 3300013102 | Bacteria | 339838 |
| 81 | Ga0157371_10000810 | 3300013102 | Bacteria | 35896 |
| 82 | Ga0157371_10016604 | 3300013102 | Bacteria | 5489 |
| 83 | Ga0157370_10000046 | 3300013104 | Bacteria | 125612 |
| 84 | Ga0157370_10000402 | 3300013104 | Bacteria | 54601 |
| 85 | Ga0171463_1003 | 3300013249 | Bacteria | 695693 |
| 86 | Ga0163162_10259195 | 3300013306 | Bacteria | 1871 |
| 87 | Ga0157372_10029974 | 3300013307 | Bacteria | 5946 |
| 88 | Ga0183363_1047 | 3300015690 | Bacteria | 39413 |
| 89 | Ga0214544_1001682 | 3300021320 | Bacteria | 46508 |
| 90 | Ga0214542_1001614 | 3300021321 | Bacteria | 46380 |
| 91 | Ga0214543_1000078 | 3300021327 | Bacteria | 119775 |
| 92 | Ga0214543_1001395 | 3300021327 | Bacteria | 46435 |
| 93 | Ga0228711_1000016 | 3300022739 | Bacteria | 126351 |
| 94 | Ga0228710_1000013 | 3300022740 | Bacteria | 145976 |
| 95 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 96 | Ga0209760_101106 | 3300025207 | Bacteria | 3086 |
| 97 | Ga0209436_100085 | 3300025208 | Bacteria | 46798 |
| 98 | Ga0209436_103034 | 3300025208 | Bacteria | 4648 |
| 99 | Ga0209436_105400 | 3300025208 | Bacteria | 2950 |
| 100 | Ga0209437_100047 | 3300025233 | Bacteria | 405163 |
| 101 | Ga0209437_100165 | 3300025233 | Bacteria | 145009 |
| 102 | Ga0207425_1000024 | 3300025245 | Bacteria | 328978 |
| 103 | Ga0207425_1001564 | 3300025245 | Bacteria | 9306 |
| 104 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 105 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 106 | Ga0209677_100656 | 3300025253 | Bacteria | 18202 |
| 107 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 108 | Ga0209129_1000069 | 3300025258 | Bacteria | 212790 |
| 109 | Ga0209129_1000184 | 3300025258 | Bacteria | 87102 |
| 110 | Ga0209129_1002960 | 3300025258 | Bacteria | 7755 |
| 111 | Ga0209129_1005886 | 3300025258 | Bacteria | 4162 |
| 112 | Ga0209233_1000048 | 3300025261 | Bacteria | 453669 |
| 113 | Ga0209233_1000069 | 3300025261 | Bacteria | 367639 |
| 114 | Ga0209233_1000195 | 3300025261 | Bacteria | 125863 |
| 115 | Ga0209565_1020981 | 3300025263 | Bacteria | 1371 |
| 116 | Ga0209455_1014550 | 3300025272 | Bacteria | 1775 |
| 117 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 118 | Ga0209673_1003537 | 3300025273 | Bacteria | 9130 |
| 119 | Ga0209673_1008196 | 3300025273 | Bacteria | 4689 |
| 120 | Ga0209130_1000021 | 3300025284 | Bacteria | 374278 |
| 121 | Ga0209130_1000029 | 3300025284 | Bacteria | 323399 |
| 122 | Ga0209130_1000081 | 3300025284 | Bacteria | 166440 |
| 123 | Ga0209130_1024642 | 3300025284 | Bacteria | 1310 |
| 124 | Ga0209676_1005409 | 3300025292 | Bacteria | 6685 |
| 125 | Ga0209676_1007095 | 3300025292 | Bacteria | 5362 |
| 126 | Ga0209025_1000050 | 3300025294 | Bacteria | 331531 |
| 127 | Ga0209025_1000094 | 3300025294 | Bacteria | 241080 |
| 128 | Ga0209025_1000119 | 3300025294 | Bacteria | 210606 |
| 129 | Ga0209025_1000959 | 3300025294 | Bacteria | 43491 |
| 130 | Ga0209025_1001225 | 3300025294 | Bacteria | 35824 |
| 131 | Ga0209025_1004412 | 3300025294 | Bacteria | 12242 |
| 132 | Ga0209025_1021372 | 3300025294 | Bacteria | 3489 |
| 133 | Ga0209025_1025145 | 3300025294 | Bacteria | 3042 |
| 134 | Ga0209025_1030438 | 3300025294 | Bacteria | 2584 |
| 135 | Ga0209025_1046039 | 3300025294 | Bacteria | 1800 |
| 136 | Ga0209564_1000260 | 3300025295 | Bacteria | 112444 |
| 137 | Ga0209564_1000278 | 3300025295 | Bacteria | 105405 |
| 138 | Ga0209758_1000083 | 3300025297 | Bacteria | 257283 |
| 139 | Ga0209758_1000418 | 3300025297 | Bacteria | 72150 |
| 140 | Ga0209758_1001270 | 3300025297 | Bacteria | 31259 |
| 141 | Ga0209758_1001756 | 3300025297 | Bacteria | 24054 |
| 142 | Ga0209758_1028658 | 3300025297 | Bacteria | 2348 |
| 143 | Ga0209050_1009223 | 3300025298 | Bacteria | 5091 |
| 144 | Ga0209050_1030063 | 3300025298 | Bacteria | 1721 |
| 145 | Ga0209256_1000042 | 3300025299 | Bacteria | 341821 |
| 146 | Ga0209256_1001127 | 3300025299 | Bacteria | 30457 |
| 147 | Ga0209256_1003234 | 3300025299 | Bacteria | 11741 |
| 148 | Ga0209256_1003768 | 3300025299 | Bacteria | 10221 |
| 149 | Ga0209256_1016068 | 3300025299 | Bacteria | 2575 |
| 150 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 151 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 152 | Ga0207426_1000074 | 3300025302 | Bacteria | 323399 |
| 153 | Ga0207426_1000952 | 3300025302 | Bacteria | 28571 |
| 154 | Ga0209051_1001051 | 3300025303 | Bacteria | 25929 |
| 155 | Ga0209051_1038275 | 3300025303 | Bacteria | 1747 |
| 156 | Ga0209051_1059233 | 3300025303 | Bacteria | 1215 |
| 157 | Ga0209257_1006328 | 3300025304 | Bacteria | 7699 |
| 158 | Ga0209257_1007766 | 3300025304 | Bacteria | 6371 |
| 159 | Ga0209257_1024647 | 3300025304 | Bacteria | 2077 |
| 160 | Ga0209257_1036739 | 3300025304 | Bacteria | 1501 |
| 161 | Ga0207696_1000062 | 3300025711 | Bacteria | 239603 |
| 162 | Ga0207655_1000007 | 3300025728 | Bacteria | 773492 |
| 163 | Ga0207655_1022807 | 3300025728 | Bacteria | 3122 |
| 164 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 165 | Ga0207671_10000241 | 3300025914 | Bacteria | 81847 |
| 166 | Ga0207681_10140175 | 3300025923 | Bacteria | 1800 |
| 167 | Ga0207668_10128587 | 3300025972 | Bacteria | 1931 |
| 168 | Ga0207640_10027070 | 3300025981 | Bacteria | 3491 |
| 169 | Ga0207702_10074236 | 3300026078 | Bacteria | 2935 |
| 170 | Ga0209281_1000036 | 3300027111 | Bacteria | 369415 |
| 171 | Ga0209281_1000047 | 3300027111 | Bacteria | 326514 |
| 172 | Ga0209281_1000221 | 3300027111 | Bacteria | 122380 |
| 173 | Ga0209371_1000005 | 3300027312 | Bacteria | 1061740 |
| 174 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 175 | Ga0209371_1000039 | 3300027312 | Bacteria | 350081 |
| 176 | Ga0209371_1000199 | 3300027312 | Bacteria | 87337 |
| 177 | Ga0209371_1000229 | 3300027312 | Bacteria | 71827 |
| 178 | Ga0209371_1002365 | 3300027312 | Bacteria | 10675 |
| 179 | Ga0209371_1004936 | 3300027312 | Bacteria | 5543 |
| 180 | Ga0209282_1000041 | 3300027666 | Bacteria | 122268 |
| 181 | Ga0209282_1000251 | 3300027666 | Bacteria | 26915 |
| 182 | Ga0209282_1054726 | 3300027666 | Bacteria | 2262 |
| 183 | Ga0209813_10033758 | 3300027866 | Bacteria | 1523 |
| 184 | Ga0268266_10197077 | 3300028379 | Bacteria | 1842 |
| 185 | Ga0268266_10397157 | 3300028379 | Bacteria | 1303 |
| 186 | Ga0307515_10000023 | 3300028794 | Bacteria | 400846 |
| 187 | Ga0307515_10013391 | 3300028794 | Bacteria | 15338 |
| 188 | Ga0307515_10084680 | 3300028794 | Bacteria | 4068 |
| 189 | Ga0268256_1000006 | 3300030500 | Bacteria | 1063991 |
| 190 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 191 | Ga0268256_1000033 | 3300030500 | Bacteria | 420973 |
| 192 | Ga0268256_1000618 | 3300030500 | Bacteria | 27786 |
| 193 | Ga0268256_1001050 | 3300030500 | Bacteria | 18470 |
| 194 | Ga0268256_1003171 | 3300030500 | Bacteria | 7645 |
| 195 | Ga0268256_1004176 | 3300030500 | Bacteria | 6112 |
| 196 | Ga0316181_1097185 | 3300030744 | Bacteria | 1108 |
| 197 | Ga0307408_100121756 | 3300031548 | Bacteria | 2022 |
| 198 | Ga0307412_10029449 | 3300031911 | Bacteria | 3446 |
| 199 | Ga0307412_10064336 | 3300031911 | Bacteria | 2478 |
| 200 | Ga0307412_10179015 | 3300031911 | Bacteria | 1593 |
| 201 | Ga0315914_1005042 | 3300031967 | Bacteria | 19465 |
| 202 | Ga0307409_100219905 | 3300031995 | Bacteria | 1714 |
| 203 | Ga0307416_100250920 | 3300032002 | Bacteria | 1722 |
| 204 | Ga0315913_1003257 | 3300033430 | Bacteria | 19465 |
| 205 | Ga0315915_1000017 | 3300033464 | Bacteria | 148111 |
| 206 | Ga0400483_079876 | 3300039062 | Bacteria | 8635 |
| 207 | Ga0400483_172620 | 3300039062 | Bacteria | 11957 |
| 208 | Ga0439438_004464 | 3300041405 | Bacteria | 5359 |
| 209 | Ga0439439_0052844 | 3300041406 | Bacteria | 1068 |
| 210 | Ga0439447_002812 | 3300041407 | Bacteria | 6266 |
| 211 | Ga0439465_0003881 | 3300041413 | Bacteria | 4879 |
| 212 | Ga0439465_0011462 | 3300041413 | Bacteria | 2782 |
| 213 | Ga0451791_1542990 | 3300041451 | Bacteria | 1143 |
| 214 | Ga0451833_0387060 | 3300041491 | Bacteria | 1178 |
| 215 | Ga0451835_0183697 | 3300041492 | Bacteria | 1002 |
| 216 | Ga0451835_0197663 | 3300041492 | Bacteria | 1555 |
| 217 | Ga0451837_0688979 | 3300041494 | Bacteria | 1760 |
| 218 | Ga0451839_0261576 | 3300041496 | Bacteria | 5053 |
| 219 | Ga0451841_0575577 | 3300041498 | Bacteria | 2710 |
| 220 | Ga0451846_11831 | 3300041502 | Bacteria | 1770 |
| 221 | Ga0451847_0545570 | 3300041503 | Bacteria | 2374 |
| 222 | Ga0451851_0185573 | 3300041507 | Bacteria | 3658 |
| 223 | Ga0451843_0557105 | 3300041509 | Bacteria | 1996 |
| 224 | Ga0439449_0010911 | 3300042007 | Bacteria | 3428 |
| 225 | Ga0439449_0015007 | 3300042007 | Bacteria | 2911 |
| 226 | Ga0450908_008115 | 3300042184 | Bacteria | 1970 |
| 227 | Ga0466968_0099450 | 3300044735 | Bacteria | 1297 |
| 228 | Ga0466970_0000517 | 3300044765 | Bacteria | 19001 |
| 229 | Ga0466970_0197868 | 3300044765 | Bacteria | 1118 |
| 230 | Ga0466958_0025411 | 3300045836 | Bacteria | 3493 |
| 231 | Ga0495617_007878 | 3300046452 | Bacteria | 3685 |
| 232 | Ga0495591_000007 | 3300046458 | Bacteria | 366385 |
| 233 | Ga0495591_000318 | 3300046458 | Bacteria | 43617 |
| 234 | Ga0495650_0000026 | 3300046471 | Bacteria | 476029 |
| 235 | Ga0495605_0015250 | 3300046474 | Bacteria | 4185 |
| 236 | Ga0495605_0042953 | 3300046474 | Bacteria | 2243 |
| 237 | Ga0495605_0162028 | 3300046474 | Bacteria | 992 |
| 238 | Ga0495585_0019158 | 3300046492 | Bacteria | 3949 |
| 239 | Ga0495585_0019219 | 3300046492 | Bacteria | 3942 |
| 240 | Ga0495607_0014568 | 3300046501 | Bacteria | 5113 |
| 241 | Ga0495607_0066247 | 3300046501 | Bacteria | 2033 |
| 242 | Ga0495606_0001613 | 3300046507 | Bacteria | 29410 |
| 243 | Ga0495606_0012820 | 3300046507 | Bacteria | 6679 |
| 244 | Ga0495606_0108765 | 3300046507 | Bacteria | 1675 |
| 245 | Ga0495610_0027460 | 3300046512 | Bacteria | 3023 |
| 246 | Ga0495616_0051898 | 3300046513 | Bacteria | 2043 |
| 247 | Ga0495631_0005659 | 3300046518 | Bacteria | 6519 |
| 248 | Ga0495631_0039188 | 3300046518 | Bacteria | 2104 |
| 249 | Ga0495632_0016479 | 3300046519 | Bacteria | 4109 |
| 250 | Ga0495643_0039324 | 3300046522 | Bacteria | 2587 |
| 251 | Ga0495644_0001680 | 3300046523 | Bacteria | 8985 |
| 252 | Ga0495648_0009418 | 3300046524 | Bacteria | 7577 |
| 253 | Ga0495654_0000007 | 3300046530 | Bacteria | 403529 |
| 254 | Ga0495654_0000069 | 3300046530 | Bacteria | 120853 |
| 255 | Ga0495633_0015993 | 3300046558 | Bacteria | 3881 |
| 256 | Ga0495633_0082790 | 3300046558 | Bacteria | 1493 |
| 257 | Ga0495633_0147035 | 3300046558 | Bacteria | 1089 |
| 258 | Ga0495625_0047417 | 3300046660 | Bacteria | 3098 |
| 259 | Ga0495625_0202915 | 3300046660 | Bacteria | 1307 |
| 260 | Ga0495671_0022125 | 3300046692 | Bacteria | 3333 |
| 261 | Ga0495649_0019733 | 3300046694 | Bacteria | 3785 |
| 262 | Ga0495589_0003279 | 3300046794 | Bacteria | 8788 |
| 263 | Ga0495660_0000016 | 3300046810 | Bacteria | 321859 |
| 264 | Ga0495660_0029052 | 3300046810 | Bacteria | 3121 |
| 265 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 266 | Ga0495673_0000352 | 3300047469 | Bacteria | 57266 |
| 267 | Ga0495681_0005741 | 3300047470 | Bacteria | 8255 |
| 268 | Ga0495686_0000796 | 3300047472 | Bacteria | 41000 |
| 269 | Ga0495686_0023787 | 3300047472 | Bacteria | 4033 |
| 270 | Ga0496100_0017847 | 3300048903 | Bacteria | 4197 |
| 271 | Ga0496100_0080448 | 3300048903 | Bacteria | 2199 |
| 272 | Ga0496101_0000093 | 3300048904 | Bacteria | 95734 |
| 273 | Ga0496102_0010757 | 3300048905 | Bacteria | 7880 |
| 274 | Ga0496104_0200879 | 3300048907 | Bacteria | 1905 |
| 275 | Ga0496110_0370165 | 3300048913 | Bacteria | 1306 |
| 276 | Ga0496111_0015511 | 3300048914 | Bacteria | 5233 |
| 277 | Ga0496113_0076669 | 3300048916 | Bacteria | 2554 |
| 278 | Ga0496116_0000086 | 3300048919 | Bacteria | 217597 |
| 279 | Ga0496116_0005431 | 3300048919 | Bacteria | 11825 |
| 280 | Ga0496116_0006630 | 3300048919 | Bacteria | 10457 |
| 281 | Ga0496116_0057331 | 3300048919 | Bacteria | 2547 |
| 282 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 283 | Ga0496117_0000353 | 3300048920 | Bacteria | 81061 |
| 284 | Ga0496117_0006313 | 3300048920 | Bacteria | 12058 |
| 285 | Ga0496117_0071508 | 3300048920 | Bacteria | 2324 |
| 286 | Ga0496118_0000204 | 3300048921 | Bacteria | 104260 |
| 287 | Ga0496118_0000355 | 3300048921 | Bacteria | 77500 |
| 288 | Ga0496118_0022010 | 3300048921 | Bacteria | 5590 |
| 289 | Ga0496119_0003501 | 3300048922 | Bacteria | 16239 |
| 290 | Ga0496119_0004804 | 3300048922 | Bacteria | 13257 |
| 291 | Ga0496119_0014717 | 3300048922 | Bacteria | 6095 |
| 292 | Ga0496119_0035312 | 3300048922 | Bacteria | 3277 |
| 293 | Ga0496119_0087118 | 3300048922 | Bacteria | 1783 |
| 294 | Ga0496119_0133318 | 3300048922 | Bacteria | 1351 |
| 295 | Ga0496120_0000002 | 3300048923 | Bacteria | 547999 |
| 296 | Ga0496120_0000116 | 3300048923 | Bacteria | 135302 |
| 297 | Ga0496120_0000917 | 3300048923 | Bacteria | 41032 |
| 298 | Ga0496120_0000941 | 3300048923 | Bacteria | 40051 |
| 299 | Ga0496120_0002795 | 3300048923 | Bacteria | 16912 |
| 300 | Ga0496120_0009779 | 3300048923 | Bacteria | 6762 |
| 301 | Ga0496121_0000378 | 3300048924 | Bacteria | 91381 |
| 302 | Ga0496121_0009399 | 3300048924 | Bacteria | 11245 |
| 303 | Ga0496121_0043020 | 3300048924 | Bacteria | 3918 |
| 304 | Ga0496121_0071342 | 3300048924 | Bacteria | 2794 |
| 305 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 306 | Ga0496122_0000369 | 3300048925 | Bacteria | 96672 |
| 307 | Ga0496122_0000525 | 3300048925 | Bacteria | 79294 |
| 308 | Ga0496122_0003261 | 3300048925 | Bacteria | 21531 |
| 309 | Ga0496122_0004665 | 3300048925 | Bacteria | 16828 |
| 310 | Ga0496122_0008819 | 3300048925 | Bacteria | 10769 |
| 311 | Ga0496122_0012544 | 3300048925 | Bacteria | 8418 |
| 312 | Ga0496122_0024409 | 3300048925 | Bacteria | 5291 |
| 313 | Ga0496122_0032026 | 3300048925 | Bacteria | 4358 |
| 314 | Ga0496122_0072484 | 3300048925 | Bacteria | 2448 |
| 315 | Ga0496122_0243607 | 3300048925 | Bacteria | 1011 |
| 316 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 317 | Ga0496123_0000054 | 3300048926 | Bacteria | 234046 |
| 318 | Ga0496123_0001014 | 3300048926 | Bacteria | 42878 |
| 319 | Ga0496123_0002174 | 3300048926 | Bacteria | 25015 |
| 320 | Ga0496123_0002482 | 3300048926 | Bacteria | 22770 |
| 321 | Ga0496123_0003243 | 3300048926 | Bacteria | 18515 |
| 322 | Ga0496124_0000357 | 3300048927 | Bacteria | 83170 |
| 323 | Ga0496124_0001936 | 3300048927 | Bacteria | 28381 |
| 324 | Ga0496124_0006121 | 3300048927 | Bacteria | 13215 |
| 325 | Ga0496124_0010848 | 3300048927 | Bacteria | 9175 |
| 326 | Ga0496124_0014592 | 3300048927 | Bacteria | 7589 |
| 327 | Ga0496124_0049824 | 3300048927 | Bacteria | 3571 |
| 328 | Ga0496124_0065627 | 3300048927 | Bacteria | 3025 |
| 329 | Ga0496124_0075919 | 3300048927 | Bacteria | 2776 |
| 330 | Ga0496124_0324998 | 3300048927 | Bacteria | 1099 |
| 331 | Ga0496125_0000282 | 3300048928 | Bacteria | 101380 |
| 332 | Ga0496125_0002081 | 3300048928 | Bacteria | 26974 |
| 333 | Ga0496125_0011299 | 3300048928 | Bacteria | 8948 |
| 334 | Ga0496125_0024477 | 3300048928 | Bacteria | 5551 |
| 335 | Ga0496125_0028386 | 3300048928 | Bacteria | 5055 |
| 336 | Ga0496125_0041019 | 3300048928 | Bacteria | 3962 |
| 337 | Ga0496126_0000703 | 3300048929 | Bacteria | 61100 |
| 338 | Ga0496126_0001019 | 3300048929 | Bacteria | 47578 |
| 339 | Ga0496126_0041836 | 3300048929 | Bacteria | 4237 |
| 340 | Ga0496126_0061193 | 3300048929 | Bacteria | 3383 |
| 341 | Ga0496126_0070749 | 3300048929 | Bacteria | 3107 |
| 342 | Ga0496126_0189716 | 3300048929 | Bacteria | 1742 |
| 343 | Ga0496126_0255942 | 3300048929 | Bacteria | 1457 |
| 344 | Ga0495678_001115 | 3300049459 | Bacteria | 22363 |
| 345 | Ga0495682_0000001 | 3300049460 | Bacteria | 1559116 |
| 346 | Ga0501032_0175424 | 3300049569 | Bacteria | 1404 |
| 347 | Ga0501033_0000167 | 3300049570 | Bacteria | 63051 |
| 348 | Ga0501033_0058254 | 3300049570 | Bacteria | 2854 |
| 349 | Ga0501034_0002538 | 3300049571 | Bacteria | 21830 |
| 350 | Ga0501034_0427279 | 3300049571 | Bacteria | 1245 |
| 351 | Ga0501037_0088749 | 3300049573 | Bacteria | 2238 |
| 352 | Ga0501037_0128592 | 3300049573 | Bacteria | 1817 |
| 353 | Ga0501043_0027267 | 3300049579 | Bacteria | 4485 |
| 354 | Ga0501070_0211017 | 3300049586 | Bacteria | 1594 |
| 355 | Ga0501083_0092066 | 3300049744 | Bacteria | 2001 |
| 356 | Ga0501280_000582 | 3300049776 | Bacteria | 8435 |
| 357 | Ga0501035_0006797 | 3300049822 | Bacteria | 10686 |
| 358 | Ga0501035_0195416 | 3300049822 | Bacteria | 1738 |
| 359 | Ga0501044_0091936 | 3300049823 | Bacteria | 3060 |
| 360 | Ga0501044_0263690 | 3300049823 | Bacteria | 1661 |
| 361 | Ga0501044_0280231 | 3300049823 | Bacteria | 1601 |
| 362 | Ga0501044_0355027 | 3300049823 | Bacteria | 1385 |
| 363 | nmdc:mga03683_2318_c1 | 3300050489 | Bacteria | 5888 |
| 364 | nmdc:mga03683_34891_c1 | 3300050489 | Bacteria | 2037 |
| 365 | nmdc:mga03n38_1786_c1 | 3300050490 | Bacteria | 6376 |
| 366 | nmdc:mga00v17_219758_c1 | 3300050491 | Bacteria | 1230 |
| 367 | nmdc:mga00v17_264213_c1 | 3300050491 | Bacteria | 1116 |
| 368 | nmdc:mga00v17_6_c1 | 3300050491 | Bacteria | 179509 |
| 369 | nmdc:mga0yw44_33191_c1 | 3300050492 | Bacteria | 3014 |
| 370 | nmdc:mga0yw44_72132_c1 | 3300050492 | Bacteria | 2146 |
| 371 | nmdc:mga06z11_55161_c1 | 3300050494 | Bacteria | 2051 |
| 372 | nmdc:mga06z11_817_c1 | 3300050494 | Bacteria | 11396 |
| 373 | nmdc:mga04h51_23321_c1 | 3300050495 | Bacteria | 1883 |
| 374 | nmdc:mga07m45_161522_c1 | 3300050496 | Bacteria | 1301 |
| 375 | nmdc:mga07m45_176094_c1 | 3300050496 | Bacteria | 1244 |
| 376 | nmdc:mga07m45_928_c1 | 3300050496 | Bacteria | 12810 |
| 377 | nmdc:mga0sz30_12802_c1 | 3300050516 | Bacteria | 3269 |
| 378 | nmdc:mga0sz30_215_c2 | 3300050516 | Bacteria | 16156 |
| 379 | nmdc:mga0sz30_708_c1 | 3300050516 | Bacteria | 12251 |
| 380 | Ga0500560_006454 | 3300053107 | Bacteria | 2685 |
| 381 | Ga0500569_018613 | 3300053109 | Bacteria | 1796 |
| 382 | Ga0500594_0016193 | 3300053118 | Bacteria | 1809 |
| 383 | Ga0500618_000313 | 3300053125 | Bacteria | 35843 |
| 384 | Ga0500618_000604 | 3300053125 | Bacteria | 22060 |
| 385 | Ga0500618_012244 | 3300053125 | Bacteria | 2249 |
| 386 | Ga0500621_000002 | 3300053126 | Bacteria | 849473 |
| 387 | Ga0500658_0000945 | 3300053134 | Bacteria | 11858 |
| 388 | Ga0500561_0000246 | 3300053137 | Bacteria | 9524 |
| 389 | Ga0500568_0001517 | 3300053139 | Bacteria | 14797 |
| 390 | Ga0500573_0000259 | 3300053140 | Bacteria | 22228 |
| 391 | Ga0500616_0000301 | 3300053153 | Bacteria | 71758 |
| 392 | Ga0500616_0004349 | 3300053153 | Bacteria | 10137 |
| 393 | Ga0500616_0019956 | 3300053153 | Bacteria | 3770 |
| 394 | Ga0500622_0001146 | 3300053156 | Bacteria | 22058 |
| 395 | Ga0500627_0063175 | 3300053158 | Bacteria | 1632 |
| 396 | Ga0500634_0079358 | 3300053161 | Bacteria | 1696 |
| 397 | Ga0500636_0000153 | 3300053177 | Bacteria | 35853 |
| 398 | Ga0500636_0001102 | 3300053177 | Bacteria | 14459 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046474 | Ga0495605_0162028 | Ga0495605_0162028_269_964 | 191 |
| 2 | 3300002773 | JGI25152J39213_1000570 | JGI25152J39213_10005709 | 196 |
| 3 | 3300002774 | JGI25150J39212_1000326 | JGI25150J39212_100032611 | 196 |
| 4 | 3300003187 | JGI25151J46595_10000083 | JGI25151J46595_1000008382 | 196 |
| 5 | 3300003215 | JGI25153J46596_10000377 | JGI25153J46596_1000037725 | 196 |
| 6 | 3300006178 | Ga0075367_10006190 | Ga0075367_100061904 | 196 |
| 7 | 3300025245 | Ga0207425_1000024 | Ga0207425_1000024168 | 196 |
| 8 | 3300025258 | Ga0209129_1000184 | Ga0209129_100018456 | 196 |
| 9 | 3300025294 | Ga0209025_1000050 | Ga0209025_1000050159 | 196 |
| 10 | 3300025297 | Ga0209758_1000083 | Ga0209758_100008398 | 196 |
| 11 | 3300048920 | Ga0496117_0071508 | Ga0496117_0071508_572_1390 | 196 |
| 12 | 3300046518 | Ga0495631_0005659 | Ga0495631_0005659_3365_4174 | 197 |
| 13 | 3300053158 | Ga0500627_0063175 | Ga0500627_0063175_533_1342 | 197 |
| 14 | 3300002773 | JGI25152J39213_1011917 | JGI25152J39213_10119173 | 198 |
| 15 | 3300003771 | Ga0055526_1028194 | Ga0055526_10281942 | 198 |
| 16 | 3300003775 | Ga0055524_1025058 | Ga0055524_10250582 | 198 |
| 17 | 3300005347 | Ga0070668_100205064 | Ga0070668_1002050642 | 198 |
| 18 | 3300005355 | Ga0070671_100084132 | Ga0070671_1000841325 | 198 |
| 19 | 3300006038 | Ga0075365_10000404 | Ga0075365_1000040414 | 198 |
| 20 | 3300006186 | Ga0075369_10000812 | Ga0075369_100008123 | 198 |
| 21 | 3300025258 | Ga0209129_1005886 | Ga0209129_10058868 | 198 |
| 22 | 3300025294 | Ga0209025_1004412 | Ga0209025_10044129 | 198 |
| 23 | 3300025297 | Ga0209758_1028658 | Ga0209758_10286582 | 198 |
| 24 | 3300025302 | Ga0207426_1000952 | Ga0207426_100095215 | 198 |
| 25 | 3300025972 | Ga0207668_10128587 | Ga0207668_101285872 | 198 |
| 26 | 3300048925 | Ga0496122_0243607 | Ga0496122_0243607_138_950 | 198 |
| 27 | 3300006178 | Ga0075367_10130254 | Ga0075367_101302543 | 199 |
| 28 | 3300025273 | Ga0209673_1008196 | Ga0209673_10081964 | 199 |
| 29 | 3300025299 | Ga0209256_1016068 | Ga0209256_10160683 | 199 |
| 30 | 3300025303 | Ga0209051_1059233 | Ga0209051_10592332 | 199 |
| 31 | 3300028794 | Ga0307515_10084680 | Ga0307515_100846802 | 199 |
| 32 | 3300041451 | Ga0451791_1542990 | Ga0451791_1542990_22_837 | 199 |
| 33 | 3300041509 | Ga0451843_0557105 | Ga0451843_0557105_613_1428 | 199 |
| 34 | 3300046660 | Ga0495625_0047417 | Ga0495625_0047417_1219_2037 | 199 |
| 35 | 3300053139 | Ga0500568_0001517 | Ga0500568_0001517_5787_6605 | 200 |
| 36 | 3300053153 | Ga0500616_0004349 | Ga0500616_0004349_5458_6276 | 200 |
| 37 | 3300009766 | Ga0123342_1012633 | Ga0123342_10126337 | 202 |
| 38 | 3300046522 | Ga0495643_0039324 | Ga0495643_0039324_1190_2023 | 205 |
| 39 | 3300046660 | Ga0495625_0202915 | Ga0495625_0202915_35_868 | 205 |
| 40 | 3300049823 | Ga0501044_0355027 | Ga0501044_0355027_63_884 | 205 |
| 41 | 3300053153 | Ga0500616_0019956 | Ga0500616_0019956_2501_3334 | 205 |
| 42 | 3300048927 | Ga0496124_0065627 | Ga0496124_0065627_187_1014 | 207 |
| 43 | 3300004625 | Ga0055543_1001883 | Ga0055543_10018835 | 208 |
| 44 | 3300005578 | Ga0068854_100046155 | Ga0068854_1000461552 | 208 |
| 45 | 3300005834 | Ga0068851_10061721 | Ga0068851_100617213 | 208 |
| 46 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005700 | 208 |
| 47 | 3300009545 | Ga0105237_10000766 | Ga0105237_1000076637 | 208 |
| 48 | 3300010375 | Ga0105239_10001069 | Ga0105239_1000106921 | 208 |
| 49 | 3300013104 | Ga0157370_10000046 | Ga0157370_1000004676 | 208 |
| 50 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011217 | 208 |
| 51 | 3300025914 | Ga0207671_10000241 | Ga0207671_1000024124 | 208 |
| 52 | 3300025981 | Ga0207640_10027070 | Ga0207640_100270704 | 208 |
| 53 | 3300048929 | Ga0496126_0070749 | Ga0496126_0070749_1968_2795 | 208 |
| 54 | 3300025208 | Ga0209436_105400 | Ga0209436_1054003 | 209 |
| 55 | 3300025284 | Ga0209130_1000021 | Ga0209130_1000021277 | 209 |
| 56 | 3300025302 | Ga0207426_1000010 | Ga0207426_100001081 | 209 |
| 57 | 3300041498 | Ga0451841_0575577 | Ga0451841_0575577_432_1295 | 209 |
| 58 | 3300046518 | Ga0495631_0039188 | Ga0495631_0039188_933_1817 | 209 |
| 59 | 3300003775 | Ga0055524_1001805 | Ga0055524_100180511 | 210 |
| 60 | 3300003790 | Ga0055528_1000358 | Ga0055528_10003586 | 210 |
| 61 | 3300025258 | Ga0209129_1000069 | Ga0209129_100006914 | 210 |
| 62 | 3300025273 | Ga0209673_1000010 | Ga0209673_10000106 | 210 |
| 63 | 3300025294 | Ga0209025_1001225 | Ga0209025_100122514 | 210 |
| 64 | 3300025294 | Ga0209025_1021372 | Ga0209025_10213722 | 210 |
| 65 | 3300025299 | Ga0209256_1001127 | Ga0209256_10011276 | 210 |
| 66 | 3300041491 | Ga0451833_0387060 | Ga0451833_0387060_209_1081 | 210 |
| 67 | 3300041492 | Ga0451835_0183697 | Ga0451835_0183697_56_928 | 210 |
| 68 | 3300041496 | Ga0451839_0261576 | Ga0451839_0261576_176_1048 | 210 |
| 69 | 3300046492 | Ga0495585_0019158 | Ga0495585_0019158_2196_3044 | 210 |
| 70 | 3300046513 | Ga0495616_0051898 | Ga0495616_0051898_592_1458 | 211 |
| 71 | 3300049586 | Ga0501070_0211017 | Ga0501070_0211017_137_955 | 211 |
| 72 | 3300041494 | Ga0451837_0688979 | Ga0451837_0688979_791_1663 | 212 |
| 73 | 3300041502 | Ga0451846_11831 | Ga0451846_11831_840_1712 | 212 |
| 74 | 3300046492 | Ga0495585_0019219 | Ga0495585_0019219_2217_3122 | 212 |
| 75 | 3300041492 | Ga0451835_0197663 | Ga0451835_0197663_109_981 | 213 |
| 76 | 3300041503 | Ga0451847_0545570 | Ga0451847_0545570_843_1760 | 213 |
| 77 | 3300041507 | Ga0451851_0185573 | Ga0451851_0185573_1253_2158 | 213 |
| 78 | 3300046501 | Ga0495607_0066247 | Ga0495607_0066247_611_1528 | 213 |
| 79 | 3300046507 | Ga0495606_0108765 | Ga0495606_0108765_610_1527 | 213 |
| 80 | 3300046512 | Ga0495610_0027460 | Ga0495610_0027460_1967_2884 | 213 |
| 81 | 3300046519 | Ga0495632_0016479 | Ga0495632_0016479_2310_3227 | 213 |
| 82 | 3300046810 | Ga0495660_0029052 | Ga0495660_0029052_1422_2339 | 213 |
| 83 | 3300047472 | Ga0495686_0023787 | Ga0495686_0023787_898_1791 | 213 |
| 84 | 3300050489 | nmdc:mga03683_2318_c1 | nmdc:mga03683_2318_c1_870_1811 | 213 |
| 85 | 3300050494 | nmdc:mga06z11_817_c1 | nmdc:mga06z11_817_c1_3225_4166 | 213 |
| 86 | 3300050496 | nmdc:mga07m45_928_c1 | nmdc:mga07m45_928_c1_6193_7134 | 213 |
| 87 | 3300050516 | nmdc:mga0sz30_708_c1 | nmdc:mga0sz30_708_c1_6052_6993 | 213 |
| 88 | 3300053109 | Ga0500569_018613 | Ga0500569_018613_722_1639 | 213 |
| 89 | 3300053118 | Ga0500594_0016193 | Ga0500594_0016193_902_1795 | 213 |
| 90 | 3300053134 | Ga0500658_0000945 | Ga0500658_0000945_4480_5397 | 213 |
| 91 | 3300046474 | Ga0495605_0015250 | Ga0495605_0015250_86_961 | 214 |
| 92 | 3300046558 | Ga0495633_0082790 | Ga0495633_0082790_15_962 | 214 |
| 93 | 3300048919 | Ga0496116_0057331 | Ga0496116_0057331_612_1592 | 214 |
| 94 | 3300048925 | Ga0496122_0004665 | Ga0496122_0004665_949_1929 | 214 |
| 95 | 3300048926 | Ga0496123_0002482 | Ga0496123_0002482_874_1854 | 214 |
| 96 | 3300048927 | Ga0496124_0014592 | Ga0496124_0014592_608_1588 | 214 |
| 97 | 3300048928 | Ga0496125_0011299 | Ga0496125_0011299_5375_6355 | 214 |
| 98 | 3300048929 | Ga0496126_0255942 | Ga0496126_0255942_409_1272 | 214 |
| 99 | 3300002737 | JGI25162J39368_1000209 | JGI25162J39368_100020912 | 215 |
| 100 | 3300003214 | JGI25165J46597_1000302 | JGI25165J46597_100030212 | 215 |
| 101 | 3300005614 | Ga0068856_100035514 | Ga0068856_1000355144 | 215 |
| 102 | 3300025233 | Ga0209437_100047 | Ga0209437_100047127 | 215 |
| 103 | 3300025261 | Ga0209233_1000048 | Ga0209233_1000048275 | 215 |
| 104 | 3300026078 | Ga0207702_10074236 | Ga0207702_100742363 | 215 |
| 105 | iso_pu_bacteria | 2919493220 | 2919495545 | 215 |
| 106 | iso_pu_bacteria | 2919543075 | 2919544736 | 215 |
| 107 | iso_pu_bacteria | 2923525760 | 2923526907 | 215 |
| 108 | 3300027312 | Ga0209371_1004936 | Ga0209371_10049363 | 216 |
| 109 | 3300030500 | Ga0268256_1004176 | Ga0268256_10041764 | 216 |
| 110 | 3300025253 | Ga0209677_100656 | Ga0209677_10065610 | 217 |
| 111 | 3300025261 | Ga0209233_1000195 | Ga0209233_1000195119 | 217 |
| 112 | 3300031548 | Ga0307408_100121756 | Ga0307408_1001217562 | 217 |
| 113 | 3300031911 | Ga0307412_10064336 | Ga0307412_100643362 | 217 |
| 114 | 3300031995 | Ga0307409_100219905 | Ga0307409_1002199052 | 217 |
| 115 | 3300032002 | Ga0307416_100250920 | Ga0307416_1002509202 | 217 |
| 116 | 3300042007 | Ga0439449_0010911 | Ga0439449_0010911_2591_3418 | 217 |
| 117 | iso_pu_bacteria | 2511231025 | 2511382934 | 217 |
| 118 | iso_pu_bacteria | 2511231035 | 2511435065 | 217 |
| 119 | iso_pu_bacteria | 2511231221 | 2512038281 | 217 |
| 120 | iso_pu_bacteria | 2565956521 | 2566038038 | 217 |
| 121 | iso_pu_bacteria | 2608642108 | 2608669758 | 217 |
| 122 | iso_pu_bacteria | 2648501693 | 2650896422 | 217 |
| 123 | iso_pu_bacteria | 2684622997 | 2686353702 | 217 |
| 124 | iso_pu_bacteria | 2844528606 | 2844528727 | 217 |
| 125 | iso_pu_bacteria | 2847085930 | 2847087289 | 217 |
| 126 | iso_pu_bacteria | 2854601825 | 2854602271 | 217 |
| 127 | iso_pu_bacteria | 2858466076 | 2858467076 | 217 |
| 128 | iso_pu_bacteria | 2865014394 | 2865018387 | 217 |
| 129 | iso_pu_bacteria | 2871272651 | 2871275206 | 217 |
| 130 | iso_pu_bacteria | 2871282230 | 2871285158 | 217 |
| 131 | iso_pu_bacteria | 2876601092 | 2876603890 | 217 |
| 132 | iso_pu_bacteria | 2881609920 | 2881611545 | 217 |
| 133 | iso_pu_bacteria | 2897803580 | 2897808816 | 217 |
| 134 | iso_pu_bacteria | 2908669403 | 2908669420 | 217 |
| 135 | iso_pu_bacteria | 2939602548 | 2939606103 | 217 |
| 136 | iso_pu_bacteria | 2945951305 | 2945952634 | 217 |
| 137 | iso_pu_bacteria | 2978975091 | 2978979202 | 217 |
| 138 | iso_pu_bacteria | 2984494565 | 2984496991 | 217 |
| 139 | iso_pu_bacteria | 2990261002 | 2990262407 | 217 |
| 140 | iso_pu_bacteria | 8019499862 | 8019501028 | 217 |
| 141 | iso_pu_bacteria | 8054002106 | 8054002871 | 217 |
| 142 | 3300039062 | Ga0400483_079876 | Ga0400483_079876_4136_4933 | 218 |
| 143 | 3300039062 | Ga0400483_172620 | Ga0400483_172620_9842_10639 | 218 |
| 144 | iso_pu_bacteria | 2738541276 | 2738714046 | 218 |
| 145 | 3300049823 | Ga0501044_0280231 | Ga0501044_0280231_588_1403 | 220 |
| 146 | iso_pu_bacteria | 2738541317 | 2738945435 | 220 |
| 147 | iso_pu_bacteria | 2913308742 | 2913310141 | 220 |
| 148 | 3300003856 | Ga0058692_1000085 | Ga0058692_100008542 | 221 |
| 149 | 3300003856 | Ga0058692_1000167 | Ga0058692_100016742 | 221 |
| 150 | 3300009092 | Ga0105250_10003428 | Ga0105250_100034287 | 221 |
| 151 | 3300011119 | Ga0105246_10009831 | Ga0105246_100098315 | 221 |
| 152 | 3300011119 | Ga0105246_10017249 | Ga0105246_100172495 | 221 |
| 153 | 3300013100 | Ga0157373_10000137 | Ga0157373_1000013726 | 221 |
| 154 | 3300013102 | Ga0157371_10000810 | Ga0157371_1000081013 | 221 |
| 155 | 3300013102 | Ga0157371_10016604 | Ga0157371_100166044 | 221 |
| 156 | 3300013306 | Ga0163162_10259195 | Ga0163162_102591951 | 221 |
| 157 | 3300013307 | Ga0157372_10029974 | Ga0157372_100299747 | 221 |
| 158 | 3300025711 | Ga0207696_1000062 | Ga0207696_100006258 | 221 |
| 159 | 3300025728 | Ga0207655_1000007 | Ga0207655_1000007177 | 221 |
| 160 | 3300025728 | Ga0207655_1022807 | Ga0207655_10228073 | 221 |
| 161 | 3300027312 | Ga0209371_1000005 | Ga0209371_1000005516 | 221 |
| 162 | 3300027312 | Ga0209371_1000039 | Ga0209371_1000039299 | 221 |
| 163 | 3300027312 | Ga0209371_1000199 | Ga0209371_100019956 | 221 |
| 164 | 3300027312 | Ga0209371_1002365 | Ga0209371_10023652 | 221 |
| 165 | 3300030500 | Ga0268256_1000006 | Ga0268256_1000006541 | 221 |
| 166 | 3300030500 | Ga0268256_1000033 | Ga0268256_100003363 | 221 |
| 167 | 3300030500 | Ga0268256_1000618 | Ga0268256_10006183 | 221 |
| 168 | 3300030500 | Ga0268256_1001050 | Ga0268256_100105010 | 221 |
| 169 | 3300041405 | Ga0439438_004464 | Ga0439438_004464_1609_2394 | 221 |
| 170 | 3300041407 | Ga0439447_002812 | Ga0439447_002812_1452_2237 | 221 |
| 171 | 3300046452 | Ga0495617_007878 | Ga0495617_007878_1197_1982 | 221 |
| 172 | 3300046458 | Ga0495591_000007 | Ga0495591_000007_310064_310849 | 221 |
| 173 | 3300046458 | Ga0495591_000318 | Ga0495591_000318_30702_31487 | 221 |
| 174 | 3300046471 | Ga0495650_0000026 | Ga0495650_0000026_433343_434128 | 221 |
| 175 | 3300046474 | Ga0495605_0042953 | Ga0495605_0042953_203_988 | 221 |
| 176 | 3300046501 | Ga0495607_0014568 | Ga0495607_0014568_4094_4879 | 221 |
| 177 | 3300046507 | Ga0495606_0012820 | Ga0495606_0012820_5202_5987 | 221 |
| 178 | 3300046523 | Ga0495644_0001680 | Ga0495644_0001680_6573_7358 | 221 |
| 179 | 3300046524 | Ga0495648_0009418 | Ga0495648_0009418_4715_5500 | 221 |
| 180 | 3300046530 | Ga0495654_0000007 | Ga0495654_0000007_347200_347985 | 221 |
| 181 | 3300046530 | Ga0495654_0000069 | Ga0495654_0000069_78948_79733 | 221 |
| 182 | 3300046692 | Ga0495671_0022125 | Ga0495671_0022125_2469_3254 | 221 |
| 183 | 3300046694 | Ga0495649_0019733 | Ga0495649_0019733_2293_3078 | 221 |
| 184 | 3300046794 | Ga0495589_0003279 | Ga0495589_0003279_4372_5157 | 221 |
| 185 | 3300046810 | Ga0495660_0000016 | Ga0495660_0000016_248002_248787 | 221 |
| 186 | 3300047320 | Ga0495672_0000001 | Ga0495672_0000001_478023_478808 | 221 |
| 187 | 3300047469 | Ga0495673_0000352 | Ga0495673_0000352_464_1249 | 221 |
| 188 | 3300048903 | Ga0496100_0080448 | Ga0496100_0080448_387_1172 | 221 |
| 189 | 3300048904 | Ga0496101_0000093 | Ga0496101_0000093_66795_67580 | 221 |
| 190 | 3300048919 | Ga0496116_0000086 | Ga0496116_0000086_36621_37406 | 221 |
| 191 | 3300048919 | Ga0496116_0006630 | Ga0496116_0006630_25_810 | 221 |
| 192 | 3300048922 | Ga0496119_0003501 | Ga0496119_0003501_7181_7966 | 221 |
| 193 | 3300048922 | Ga0496119_0087118 | Ga0496119_0087118_57_842 | 221 |
| 194 | 3300048922 | Ga0496119_0133318 | Ga0496119_0133318_499_1284 | 221 |
| 195 | 3300048923 | Ga0496120_0000002 | Ga0496120_0000002_62953_63738 | 221 |
| 196 | 3300048923 | Ga0496120_0000116 | Ga0496120_0000116_64619_65404 | 221 |
| 197 | 3300048923 | Ga0496120_0000917 | Ga0496120_0000917_15107_15892 | 221 |
| 198 | 3300048923 | Ga0496120_0002795 | Ga0496120_0002795_6958_7743 | 221 |
| 199 | 3300048925 | Ga0496122_0003261 | Ga0496122_0003261_16468_17253 | 221 |
| 200 | 3300048926 | Ga0496123_0003243 | Ga0496123_0003243_17105_17890 | 221 |
| 201 | 3300048927 | Ga0496124_0000357 | Ga0496124_0000357_48002_48787 | 221 |
| 202 | 3300048927 | Ga0496124_0006121 | Ga0496124_0006121_8835_9620 | 221 |
| 203 | 3300048929 | Ga0496126_0041836 | Ga0496126_0041836_535_1320 | 221 |
| 204 | 3300049459 | Ga0495678_001115 | Ga0495678_001115_11028_11813 | 221 |
| 205 | 3300049460 | Ga0495682_0000001 | Ga0495682_0000001_621722_622507 | 221 |
| 206 | 3300053126 | Ga0500621_000002 | Ga0500621_000002_628439_629224 | 221 |
| 207 | iso_pu_bacteria | 2558860983 | 2561466428 | 221 |
| 208 | iso_pu_bacteria | 2891048133 | 2891050903 | 221 |
| 209 | 3300025303 | Ga0209051_1038275 | Ga0209051_10382753 | 222 |
| 210 | iso_pu_bacteria | 2757320392 | 2757571228 | 222 |
| 211 | iso_pu_bacteria | 2995392953 | 2995393085 | 222 |
| 212 | 3300048922 | Ga0496119_0014717 | Ga0496119_0014717_4074_4988 | 223 |
| 213 | 3300053153 | Ga0500616_0000301 | Ga0500616_0000301_63229_64053 | 223 |
| 214 | iso_pu_bacteria | 2791355082 | 2792581774 | 223 |
| 215 | iso_pu_bacteria | 8005658619 | 8005659257 | 223 |
| 216 | iso_pu_bacteria | 8049293176 | 8049294950 | 223 |
| 217 | iso_pu_bacteria | 8055431914 | 8055435894 | 223 |
| 218 | iso_pu_bacteria | 2519899620 | 2520381517 | 224 |
| 219 | iso_pu_bacteria | 2643221591 | 2643964498 | 224 |
| 220 | iso_pu_bacteria | 2643221674 | 2644413558 | 224 |
| 221 | iso_pu_bacteria | 2932401849 | 2932404507 | 224 |
| 222 | 3300002987 | JGI25159J45721_1000530 | JGI25159J45721_100053015 | 225 |
| 223 | 3300003354 | JGI25160J50197_1000087 | JGI25160J50197_100008780 | 225 |
| 224 | 3300003374 | JGI25161J50226_1000066 | JGI25161J50226_100006616 | 225 |
| 225 | 3300004625 | Ga0055543_1000068 | Ga0055543_100006880 | 225 |
| 226 | 3300005262 | Ga0065165_1000839 | Ga0065165_100083916 | 225 |
| 227 | 3300006946 | Ga0079104_1013531 | Ga0079104_10135313 | 225 |
| 228 | 3300022739 | Ga0228711_1000016 | Ga0228711_100001612 | 225 |
| 229 | 3300022740 | Ga0228710_1000013 | Ga0228710_1000013122 | 225 |
| 230 | 3300027111 | Ga0209281_1000221 | Ga0209281_10002218 | 225 |
| 231 | 3300027666 | Ga0209282_1000041 | Ga0209282_10000418 | 225 |
| 232 | 3300031967 | Ga0315914_1005042 | Ga0315914_10050428 | 225 |
| 233 | 3300033430 | Ga0315913_1003257 | Ga0315913_100325716 | 225 |
| 234 | 3300033464 | Ga0315915_1000017 | Ga0315915_100001744 | 225 |
| 235 | 3300048925 | Ga0496122_0032026 | Ga0496122_0032026_1755_2573 | 225 |
| 236 | 3300048928 | Ga0496125_0028386 | Ga0496125_0028386_2042_2860 | 225 |
| 237 | 3300049571 | Ga0501034_0427279 | Ga0501034_0427279_260_1063 | 225 |
| 238 | 3300053125 | Ga0500618_000313 | Ga0500618_000313_4946_5767 | 225 |
| 239 | 3300053125 | Ga0500618_012244 | Ga0500618_012244_952_1779 | 225 |
| 240 | iso_pu_bacteria | 2510461069 | 2510841077 | 225 |
| 241 | iso_pu_bacteria | 2585427528 | 2585538038 | 225 |
| 242 | iso_pu_bacteria | 2585427593 | 2585835986 | 225 |
| 243 | iso_pu_bacteria | 2643221653 | 2644300354 | 225 |
| 244 | iso_pu_bacteria | 2643221719 | 2644658578 | 225 |
| 245 | iso_pu_bacteria | 2818991272 | 2819242027 | 225 |
| 246 | iso_pu_bacteria | 2899803654 | 2899809004 | 225 |
| 247 | iso_pu_bacteria | 2989776772 | 2989778697 | 225 |
| 248 | iso_pu_bacteria | 8005246636 | 8005250729 | 225 |
| 249 | 3300025284 | Ga0209130_1024642 | Ga0209130_10246421 | 226 |
| 250 | 3300044765 | Ga0466970_0000517 | Ga0466970_0000517_22_966 | 226 |
| 251 | 3300045836 | Ga0466958_0025411 | Ga0466958_0025411_1593_2492 | 226 |
| 252 | 3300048903 | Ga0496100_0017847 | Ga0496100_0017847_2700_3653 | 226 |
| 253 | 3300048905 | Ga0496102_0010757 | Ga0496102_0010757_1100_2053 | 226 |
| 254 | 3300048919 | Ga0496116_0005431 | Ga0496116_0005431_2012_2965 | 226 |
| 255 | 3300048920 | Ga0496117_0000353 | Ga0496117_0000353_22830_23783 | 226 |
| 256 | 3300048921 | Ga0496118_0000204 | Ga0496118_0000204_48182_49135 | 226 |
| 257 | 3300048922 | Ga0496119_0004804 | Ga0496119_0004804_9355_10308 | 226 |
| 258 | 3300048923 | Ga0496120_0009779 | Ga0496120_0009779_1760_2713 | 226 |
| 259 | 3300048924 | Ga0496121_0000378 | Ga0496121_0000378_66170_67123 | 226 |
| 260 | 3300048925 | Ga0496122_0008819 | Ga0496122_0008819_3922_4875 | 226 |
| 261 | 3300048926 | Ga0496123_0002174 | Ga0496123_0002174_19337_20290 | 226 |
| 262 | 3300049573 | Ga0501037_0088749 | Ga0501037_0088749_749_1558 | 226 |
| 263 | 3300049822 | Ga0501035_0195416 | Ga0501035_0195416_417_1226 | 226 |
| 264 | 3300049823 | Ga0501044_0091936 | Ga0501044_0091936_1561_2370 | 226 |
| 265 | iso_pu_bacteria | 2534681796 | 2535516599 | 226 |
| 266 | iso_pu_bacteria | 2751185800 | 2753357176 | 226 |
| 267 | iso_pu_bacteria | 2758568016 | 2758639582 | 226 |
| 268 | iso_pu_bacteria | 2915650412 | 2915652038 | 226 |
| 269 | iso_pu_bacteria | 2513237144 | 2513914100 | 227 |
| 270 | iso_pu_bacteria | 2513237146 | 2513926077 | 227 |
| 271 | iso_pu_bacteria | 2516143018 | 2516209680 | 227 |
| 272 | iso_pu_bacteria | 2582581294 | 2585200279 | 227 |
| 273 | iso_pu_bacteria | 2599185170 | 2599417550 | 227 |
| 274 | iso_pu_bacteria | 2615840624 | 2616293520 | 227 |
| 275 | iso_pu_bacteria | 2690316117 | 2692315858 | 227 |
| 276 | iso_pu_bacteria | 2718217882 | 2719181656 | 227 |
| 277 | iso_pu_bacteria | 2718218009 | 2719732320 | 227 |
| 278 | iso_pu_bacteria | 2718218363 | 2721147748 | 227 |
| 279 | iso_pu_bacteria | 2718218365 | 2721159196 | 227 |
| 280 | iso_pu_bacteria | 2718218366 | 2721164583 | 227 |
| 281 | iso_pu_bacteria | 2721755514 | 2722840753 | 227 |
| 282 | iso_pu_bacteria | 2721755810 | 2724045076 | 227 |
| 283 | iso_pu_bacteria | 2724679232 | 2725952708 | 227 |
| 284 | iso_pu_bacteria | 2728369365 | 2730164891 | 227 |
| 285 | iso_pu_bacteria | 2728369397 | 2730298828 | 227 |
| 286 | iso_pu_bacteria | 2751185821 | 2753461852 | 227 |
| 287 | iso_pu_bacteria | 2791355091 | 2792620157 | 227 |
| 288 | iso_pu_bacteria | 2791355092 | 2792626423 | 227 |
| 289 | iso_pu_bacteria | 2791355094 | 2792639371 | 227 |
| 290 | iso_pu_bacteria | 2791355260 | 2793320520 | 227 |
| 291 | iso_pu_bacteria | 2791355261 | 2793330440 | 227 |
| 292 | iso_pu_bacteria | 2791355263 | 2793344286 | 227 |
| 293 | iso_pu_bacteria | 2791355264 | 2793348728 | 227 |
| 294 | iso_pu_bacteria | 2838035591 | 2838038238 | 227 |
| 295 | iso_pu_bacteria | 2838042994 | 2838043824 | 227 |
| 296 | iso_pu_bacteria | 2838661181 | 2838661885 | 227 |
| 297 | iso_pu_bacteria | 2847417321 | 2847419077 | 227 |
| 298 | iso_pu_bacteria | 2848992105 | 2848994108 | 227 |
| 299 | iso_pu_bacteria | 2855872281 | 2855876753 | 227 |
| 300 | iso_pu_bacteria | 2933016740 | 2933018390 | 227 |
| 301 | iso_pu_bacteria | 2936381700 | 2936383040 | 227 |
| 302 | iso_pu_bacteria | 2996893221 | 2996898686 | 227 |
| 303 | iso_pu_bacteria | 3005409236 | 3005414987 | 227 |
| 304 | iso_pu_bacteria | 643692032 | 643825963 | 227 |
| 305 | iso_pu_bacteria | 8005301065 | 8005302961 | 227 |
| 306 | iso_pu_bacteria | 8005382845 | 8005386502 | 227 |
| 307 | iso_pu_bacteria | 8005395548 | 8005396280 | 227 |
| 308 | iso_pu_bacteria | 8005688590 | 8005692270 | 227 |
| 309 | iso_pu_bacteria | 8018127388 | 8018133926 | 227 |
| 310 | 3300025292 | Ga0209676_1007095 | Ga0209676_10070953 | 228 |
| 311 | 3300025297 | Ga0209758_1000418 | Ga0209758_10004185 | 228 |
| 312 | 3300025298 | Ga0209050_1009223 | Ga0209050_10092232 | 228 |
| 313 | 3300025303 | Ga0209051_1001051 | Ga0209051_10010516 | 228 |
| 314 | 3300025304 | Ga0209257_1007766 | Ga0209257_10077665 | 228 |
| 315 | 3300048928 | Ga0496125_0000282 | Ga0496125_0000282_70081_70899 | 228 |
| 316 | 3300048929 | Ga0496126_0000703 | Ga0496126_0000703_46471_47286 | 228 |
| 317 | iso_pu_bacteria | 2509276033 | 2509446848 | 228 |
| 318 | iso_pu_bacteria | 2510065019 | 2510133800 | 228 |
| 319 | iso_pu_bacteria | 2510461076 | 2510895229 | 228 |
| 320 | iso_pu_bacteria | 2510917028 | 2511181650 | 228 |
| 321 | iso_pu_bacteria | 2510917030 | 2511194381 | 228 |
| 322 | iso_pu_bacteria | 2513237084 | 2513574159 | 228 |
| 323 | iso_pu_bacteria | 2513237085 | 2513576805 | 228 |
| 324 | iso_pu_bacteria | 2513237088 | 2513594686 | 228 |
| 325 | iso_pu_bacteria | 2513237093 | 2513629549 | 228 |
| 326 | iso_pu_bacteria | 2513237103 | 2513708190 | 228 |
| 327 | iso_pu_bacteria | 2513237138 | 2513864754 | 228 |
| 328 | iso_pu_bacteria | 2513237162 | 2514020151 | 228 |
| 329 | iso_pu_bacteria | 2515075009 | 2515112846 | 228 |
| 330 | iso_pu_bacteria | 2515154113 | 2515636467 | 228 |
| 331 | iso_pu_bacteria | 2515154114 | 2515640817 | 228 |
| 332 | iso_pu_bacteria | 2515154116 | 2515655499 | 228 |
| 333 | iso_pu_bacteria | 2515154134 | 2515739343 | 228 |
| 334 | iso_pu_bacteria | 2516653077 | 2517036553 | 228 |
| 335 | iso_pu_bacteria | 2516653085 | 2517076923 | 228 |
| 336 | iso_pu_bacteria | 2517093000 | 2517095685 | 228 |
| 337 | iso_pu_bacteria | 2517287029 | 2517407249 | 228 |
| 338 | iso_pu_bacteria | 2529292951 | 2530646157 | 228 |
| 339 | iso_pu_bacteria | 2582581298 | 2585222622 | 228 |
| 340 | iso_pu_bacteria | 2582581867 | 2585402116 | 228 |
| 341 | iso_pu_bacteria | 2585427526 | 2585527301 | 228 |
| 342 | iso_pu_bacteria | 2585427529 | 2585545205 | 228 |
| 343 | iso_pu_bacteria | 2585427590 | 2585821901 | 228 |
| 344 | iso_pu_bacteria | 2643221568 | 2643857660 | 228 |
| 345 | iso_pu_bacteria | 2643221599 | 2644003868 | 228 |
| 346 | iso_pu_bacteria | 2657244999 | 2657681176 | 228 |
| 347 | iso_pu_bacteria | 2718217927 | 2719386189 | 228 |
| 348 | iso_pu_bacteria | 2718217997 | 2719665997 | 228 |
| 349 | iso_pu_bacteria | 2718218199 | 2720492417 | 228 |
| 350 | iso_pu_bacteria | 2718218232 | 2720613772 | 228 |
| 351 | iso_pu_bacteria | 2718218233 | 2720620560 | 228 |
| 352 | iso_pu_bacteria | 2718218235 | 2720631985 | 228 |
| 353 | iso_pu_bacteria | 2718218269 | 2720775713 | 228 |
| 354 | iso_pu_bacteria | 2718218423 | 2721399971 | 228 |
| 355 | iso_pu_bacteria | 2721755556 | 2723027320 | 228 |
| 356 | iso_pu_bacteria | 2721755684 | 2723560939 | 228 |
| 357 | iso_pu_bacteria | 2721755685 | 2723567532 | 228 |
| 358 | iso_pu_bacteria | 2721755809 | 2724038784 | 228 |
| 359 | iso_pu_bacteria | 2721755819 | 2724090320 | 228 |
| 360 | iso_pu_bacteria | 2721755822 | 2724104797 | 228 |
| 361 | iso_pu_bacteria | 2721755823 | 2724110598 | 228 |
| 362 | iso_pu_bacteria | 2728369352 | 2730108256 | 228 |
| 363 | iso_pu_bacteria | 2738541333 | 2739032695 | 228 |
| 364 | iso_pu_bacteria | 2765235942 | 2766065722 | 228 |
| 365 | iso_pu_bacteria | 2791355256 | 2793298714 | 228 |
| 366 | iso_pu_bacteria | 2791355259 | 2793314684 | 228 |
| 367 | iso_pu_bacteria | 2791355262 | 2793338337 | 228 |
| 368 | iso_pu_bacteria | 2791355265 | 2793351981 | 228 |
| 369 | iso_pu_bacteria | 2791355267 | 2793370334 | 228 |
| 370 | iso_pu_bacteria | 2802429268 | 2804752375 | 228 |
| 371 | iso_pu_bacteria | 2802429605 | 2805931004 | 228 |
| 372 | iso_pu_bacteria | 2802429606 | 2805937981 | 228 |
| 373 | iso_pu_bacteria | 2802429633 | 2806043675 | 228 |
| 374 | iso_pu_bacteria | 2802429634 | 2806050394 | 228 |
| 375 | iso_pu_bacteria | 2802429635 | 2806057211 | 228 |
| 376 | iso_pu_bacteria | 2802429636 | 2806064592 | 228 |
| 377 | iso_pu_bacteria | 2802429637 | 2806071859 | 228 |
| 378 | iso_pu_bacteria | 2838016132 | 2838017815 | 228 |
| 379 | iso_pu_bacteria | 2838048938 | 2838051893 | 228 |
| 380 | iso_pu_bacteria | 2838061910 | 2838068487 | 228 |
| 381 | iso_pu_bacteria | 2838068647 | 2838070305 | 228 |
| 382 | iso_pu_bacteria | 2838668709 | 2838674157 | 228 |
| 383 | iso_pu_bacteria | 2838680041 | 2838681756 | 228 |
| 384 | iso_pu_bacteria | 2838686498 | 2838687197 | 228 |
| 385 | iso_pu_bacteria | 2838694306 | 2838696328 | 228 |
| 386 | iso_pu_bacteria | 2838729681 | 2838729831 | 228 |
| 387 | iso_pu_bacteria | 2838742623 | 2838743154 | 228 |
| 388 | iso_pu_bacteria | 2841851746 | 2841852640 | 228 |
| 389 | iso_pu_bacteria | 2841864319 | 2841869941 | 228 |
| 390 | iso_pu_bacteria | 2842118031 | 2842118884 | 228 |
| 391 | iso_pu_bacteria | 2842156927 | 2842157900 | 228 |
| 392 | iso_pu_bacteria | 2842163707 | 2842167551 | 228 |
| 393 | iso_pu_bacteria | 2842180545 | 2842181519 | 228 |
| 394 | iso_pu_bacteria | 2842192696 | 2842198420 | 228 |
| 395 | iso_pu_bacteria | 2842205361 | 2842205635 | 228 |
| 396 | iso_pu_bacteria | 2842217011 | 2842217783 | 228 |
| 397 | iso_pu_bacteria | 2842229732 | 2842230430 | 228 |
| 398 | iso_pu_bacteria | 2842243621 | 2842244332 | 228 |
| 399 | iso_pu_bacteria | 2842250916 | 2842256351 | 228 |
| 400 | iso_pu_bacteria | 2842257432 | 2842257582 | 228 |
| 401 | iso_pu_bacteria | 2842264693 | 2842265647 | 228 |
| 402 | iso_pu_bacteria | 2842271015 | 2842271265 | 228 |
| 403 | iso_pu_bacteria | 2842278818 | 2842279092 | 228 |
| 404 | iso_pu_bacteria | 2842285085 | 2842285755 | 228 |
| 405 | iso_pu_bacteria | 2842311132 | 2842315071 | 228 |
| 406 | iso_pu_bacteria | 2842341865 | 2842346312 | 228 |
| 407 | iso_pu_bacteria | 2842363717 | 2842369109 | 228 |
| 408 | iso_pu_bacteria | 2842370503 | 2842372323 | 228 |
| 409 | iso_pu_bacteria | 2842384541 | 2842385394 | 228 |
| 410 | iso_pu_bacteria | 2842395702 | 2842401924 | 228 |
| 411 | iso_pu_bacteria | 2842402390 | 2842403115 | 228 |
| 412 | iso_pu_bacteria | 2842409023 | 2842409512 | 228 |
| 413 | iso_pu_bacteria | 2842415677 | 2842416165 | 228 |
| 414 | iso_pu_bacteria | 2842422224 | 2842423919 | 228 |
| 415 | iso_pu_bacteria | 2842447887 | 2842452936 | 228 |
| 416 | iso_pu_bacteria | 2842495871 | 2842496983 | 228 |
| 417 | iso_pu_bacteria | 2844454524 | 2844458563 | 228 |
| 418 | iso_pu_bacteria | 2857516855 | 2857517584 | 228 |
| 419 | iso_pu_bacteria | 2913295892 | 2913300847 | 228 |
| 420 | iso_pu_bacteria | 2919100787 | 2919106505 | 228 |
| 421 | iso_pu_bacteria | 2919166419 | 2919167840 | 228 |
| 422 | iso_pu_bacteria | 2923556063 | 2923558035 | 228 |
| 423 | iso_pu_bacteria | 2933570622 | 2933570701 | 228 |
| 424 | iso_pu_bacteria | 2933586486 | 2933591205 | 228 |
| 425 | iso_pu_bacteria | 2933599457 | 2933601110 | 228 |
| 426 | iso_pu_bacteria | 2935894831 | 2935900667 | 228 |
| 427 | iso_pu_bacteria | 2935901341 | 2935902100 | 228 |
| 428 | iso_pu_bacteria | 2936367885 | 2936372191 | 228 |
| 429 | iso_pu_bacteria | 2936375103 | 2936381006 | 228 |
| 430 | iso_pu_bacteria | 2978969890 | 2978974292 | 228 |
| 431 | iso_pu_bacteria | 2984587000 | 2984589634 | 228 |
| 432 | iso_pu_bacteria | 2996887358 | 2996891812 | 228 |
| 433 | iso_pu_bacteria | 3005445848 | 3005448241 | 228 |
| 434 | iso_pu_bacteria | 639633055 | 639649049 | 228 |
| 435 | iso_pu_bacteria | 8005258706 | 8005263143 | 228 |
| 436 | iso_pu_bacteria | 8005275841 | 8005280978 | 228 |
| 437 | iso_pu_bacteria | 8005282627 | 8005285149 | 228 |
| 438 | iso_pu_bacteria | 8005289223 | 8005293486 | 228 |
| 439 | iso_pu_bacteria | 8005307578 | 8005312688 | 228 |
| 440 | iso_pu_bacteria | 8005321885 | 8005326339 | 228 |
| 441 | iso_pu_bacteria | 8005376324 | 8005380777 | 228 |
| 442 | iso_pu_bacteria | 8005430974 | 8005434991 | 228 |
| 443 | iso_pu_bacteria | 8005460587 | 8005463520 | 228 |
| 444 | iso_pu_bacteria | 8005497431 | 8005500730 | 228 |
| 445 | iso_pu_bacteria | 8005542996 | 8005545257 | 228 |
| 446 | iso_pu_bacteria | 8005563573 | 8005567841 | 228 |
| 447 | iso_pu_bacteria | 8005570704 | 8005573614 | 228 |
| 448 | iso_pu_bacteria | 8005619151 | 8005622106 | 228 |
| 449 | iso_pu_bacteria | 8005626139 | 8005632412 | 228 |
| 450 | iso_pu_bacteria | 8005668836 | 8005672149 | 228 |
| 451 | iso_pu_bacteria | 8005695170 | 8005699733 | 228 |
| 452 | iso_pu_bacteria | 8018163183 | 8018166243 | 228 |
| 453 | iso_pu_bacteria | 8018176218 | 8018181474 | 228 |
| 454 | iso_pu_bacteria | 8023680758 | 8023683315 | 228 |
| 455 | iso_pu_bacteria | 8024479707 | 8024483016 | 228 |
| 456 | iso_pu_bacteria | 8024501048 | 8024503915 | 228 |
| 457 | iso_pu_bacteria | 8056375014 | 8056378364 | 228 |
| 458 | iso_pu_bacteria | 8056382006 | 8056386570 | 228 |
| 459 | iso_pu_bacteria | 8057874678 | 8057877391 | 228 |
| 460 | 3300044765 | Ga0466970_0197868 | Ga0466970_0197868_46_873 | 229 |
| 461 | 3300053140 | Ga0500573_0000259 | Ga0500573_0000259_13111_13932 | 229 |
| 462 | iso_pu_bacteria | 2508501122 | 2509111387 | 229 |
| 463 | iso_pu_bacteria | 2509276019 | 2509375674 | 229 |
| 464 | iso_pu_bacteria | 2510065057 | 2510303300 | 229 |
| 465 | iso_pu_bacteria | 2511231052 | 2511501959 | 229 |
| 466 | iso_pu_bacteria | 2512047086 | 2512533330 | 229 |
| 467 | iso_pu_bacteria | 2512875026 | 2512971115 | 229 |
| 468 | iso_pu_bacteria | 2513237086 | 2513584743 | 229 |
| 469 | iso_pu_bacteria | 2513237089 | 2513604528 | 229 |
| 470 | iso_pu_bacteria | 2513237091 | 2513615451 | 229 |
| 471 | iso_pu_bacteria | 2513237140 | 2513881239 | 229 |
| 472 | iso_pu_bacteria | 2513237143 | 2513902371 | 229 |
| 473 | iso_pu_bacteria | 2513237156 | 2513984613 | 229 |
| 474 | iso_pu_bacteria | 2513237160 | 2514007581 | 229 |
| 475 | iso_pu_bacteria | 2515154107 | 2515608749 | 229 |
| 476 | iso_pu_bacteria | 2516653046 | 2516893254 | 229 |
| 477 | iso_pu_bacteria | 2517487022 | 2517570001 | 229 |
| 478 | iso_pu_bacteria | 2524023207 | 2524448844 | 229 |
| 479 | iso_pu_bacteria | 2537561587 | 2537877728 | 229 |
| 480 | iso_pu_bacteria | 2551306084 | 2551674933 | 229 |
| 481 | iso_pu_bacteria | 2551306084 | 2551680187 | 229 |
| 482 | iso_pu_bacteria | 2551306085 | 2551684836 | 229 |
| 483 | iso_pu_bacteria | 2551306086 | 2551695934 | 229 |
| 484 | iso_pu_bacteria | 2551306087 | 2551704472 | 229 |
| 485 | iso_pu_bacteria | 2551306089 | 2551711463 | 229 |
| 486 | iso_pu_bacteria | 2551306090 | 2551720832 | 229 |
| 487 | iso_pu_bacteria | 2551306091 | 2551728684 | 229 |
| 488 | iso_pu_bacteria | 2551306092 | 2551735015 | 229 |
| 489 | iso_pu_bacteria | 2551306093 | 2551739435 | 229 |
| 490 | iso_pu_bacteria | 2554235003 | 2554247610 | 229 |
| 491 | iso_pu_bacteria | 2558860100 | 2558867990 | 229 |
| 492 | iso_pu_bacteria | 2558860242 | 2559294743 | 229 |
| 493 | iso_pu_bacteria | 2582581299 | 2585229901 | 229 |
| 494 | iso_pu_bacteria | 2582581304 | 2585254865 | 229 |
| 495 | iso_pu_bacteria | 2585427594 | 2585846824 | 229 |
| 496 | iso_pu_bacteria | 2599185210 | 2599604007 | 229 |
| 497 | iso_pu_bacteria | 2643221558 | 2643811649 | 229 |
| 498 | iso_pu_bacteria | 2643221582 | 2643919230 | 229 |
| 499 | iso_pu_bacteria | 2643221634 | 2644192607 | 229 |
| 500 | iso_pu_bacteria | 2643221643 | 2644239675 | 229 |
| 501 | iso_pu_bacteria | 2643221693 | 2644522136 | 229 |
| 502 | iso_pu_bacteria | 2738541293 | 2738804214 | 229 |
| 503 | iso_pu_bacteria | 2802428858 | 2802719496 | 229 |
| 504 | iso_pu_bacteria | 2802428859 | 2802726911 | 229 |
| 505 | iso_pu_bacteria | 2802428860 | 2802732230 | 229 |
| 506 | iso_pu_bacteria | 2802428861 | 2802739833 | 229 |
| 507 | iso_pu_bacteria | 2802428862 | 2802745339 | 229 |
| 508 | iso_pu_bacteria | 2802428863 | 2802752731 | 229 |
| 509 | iso_pu_bacteria | 2808606387 | 2808985488 | 229 |
| 510 | iso_pu_bacteria | 2818991439 | 2819559971 | 229 |
| 511 | iso_pu_bacteria | 2837678835 | 2837679770 | 229 |
| 512 | iso_pu_bacteria | 2838074704 | 2838079602 | 229 |
| 513 | iso_pu_bacteria | 2838675328 | 2838676336 | 229 |
| 514 | iso_pu_bacteria | 2838714209 | 2838715219 | 229 |
| 515 | iso_pu_bacteria | 2838719591 | 2838720981 | 229 |
| 516 | iso_pu_bacteria | 2838724970 | 2838725977 | 229 |
| 517 | iso_pu_bacteria | 2841846520 | 2841847939 | 229 |
| 518 | iso_pu_bacteria | 2841859092 | 2841859509 | 229 |
| 519 | iso_pu_bacteria | 2842124991 | 2842126031 | 229 |
| 520 | iso_pu_bacteria | 2842130223 | 2842131230 | 229 |
| 521 | iso_pu_bacteria | 2842152218 | 2842153600 | 229 |
| 522 | iso_pu_bacteria | 2842170452 | 2842171462 | 229 |
| 523 | iso_pu_bacteria | 2842175837 | 2842177220 | 229 |
| 524 | iso_pu_bacteria | 2842187318 | 2842188327 | 229 |
| 525 | iso_pu_bacteria | 2842211629 | 2842212638 | 229 |
| 526 | iso_pu_bacteria | 2842224351 | 2842225743 | 229 |
| 527 | iso_pu_bacteria | 2842515876 | 2842516294 | 229 |
| 528 | iso_pu_bacteria | 2850079185 | 2850081150 | 229 |
| 529 | iso_pu_bacteria | 2855825444 | 2855825980 | 229 |
| 530 | iso_pu_bacteria | 2855839649 | 2855841326 | 229 |
| 531 | iso_pu_bacteria | 2858800743 | 2858802307 | 229 |
| 532 | iso_pu_bacteria | 2889790730 | 2889795854 | 229 |
| 533 | iso_pu_bacteria | 2889914905 | 2889917769 | 229 |
| 534 | iso_pu_bacteria | 2896384573 | 2896389945 | 229 |
| 535 | iso_pu_bacteria | 2899792073 | 2899796306 | 229 |
| 536 | iso_pu_bacteria | 2899845264 | 2899849472 | 229 |
| 537 | iso_pu_bacteria | 2915980308 | 2915981911 | 229 |
| 538 | iso_pu_bacteria | 2915986958 | 2915991354 | 229 |
| 539 | iso_pu_bacteria | 2915993759 | 2915994372 | 229 |
| 540 | iso_pu_bacteria | 2916000859 | 2916002202 | 229 |
| 541 | iso_pu_bacteria | 2916007675 | 2916009176 | 229 |
| 542 | iso_pu_bacteria | 2916014648 | 2916018208 | 229 |
| 543 | iso_pu_bacteria | 2916021584 | 2916022727 | 229 |
| 544 | iso_pu_bacteria | 2916028427 | 2916029424 | 229 |
| 545 | iso_pu_bacteria | 2916035215 | 2916035988 | 229 |
| 546 | iso_pu_bacteria | 2916041962 | 2916042529 | 229 |
| 547 | iso_pu_bacteria | 2916048683 | 2916052269 | 229 |
| 548 | iso_pu_bacteria | 2916055098 | 2916061455 | 229 |
| 549 | iso_pu_bacteria | 2916061851 | 2916067597 | 229 |
| 550 | iso_pu_bacteria | 2916076590 | 2916080856 | 229 |
| 551 | iso_pu_bacteria | 2919114240 | 2919115311 | 229 |
| 552 | iso_pu_bacteria | 2920760137 | 2920766102 | 229 |
| 553 | iso_pu_bacteria | 2921201388 | 2921201945 | 229 |
| 554 | iso_pu_bacteria | 2921208531 | 2921210484 | 229 |
| 555 | iso_pu_bacteria | 2921237296 | 2921238983 | 229 |
| 556 | iso_pu_bacteria | 2921244191 | 2921244569 | 229 |
| 557 | iso_pu_bacteria | 2921250672 | 2921251194 | 229 |
| 558 | iso_pu_bacteria | 2921257292 | 2921262481 | 229 |
| 559 | iso_pu_bacteria | 2921263974 | 2921270815 | 229 |
| 560 | iso_pu_bacteria | 2921282425 | 2921284314 | 229 |
| 561 | iso_pu_bacteria | 2921289301 | 2921291261 | 229 |
| 562 | iso_pu_bacteria | 2921296804 | 2921300803 | 229 |
| 563 | iso_pu_bacteria | 2924144063 | 2924144444 | 229 |
| 564 | iso_pu_bacteria | 2924150972 | 2924152328 | 229 |
| 565 | iso_pu_bacteria | 2924158325 | 2924160756 | 229 |
| 566 | iso_pu_bacteria | 2924172951 | 2924173630 | 229 |
| 567 | iso_pu_bacteria | 2924179722 | 2924181191 | 229 |
| 568 | iso_pu_bacteria | 2924186466 | 2924187731 | 229 |
| 569 | iso_pu_bacteria | 2924193448 | 2924200436 | 229 |
| 570 | iso_pu_bacteria | 2924200457 | 2924206871 | 229 |
| 571 | iso_pu_bacteria | 2924207177 | 2924213965 | 229 |
| 572 | iso_pu_bacteria | 2924214083 | 2924214962 | 229 |
| 573 | iso_pu_bacteria | 2924221636 | 2924222979 | 229 |
| 574 | iso_pu_bacteria | 2924228884 | 2924229325 | 229 |
| 575 | iso_pu_bacteria | 2926754445 | 2926756357 | 229 |
| 576 | iso_pu_bacteria | 2926760298 | 2926760579 | 229 |
| 577 | iso_pu_bacteria | 2929138655 | 2929140442 | 229 |
| 578 | iso_pu_bacteria | 2933006813 | 2933008243 | 229 |
| 579 | iso_pu_bacteria | 2933011516 | 2933013064 | 229 |
| 580 | iso_pu_bacteria | 2936996657 | 2937002092 | 229 |
| 581 | iso_pu_bacteria | 2937002841 | 2937003433 | 229 |
| 582 | iso_pu_bacteria | 2937009748 | 2937014130 | 229 |
| 583 | iso_pu_bacteria | 2937016420 | 2937018625 | 229 |
| 584 | iso_pu_bacteria | 2937023124 | 2937028959 | 229 |
| 585 | iso_pu_bacteria | 2937029754 | 2937033430 | 229 |
| 586 | iso_pu_bacteria | 2937036028 | 2937038605 | 229 |
| 587 | iso_pu_bacteria | 2937042894 | 2937044353 | 229 |
| 588 | iso_pu_bacteria | 2937049772 | 2937051073 | 229 |
| 589 | iso_pu_bacteria | 2937056579 | 2937062332 | 229 |
| 590 | iso_pu_bacteria | 2937063883 | 2937065237 | 229 |
| 591 | iso_pu_bacteria | 2937071275 | 2937072407 | 229 |
| 592 | iso_pu_bacteria | 2937078374 | 2937079777 | 229 |
| 593 | iso_pu_bacteria | 2937084907 | 2937088082 | 229 |
| 594 | iso_pu_bacteria | 2937091812 | 2937097581 | 229 |
| 595 | iso_pu_bacteria | 2937098957 | 2937099528 | 229 |
| 596 | iso_pu_bacteria | 2937106411 | 2937110002 | 229 |
| 597 | iso_pu_bacteria | 2937113482 | 2937119017 | 229 |
| 598 | iso_pu_bacteria | 2937119839 | 2937126051 | 229 |
| 599 | iso_pu_bacteria | 2937126314 | 2937126844 | 229 |
| 600 | iso_pu_bacteria | 2957375807 | 2957376562 | 229 |
| 601 | iso_pu_bacteria | 2957382221 | 2957388456 | 229 |
| 602 | iso_pu_bacteria | 2957388812 | 2957394837 | 229 |
| 603 | iso_pu_bacteria | 2957395598 | 2957398283 | 229 |
| 604 | iso_pu_bacteria | 2957402308 | 2957408798 | 229 |
| 605 | iso_pu_bacteria | 2957408893 | 2957414738 | 229 |
| 606 | iso_pu_bacteria | 2957415311 | 2957416011 | 229 |
| 607 | iso_pu_bacteria | 2957422303 | 2957424207 | 229 |
| 608 | iso_pu_bacteria | 2957430029 | 2957430987 | 229 |
| 609 | iso_pu_bacteria | 2957437181 | 2957441243 | 229 |
| 610 | iso_pu_bacteria | 2957443900 | 2957444981 | 229 |
| 611 | iso_pu_bacteria | 2957450854 | 2957451404 | 229 |
| 612 | iso_pu_bacteria | 2957457609 | 2957458670 | 229 |
| 613 | iso_pu_bacteria | 2957464669 | 2957471101 | 229 |
| 614 | iso_pu_bacteria | 2957471148 | 2957472068 | 229 |
| 615 | iso_pu_bacteria | 2957478035 | 2957484437 | 229 |
| 616 | iso_pu_bacteria | 2957484790 | 2957486192 | 229 |
| 617 | iso_pu_bacteria | 2957491536 | 2957492019 | 229 |
| 618 | iso_pu_bacteria | 2957498199 | 2957503697 | 229 |
| 619 | iso_pu_bacteria | 2957505466 | 2957507114 | 229 |
| 620 | iso_pu_bacteria | 2960584000 | 2960586187 | 229 |
| 621 | iso_pu_bacteria | 2960591022 | 2960592738 | 229 |
| 622 | iso_pu_bacteria | 2960597568 | 2960598009 | 229 |
| 623 | iso_pu_bacteria | 2960603979 | 2960604775 | 229 |
| 624 | iso_pu_bacteria | 2960610863 | 2960612413 | 229 |
| 625 | iso_pu_bacteria | 2960617483 | 2960620021 | 229 |
| 626 | iso_pu_bacteria | 2960624210 | 2960629235 | 229 |
| 627 | iso_pu_bacteria | 2960631154 | 2960632856 | 229 |
| 628 | iso_pu_bacteria | 2960637947 | 2960640061 | 229 |
| 629 | iso_pu_bacteria | 2960645483 | 2960647101 | 229 |
| 630 | iso_pu_bacteria | 2960652885 | 2960655289 | 229 |
| 631 | iso_pu_bacteria | 2960660292 | 2960660857 | 229 |
| 632 | iso_pu_bacteria | 2960667422 | 2960673781 | 229 |
| 633 | iso_pu_bacteria | 2960674078 | 2960675559 | 229 |
| 634 | iso_pu_bacteria | 2960680706 | 2960681838 | 229 |
| 635 | iso_pu_bacteria | 2960687367 | 2960688007 | 229 |
| 636 | iso_pu_bacteria | 2960693952 | 2960700550 | 229 |
| 637 | iso_pu_bacteria | 2964607997 | 2964609704 | 229 |
| 638 | iso_pu_bacteria | 2964615318 | 2964616563 | 229 |
| 639 | iso_pu_bacteria | 2964621998 | 2964623732 | 229 |
| 640 | iso_pu_bacteria | 2964628898 | 2964629433 | 229 |
| 641 | iso_pu_bacteria | 2964636051 | 2964640939 | 229 |
| 642 | iso_pu_bacteria | 2964643177 | 2964649046 | 229 |
| 643 | iso_pu_bacteria | 2964649959 | 2964651794 | 229 |
| 644 | iso_pu_bacteria | 2964656573 | 2964661018 | 229 |
| 645 | iso_pu_bacteria | 2964663802 | 2964670789 | 229 |
| 646 | iso_pu_bacteria | 2964670856 | 2964673622 | 229 |
| 647 | iso_pu_bacteria | 2964678106 | 2964680024 | 229 |
| 648 | iso_pu_bacteria | 2964685014 | 2964686269 | 229 |
| 649 | iso_pu_bacteria | 2964691889 | 2964693088 | 229 |
| 650 | iso_pu_bacteria | 2964698721 | 2964699848 | 229 |
| 651 | iso_pu_bacteria | 2964705432 | 2964706093 | 229 |
| 652 | iso_pu_bacteria | 2964712639 | 2964713945 | 229 |
| 653 | iso_pu_bacteria | 2964719344 | 2964721500 | 229 |
| 654 | iso_pu_bacteria | 2967664464 | 2967665508 | 229 |
| 655 | iso_pu_bacteria | 2967671571 | 2967671982 | 229 |
| 656 | iso_pu_bacteria | 2967678726 | 2967681864 | 229 |
| 657 | iso_pu_bacteria | 2967686174 | 2967691679 | 229 |
| 658 | iso_pu_bacteria | 2967693043 | 2967695262 | 229 |
| 659 | iso_pu_bacteria | 2967699805 | 2967701918 | 229 |
| 660 | iso_pu_bacteria | 2967706974 | 2967708231 | 229 |
| 661 | iso_pu_bacteria | 2967714385 | 2967716654 | 229 |
| 662 | iso_pu_bacteria | 2967721400 | 2967721655 | 229 |
| 663 | iso_pu_bacteria | 2967728569 | 2967734962 | 229 |
| 664 | iso_pu_bacteria | 2967735183 | 2967736853 | 229 |
| 665 | iso_pu_bacteria | 2967742019 | 2967744349 | 229 |
| 666 | iso_pu_bacteria | 2967748971 | 2967753310 | 229 |
| 667 | iso_pu_bacteria | 2967755722 | 2967758736 | 229 |
| 668 | iso_pu_bacteria | 2967762386 | 2967765372 | 229 |
| 669 | iso_pu_bacteria | 2967769361 | 2967770964 | 229 |
| 670 | iso_pu_bacteria | 2967775926 | 2967778384 | 229 |
| 671 | iso_pu_bacteria | 2970019648 | 2970026526 | 229 |
| 672 | iso_pu_bacteria | 2970026789 | 2970031033 | 229 |
| 673 | iso_pu_bacteria | 2970033650 | 2970039713 | 229 |
| 674 | iso_pu_bacteria | 2970040964 | 2970041321 | 229 |
| 675 | iso_pu_bacteria | 2970047711 | 2970053627 | 229 |
| 676 | iso_pu_bacteria | 2970054988 | 2970061209 | 229 |
| 677 | iso_pu_bacteria | 2970061556 | 2970063307 | 229 |
| 678 | iso_pu_bacteria | 2970068827 | 2970073008 | 229 |
| 679 | iso_pu_bacteria | 2970076120 | 2970082721 | 229 |
| 680 | iso_pu_bacteria | 2970082768 | 2970083733 | 229 |
| 681 | iso_pu_bacteria | 2970088815 | 2970089290 | 229 |
| 682 | iso_pu_bacteria | 2970095765 | 2970096769 | 229 |
| 683 | iso_pu_bacteria | 2970102677 | 2970107486 | 229 |
| 684 | iso_pu_bacteria | 2970109326 | 2970116095 | 229 |
| 685 | iso_pu_bacteria | 2970116247 | 2970122173 | 229 |
| 686 | iso_pu_bacteria | 2970122695 | 2970122959 | 229 |
| 687 | iso_pu_bacteria | 2970129317 | 2970131676 | 229 |
| 688 | iso_pu_bacteria | 2970136068 | 2970138449 | 229 |
| 689 | iso_pu_bacteria | 2970143518 | 2970144121 | 229 |
| 690 | iso_pu_bacteria | 2970149975 | 2970150821 | 229 |
| 691 | iso_pu_bacteria | 2970164137 | 2970170385 | 229 |
| 692 | iso_pu_bacteria | 2970177841 | 2970178384 | 229 |
| 693 | iso_pu_bacteria | 2970184632 | 2970186169 | 229 |
| 694 | iso_pu_bacteria | 2970191845 | 2970192271 | 229 |
| 695 | iso_pu_bacteria | 2977516862 | 2977522410 | 229 |
| 696 | iso_pu_bacteria | 2977523885 | 2977524373 | 229 |
| 697 | iso_pu_bacteria | 2977530762 | 2977531648 | 229 |
| 698 | iso_pu_bacteria | 2977537788 | 2977544334 | 229 |
| 699 | iso_pu_bacteria | 2977544691 | 2977549063 | 229 |
| 700 | iso_pu_bacteria | 2977551784 | 2977554425 | 229 |
| 701 | iso_pu_bacteria | 2977558990 | 2977560894 | 229 |
| 702 | iso_pu_bacteria | 2977565890 | 2977572654 | 229 |
| 703 | iso_pu_bacteria | 2977572785 | 2977579610 | 229 |
| 704 | iso_pu_bacteria | 2977579622 | 2977580166 | 229 |
| 705 | iso_pu_bacteria | 2979089926 | 2979094141 | 229 |
| 706 | iso_pu_bacteria | 2979095461 | 2979098478 | 229 |
| 707 | iso_pu_bacteria | 2979100975 | 2979106095 | 229 |
| 708 | iso_pu_bacteria | 2984509177 | 2984512116 | 229 |
| 709 | iso_pu_bacteria | 2984518228 | 2984521523 | 229 |
| 710 | iso_pu_bacteria | 2984537506 | 2984540817 | 229 |
| 711 | iso_pu_bacteria | 2984601300 | 2984603085 | 229 |
| 712 | iso_pu_bacteria | 3005452660 | 3005454349 | 229 |
| 713 | iso_pu_bacteria | 648276728 | 648741750 | 229 |
| 714 | iso_pu_bacteria | 650716007 | 650739993 | 229 |
| 715 | iso_pu_bacteria | 8003570095 | 8003570992 | 229 |
| 716 | iso_pu_bacteria | 8003992118 | 8003993835 | 229 |
| 717 | iso_pu_bacteria | 8003999396 | 8004001372 | 229 |
| 718 | iso_pu_bacteria | 8054460903 | 8054462316 | 229 |
| 719 | 3300049570 | Ga0501033_0000167 | Ga0501033_0000167_7258_8199 | 230 |
| 720 | 3300049744 | Ga0501083_0092066 | Ga0501083_0092066_972_1787 | 230 |
| 721 | 3300049776 | Ga0501280_000582 | Ga0501280_000582_4277_5191 | 230 |
| 722 | 3300049822 | Ga0501035_0006797 | Ga0501035_0006797_5716_6657 | 230 |
| 723 | iso_pu_bacteria | 2599185156 | 2599331571 | 230 |
| 724 | iso_pu_bacteria | 2599185352 | 2600193102 | 230 |
| 725 | iso_pu_bacteria | 2643221557 | 2643803601 | 230 |
| 726 | iso_pu_bacteria | 2643221610 | 2644067569 | 230 |
| 727 | iso_pu_bacteria | 2643221618 | 2644107716 | 230 |
| 728 | iso_pu_bacteria | 2643221626 | 2644148613 | 230 |
| 729 | iso_pu_bacteria | 2643221655 | 2644309110 | 230 |
| 730 | iso_pu_bacteria | 2643221659 | 2644332937 | 230 |
| 731 | iso_pu_bacteria | 2643221668 | 2644375248 | 230 |
| 732 | iso_pu_bacteria | 2643221675 | 2644418622 | 230 |
| 733 | iso_pu_bacteria | 2643221680 | 2644451989 | 230 |
| 734 | iso_pu_bacteria | 2643221698 | 2644545891 | 230 |
| 735 | iso_pu_bacteria | 2643221712 | 2644615052 | 230 |
| 736 | iso_pu_bacteria | 2643221723 | 2644676588 | 230 |
| 737 | iso_pu_bacteria | 2643221726 | 2644690751 | 230 |
| 738 | iso_pu_bacteria | 2842922631 | 2842923969 | 230 |
| 739 | iso_pu_bacteria | 2844163670 | 2844167571 | 230 |
| 740 | iso_pu_bacteria | 2891373044 | 2891373151 | 230 |
| 741 | iso_pu_bacteria | 2920822456 | 2920824711 | 230 |
| 742 | iso_pu_bacteria | 2941499720 | 2941504987 | 230 |
| 743 | iso_pu_bacteria | 2989349275 | 2989349409 | 230 |
| 744 | iso_pu_bacteria | 2989771324 | 2989773853 | 230 |
| 745 | iso_pu_bacteria | 8056875544 | 8056877773 | 230 |
| 746 | 3300025299 | Ga0209256_1003768 | Ga0209256_100376811 | 231 |
| 747 | 3300042007 | Ga0439449_0015007 | Ga0439449_0015007_238_1059 | 231 |
| 748 | iso_pu_bacteria | 2510917026 | 2511171678 | 231 |
| 749 | iso_pu_bacteria | 2513237159 | 2513997076 | 231 |
| 750 | iso_pu_bacteria | 2582581283 | 2585166120 | 231 |
| 751 | iso_pu_bacteria | 2582581306 | 2585267675 | 231 |
| 752 | iso_pu_bacteria | 2582581865 | 2585386734 | 231 |
| 753 | iso_pu_bacteria | 2582581866 | 2585393038 | 231 |
| 754 | iso_pu_bacteria | 2585427633 | 2585996018 | 231 |
| 755 | iso_pu_bacteria | 2585427634 | 2586000622 | 231 |
| 756 | iso_pu_bacteria | 2643221607 | 2644050748 | 231 |
| 757 | iso_pu_bacteria | 2643221636 | 2644205222 | 231 |
| 758 | iso_pu_bacteria | 2643221637 | 2644210235 | 231 |
| 759 | iso_pu_bacteria | 2643221686 | 2644483666 | 231 |
| 760 | iso_pu_bacteria | 2643221688 | 2644491791 | 231 |
| 761 | iso_pu_bacteria | 2643221689 | 2644501337 | 231 |
| 762 | iso_pu_bacteria | 2643221718 | 2644653787 | 231 |
| 763 | iso_pu_bacteria | 2837651117 | 2837652182 | 231 |
| 764 | iso_pu_bacteria | 2842521101 | 2842522682 | 231 |
| 765 | iso_pu_bacteria | 2919171160 | 2919174971 | 231 |
| 766 | iso_pu_bacteria | 8054558443 | 8054560250 | 231 |
| 767 | 3300002739 | JGI25158J39367_1000764 | JGI25158J39367_10007645 | 232 |
| 768 | 3300002773 | JGI25152J39213_1004071 | JGI25152J39213_10040716 | 232 |
| 769 | 3300002774 | JGI25150J39212_1005593 | JGI25150J39212_10055931 | 232 |
| 770 | 3300002987 | JGI25159J45721_1000199 | JGI25159J45721_100019916 | 232 |
| 771 | 3300003215 | JGI25153J46596_10005215 | JGI25153J46596_100052152 | 232 |
| 772 | 3300003215 | JGI25153J46596_10008879 | JGI25153J46596_100088792 | 232 |
| 773 | 3300003374 | JGI25161J50226_1000207 | JGI25161J50226_100020745 | 232 |
| 774 | 3300003771 | Ga0055526_1003679 | Ga0055526_10036792 | 232 |
| 775 | 3300003790 | Ga0055528_1019378 | Ga0055528_10193784 | 232 |
| 776 | 3300003792 | Ga0055540_1012253 | Ga0055540_10122535 | 232 |
| 777 | 3300004625 | Ga0055543_1000053 | Ga0055543_100005329 | 232 |
| 778 | 3300005353 | Ga0070669_100215989 | Ga0070669_1002159892 | 232 |
| 779 | 3300021320 | Ga0214544_1001682 | Ga0214544_100168212 | 232 |
| 780 | 3300021321 | Ga0214542_1001614 | Ga0214542_100161411 | 232 |
| 781 | 3300021327 | Ga0214543_1001395 | Ga0214543_100139511 | 232 |
| 782 | 3300025208 | Ga0209436_100085 | Ga0209436_10008517 | 232 |
| 783 | 3300025245 | Ga0207425_1001564 | Ga0207425_10015647 | 232 |
| 784 | 3300025258 | Ga0209129_1002960 | Ga0209129_10029608 | 232 |
| 785 | 3300025273 | Ga0209673_1003537 | Ga0209673_10035373 | 232 |
| 786 | 3300025284 | Ga0209130_1000081 | Ga0209130_100008159 | 232 |
| 787 | 3300025294 | Ga0209025_1025145 | Ga0209025_10251454 | 232 |
| 788 | 3300025295 | Ga0209564_1000260 | Ga0209564_100026080 | 232 |
| 789 | 3300025297 | Ga0209758_1001270 | Ga0209758_100127012 | 232 |
| 790 | 3300025297 | Ga0209758_1001756 | Ga0209758_100175620 | 232 |
| 791 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008539 | 232 |
| 792 | 3300025304 | Ga0209257_1036739 | Ga0209257_10367393 | 232 |
| 793 | 3300025923 | Ga0207681_10140175 | Ga0207681_101401753 | 232 |
| 794 | 3300028379 | Ga0268266_10197077 | Ga0268266_101970772 | 232 |
| 795 | 3300041413 | Ga0439465_0011462 | Ga0439465_0011462_910_1725 | 232 |
| 796 | 3300048924 | Ga0496121_0009399 | Ga0496121_0009399_6505_7320 | 232 |
| 797 | 3300048927 | Ga0496124_0049824 | Ga0496124_0049824_1591_2406 | 232 |
| 798 | 3300048928 | Ga0496125_0041019 | Ga0496125_0041019_186_1001 | 232 |
| 799 | 3300049571 | Ga0501034_0002538 | Ga0501034_0002538_17540_18367 | 232 |
| 800 | 3300053156 | Ga0500622_0001146 | Ga0500622_0001146_14428_15243 | 232 |
| 801 | iso_pu_bacteria | 2510917022 | 2511135221 | 232 |
| 802 | iso_pu_bacteria | 2524023209 | 2524460169 | 232 |
| 803 | iso_pu_bacteria | 2582581307 | 2585270958 | 232 |
| 804 | iso_pu_bacteria | 2582581308 | 2585277307 | 232 |
| 805 | iso_pu_bacteria | 2585427527 | 2585533958 | 232 |
| 806 | iso_pu_bacteria | 2585427530 | 2585552191 | 232 |
| 807 | iso_pu_bacteria | 2585427531 | 2585558682 | 232 |
| 808 | iso_pu_bacteria | 2585427609 | 2585904348 | 232 |
| 809 | iso_pu_bacteria | 2585428125 | 2587980535 | 232 |
| 810 | iso_pu_bacteria | 2599185236 | 2599720972 | 232 |
| 811 | iso_pu_bacteria | 2600254933 | 2600375710 | 232 |
| 812 | iso_pu_bacteria | 2615840626 | 2616308686 | 232 |
| 813 | iso_pu_bacteria | 2667528174 | 2671111617 | 232 |
| 814 | iso_pu_bacteria | 2818991453 | 2819637805 | 232 |
| 815 | iso_pu_bacteria | 2818991461 | 2819684743 | 232 |
| 816 | iso_pu_bacteria | 2821123053 | 2821129486 | 232 |
| 817 | iso_pu_bacteria | 2838736955 | 2838738482 | 232 |
| 818 | iso_pu_bacteria | 2841840854 | 2841841149 | 232 |
| 819 | iso_pu_bacteria | 2842140634 | 2842140927 | 232 |
| 820 | iso_pu_bacteria | 2842298080 | 2842301929 | 232 |
| 821 | iso_pu_bacteria | 2842357229 | 2842357605 | 232 |
| 822 | iso_pu_bacteria | 2842509118 | 2842511321 | 232 |
| 823 | iso_pu_bacteria | 2919408235 | 2919411588 | 232 |
| 824 | iso_pu_bacteria | 8005484373 | 8005485251 | 232 |
| 825 | iso_pu_bacteria | 8018150411 | 8018155577 | 232 |
| 826 | iso_pu_bacteria | 8046767195 | 8046770427 | 232 |
| 827 | iso_pu_bacteria | 8057575449 | 8057575932 | 232 |
| 828 | 3300003320 | rootH2_10150379 | rootH2_101503792 | 233 |
| 829 | 3300003856 | Ga0058692_1000350 | Ga0058692_10003507 | 233 |
| 830 | 3300003856 | Ga0058692_1006447 | Ga0058692_10064475 | 233 |
| 831 | 3300006051 | Ga0075364_10224605 | Ga0075364_102246052 | 233 |
| 832 | 3300006178 | Ga0075367_10014267 | Ga0075367_100142673 | 233 |
| 833 | 3300006178 | Ga0075367_10277944 | Ga0075367_102779442 | 233 |
| 834 | 3300006186 | Ga0075369_10014994 | Ga0075369_100149942 | 233 |
| 835 | 3300006948 | Ga0099826_10012274 | Ga0099826_100122744 | 233 |
| 836 | 3300009148 | Ga0105243_10023405 | Ga0105243_100234055 | 233 |
| 837 | 3300013100 | Ga0157373_10007245 | Ga0157373_100072455 | 233 |
| 838 | 3300013102 | Ga0157371_10000015 | Ga0157371_1000001546 | 233 |
| 839 | 3300013104 | Ga0157370_10000402 | Ga0157370_1000040218 | 233 |
| 840 | 3300021327 | Ga0214543_1000078 | Ga0214543_100007814 | 233 |
| 841 | 3300025272 | Ga0209455_1014550 | Ga0209455_10145501 | 233 |
| 842 | 3300025294 | Ga0209025_1000094 | Ga0209025_100009451 | 233 |
| 843 | 3300027312 | Ga0209371_1000021 | Ga0209371_1000021150 | 233 |
| 844 | 3300027312 | Ga0209371_1000229 | Ga0209371_100022912 | 233 |
| 845 | 3300027666 | Ga0209282_1054726 | Ga0209282_10547261 | 233 |
| 846 | 3300027866 | Ga0209813_10033758 | Ga0209813_100337582 | 233 |
| 847 | 3300030500 | Ga0268256_1000020 | Ga0268256_1000020156 | 233 |
| 848 | 3300030500 | Ga0268256_1003171 | Ga0268256_10031715 | 233 |
| 849 | 3300030744 | Ga0316181_1097185 | Ga0316181_10971852 | 233 |
| 850 | 3300047470 | Ga0495681_0005741 | Ga0495681_0005741_2473_3291 | 233 |
| 851 | 3300048921 | Ga0496118_0000355 | Ga0496118_0000355_5048_5866 | 233 |
| 852 | 3300048925 | Ga0496122_0012544 | Ga0496122_0012544_6415_7233 | 233 |
| 853 | 3300050490 | nmdc:mga03n38_1786_c1 | nmdc:mga03n38_1786_c1_990_1808 | 233 |
| 854 | 3300050491 | nmdc:mga00v17_219758_c1 | nmdc:mga00v17_219758_c1_156_974 | 233 |
| 855 | 3300050491 | nmdc:mga00v17_6_c1 | nmdc:mga00v17_6_c1_72100_72918 | 233 |
| 856 | 3300050492 | nmdc:mga0yw44_72132_c1 | nmdc:mga0yw44_72132_c1_672_1490 | 233 |
| 857 | 3300050494 | nmdc:mga06z11_55161_c1 | nmdc:mga06z11_55161_c1_306_1124 | 233 |
| 858 | 3300050495 | nmdc:mga04h51_23321_c1 | nmdc:mga04h51_23321_c1_346_1164 | 233 |
| 859 | 3300050496 | nmdc:mga07m45_161522_c1 | nmdc:mga07m45_161522_c1_73_891 | 233 |
| 860 | 3300050516 | nmdc:mga0sz30_12802_c1 | nmdc:mga0sz30_12802_c1_342_1160 | 233 |
| 861 | 3300050516 | nmdc:mga0sz30_215_c2 | nmdc:mga0sz30_215_c2_10335_11153 | 233 |
| 862 | 3300053137 | Ga0500561_0000246 | Ga0500561_0000246_6710_7528 | 233 |
| 863 | 3300002987 | JGI25159J45721_1000078 | JGI25159J45721_100007824 | 234 |
| 864 | 3300003354 | JGI25160J50197_1000216 | JGI25160J50197_100021626 | 234 |
| 865 | 3300003374 | JGI25161J50226_1000412 | JGI25161J50226_10004129 | 234 |
| 866 | 3300003771 | Ga0055526_1000594 | Ga0055526_10005943 | 234 |
| 867 | 3300003775 | Ga0055524_1001754 | Ga0055524_100175412 | 234 |
| 868 | 3300004625 | Ga0055543_1000301 | Ga0055543_100030124 | 234 |
| 869 | 3300005262 | Ga0065165_1000717 | Ga0065165_100071726 | 234 |
| 870 | 3300005262 | Ga0065165_1005533 | Ga0065165_10055335 | 234 |
| 871 | 3300006177 | Ga0075362_10094396 | Ga0075362_100943962 | 234 |
| 872 | 3300013249 | Ga0171463_1003 | Ga0171463_1003650 | 234 |
| 873 | 3300015690 | Ga0183363_1047 | Ga0183363_104732 | 234 |
| 874 | 3300025208 | Ga0209436_103034 | Ga0209436_1030343 | 234 |
| 875 | 3300025263 | Ga0209565_1020981 | Ga0209565_10209812 | 234 |
| 876 | 3300025284 | Ga0209130_1000029 | Ga0209130_1000029273 | 234 |
| 877 | 3300025292 | Ga0209676_1005409 | Ga0209676_100540911 | 234 |
| 878 | 3300025294 | Ga0209025_1000119 | Ga0209025_100011998 | 234 |
| 879 | 3300025294 | Ga0209025_1000959 | Ga0209025_100095919 | 234 |
| 880 | 3300025294 | Ga0209025_1030438 | Ga0209025_10304382 | 234 |
| 881 | 3300025294 | Ga0209025_1046039 | Ga0209025_10460392 | 234 |
| 882 | 3300025295 | Ga0209564_1000278 | Ga0209564_100027895 | 234 |
| 883 | 3300025298 | Ga0209050_1030063 | Ga0209050_10300633 | 234 |
| 884 | 3300025299 | Ga0209256_1000042 | Ga0209256_100004213 | 234 |
| 885 | 3300025299 | Ga0209256_1003234 | Ga0209256_10032345 | 234 |
| 886 | 3300025302 | Ga0207426_1000074 | Ga0207426_100007425 | 234 |
| 887 | 3300025304 | Ga0209257_1006328 | Ga0209257_100632812 | 234 |
| 888 | 3300025304 | Ga0209257_1024647 | Ga0209257_10246472 | 234 |
| 889 | 3300028794 | Ga0307515_10000023 | Ga0307515_10000023301 | 234 |
| 890 | 3300028794 | Ga0307515_10013391 | Ga0307515_1001339117 | 234 |
| 891 | 3300031911 | Ga0307412_10029449 | Ga0307412_100294494 | 234 |
| 892 | 3300041406 | Ga0439439_0052844 | Ga0439439_0052844_43_876 | 234 |
| 893 | 3300046558 | Ga0495633_0147035 | Ga0495633_0147035_45_878 | 234 |
| 894 | 3300048920 | Ga0496117_0006313 | Ga0496117_0006313_6300_7130 | 234 |
| 895 | 3300048925 | Ga0496122_0000525 | Ga0496122_0000525_29951_30781 | 234 |
| 896 | 3300048926 | Ga0496123_0001014 | Ga0496123_0001014_6562_7392 | 234 |
| 897 | 3300048928 | Ga0496125_0002081 | Ga0496125_0002081_11528_12358 | 234 |
| 898 | 3300048929 | Ga0496126_0189716 | Ga0496126_0189716_619_1449 | 234 |
| 899 | 3300049570 | Ga0501033_0058254 | Ga0501033_0058254_699_1538 | 234 |
| 900 | 3300049573 | Ga0501037_0128592 | Ga0501037_0128592_583_1413 | 234 |
| 901 | 3300049579 | Ga0501043_0027267 | Ga0501043_0027267_1698_2528 | 234 |
| 902 | 3300049823 | Ga0501044_0263690 | Ga0501044_0263690_425_1255 | 234 |
| 903 | iso_pu_bacteria | 2643221580 | 2643909757 | 234 |
| 904 | 3300006038 | Ga0075365_10040694 | Ga0075365_100406943 | 235 |
| 905 | 3300005548 | Ga0070665_100543480 | Ga0070665_1005434801 | 236 |
| 906 | 3300006946 | Ga0079104_1000610 | Ga0079104_100061011 | 236 |
| 907 | 3300025206 | Ga0209435_100012 | Ga0209435_100012165 | 236 |
| 908 | 3300025246 | Ga0209646_1000026 | Ga0209646_1000026165 | 236 |
| 909 | 3300025250 | Ga0209026_1000014 | Ga0209026_1000014165 | 236 |
| 910 | 3300025256 | Ga0209759_1000012 | Ga0209759_1000012165 | 236 |
| 911 | 3300027111 | Ga0209281_1000036 | Ga0209281_1000036270 | 236 |
| 912 | 3300027111 | Ga0209281_1000047 | Ga0209281_1000047212 | 236 |
| 913 | 3300028379 | Ga0268266_10397157 | Ga0268266_103971572 | 236 |
| 914 | 3300047472 | Ga0495686_0000796 | Ga0495686_0000796_3478_4305 | 236 |
| 915 | 3300048913 | Ga0496110_0370165 | Ga0496110_0370165_448_1275 | 236 |
| 916 | 3300048924 | Ga0496121_0043020 | Ga0496121_0043020_38_865 | 236 |
| 917 | 3300048925 | Ga0496122_0000369 | Ga0496122_0000369_91832_92659 | 236 |
| 918 | 3300048925 | Ga0496122_0024409 | Ga0496122_0024409_2944_3771 | 236 |
| 919 | 3300048926 | Ga0496123_0000054 | Ga0496123_0000054_150148_150975 | 236 |
| 920 | 3300050491 | nmdc:mga00v17_264213_c1 | nmdc:mga00v17_264213_c1_150_977 | 236 |
| 921 | 3300053125 | Ga0500618_000604 | Ga0500618_000604_16654_17481 | 236 |
| 922 | iso_pu_bacteria | 2534681786 | 2535485924 | 236 |
| 923 | iso_pu_bacteria | 2854911287 | 2854916825 | 236 |
| 924 | 3300005367 | Ga0070667_100245343 | Ga0070667_1002453432 | 237 |
| 925 | 3300046507 | Ga0495606_0001613 | Ga0495606_0001613_6125_6961 | 239 |
| 926 | 3300048924 | Ga0496121_0071342 | Ga0496121_0071342_176_1012 | 239 |
| 927 | 3300050492 | nmdc:mga0yw44_33191_c1 | nmdc:mga0yw44_33191_c1_1175_2011 | 239 |
| 928 | 3300031911 | Ga0307412_10179015 | Ga0307412_101790151 | 240 |
| 929 | 3300044735 | Ga0466968_0099450 | Ga0466968_0099450_14_898 | 240 |
| 930 | iso_pu_bacteria | 2509276021 | 2509392200 | 240 |
| 931 | iso_pu_bacteria | 2600255279 | 2601608265 | 240 |
| 932 | iso_pu_bacteria | 2600255308 | 2601745039 | 240 |
| 933 | iso_pu_bacteria | 2933594066 | 2933597749 | 240 |
| 934 | iso_pu_bacteria | 2585427608 | 2585898047 | 242 |
| 935 | 3300048922 | Ga0496119_0035312 | Ga0496119_0035312_1527_2444 | 243 |
| 936 | 3300048925 | Ga0496122_0072484 | Ga0496122_0072484_1309_2226 | 243 |
| 937 | iso_pu_bacteria | 2791355266 | 2793363844 | 243 |
| 938 | iso_pu_bacteria | 2852387548 | 2852390012 | 243 |
| 939 | 3300006948 | Ga0099826_10000091 | Ga0099826_1000009137 | 244 |
| 940 | 3300027666 | Ga0209282_1000251 | Ga0209282_100025120 | 244 |
| 941 | 3300046558 | Ga0495633_0015993 | Ga0495633_0015993_500_1351 | 244 |
| 942 | 3300048921 | Ga0496118_0022010 | Ga0496118_0022010_4609_5460 | 244 |
| 943 | 3300053177 | Ga0500636_0001102 | Ga0500636_0001102_6361_7299 | 244 |
| 944 | iso_pu_bacteria | 2854896431 | 2854899349 | 245 |
| 945 | 3300048927 | Ga0496124_0010848 | Ga0496124_0010848_7322_8200 | 246 |
| 946 | 3300048929 | Ga0496126_0001019 | Ga0496126_0001019_28407_29285 | 246 |
| 947 | 3300049569 | Ga0501032_0175424 | Ga0501032_0175424_32_904 | 246 |
| 948 | iso_pu_bacteria | 2582581315 | 2585323521 | 246 |
| 949 | iso_pu_bacteria | 2818991448 | 2819608967 | 246 |
| 950 | iso_pu_bacteria | 2838022645 | 2838028590 | 246 |
| 951 | iso_pu_bacteria | 2842110456 | 2842114833 | 246 |
| 952 | iso_pu_bacteria | 2842198810 | 2842204618 | 246 |
| 953 | iso_pu_bacteria | 2842304105 | 2842304893 | 246 |
| 954 | iso_pu_bacteria | 2854916844 | 2854917962 | 246 |
| 955 | iso_pu_bacteria | 8005556819 | 8005557164 | 246 |
| 956 | 3300050496 | nmdc:mga07m45_176094_c1 | nmdc:mga07m45_176094_c1_29_889 | 247 |
| 957 | 3300053177 | Ga0500636_0000153 | Ga0500636_0000153_9451_10335 | 247 |
| 958 | iso_pu_bacteria | 2838701080 | 2838706597 | 247 |
| 959 | iso_pu_bacteria | 2842146304 | 2842151332 | 247 |
| 960 | iso_pu_bacteria | 2842317721 | 2842320553 | 247 |
| 961 | iso_pu_bacteria | 2842434925 | 2842436329 | 247 |
| 962 | iso_pu_bacteria | 2842441272 | 2842442676 | 247 |
| 963 | iso_pu_bacteria | 2842462802 | 2842464137 | 247 |
| 964 | iso_pu_bacteria | 2842469257 | 2842470658 | 247 |
| 965 | iso_pu_bacteria | 2842489311 | 2842490425 | 247 |
| 966 | 3300048927 | Ga0496124_0001936 | Ga0496124_0001936_19462_20346 | 248 |
| 967 | 3300053107 | Ga0500560_006454 | Ga0500560_006454_1659_2525 | 248 |
| 968 | 3300053161 | Ga0500634_0079358 | Ga0500634_0079358_306_1172 | 248 |
| 969 | iso_pu_bacteria | 2775507266 | 2778174118 | 248 |
| 970 | iso_pu_bacteria | 2838707686 | 2838710433 | 248 |
| 971 | iso_pu_bacteria | 2842077413 | 2842078607 | 248 |
| 972 | iso_pu_bacteria | 2842237096 | 2842239845 | 248 |
| 973 | iso_pu_bacteria | 2842291075 | 2842292269 | 248 |
| 974 | iso_pu_bacteria | 2842377471 | 2842378666 | 248 |
| 975 | 3300042184 | Ga0450908_008115 | Ga0450908_008115_422_1357 | 249 |
| 976 | 3300048907 | Ga0496104_0200879 | Ga0496104_0200879_840_1715 | 249 |
| 977 | 3300048928 | Ga0496125_0024477 | Ga0496125_0024477_1901_2824 | 249 |
| 978 | 3300050489 | nmdc:mga03683_34891_c1 | nmdc:mga03683_34891_c1_164_1099 | 249 |
| 979 | iso_pu_bacteria | 2582581316 | 2585331656 | 249 |
| 980 | iso_pu_bacteria | 2615840698 | 2616557010 | 249 |
| 981 | iso_pu_bacteria | 2617270742 | 2617385782 | 250 |
| 982 | 3300048916 | Ga0496113_0076669 | Ga0496113_0076669_1112_2050 | 251 |
| 983 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1076255_1077193 | 251 |
| 984 | 3300048923 | Ga0496120_0000941 | Ga0496120_0000941_26142_27080 | 251 |
| 985 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_382708_383646 | 251 |
| 986 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_386439_387377 | 251 |
| 987 | 3300048927 | Ga0496124_0075919 | Ga0496124_0075919_1700_2635 | 251 |
| 988 | 3300048927 | Ga0496124_0324998 | Ga0496124_0324998_184_1077 | 251 |
| 989 | 3300041413 | Ga0439465_0003881 | Ga0439465_0003881_1810_2793 | 252 |
| 990 | 3300048929 | Ga0496126_0061193 | Ga0496126_0061193_96_995 | 252 |
| 991 | 3300002704 | JGI25155J39150_1000001 | JGI25155J39150_1000001115 | 254 |
| 992 | 3300002705 | JGI25156J39149_1000001 | JGI25156J39149_1000001217 | 254 |
| 993 | 3300002737 | JGI25162J39368_1000245 | JGI25162J39368_100024552 | 254 |
| 994 | 3300002738 | JGI25154J39366_1000011 | JGI25154J39366_1000011166 | 254 |
| 995 | 3300002741 | JGI25157J39369_1000030 | JGI25157J39369_100003019 | 254 |
| 996 | 3300003214 | JGI25165J46597_1000682 | JGI25165J46597_10006829 | 254 |
| 997 | 3300025207 | Ga0209760_101106 | Ga0209760_1011063 | 254 |
| 998 | 3300025233 | Ga0209437_100165 | Ga0209437_10016524 | 254 |
| 999 | 3300025261 | Ga0209233_1000069 | Ga0209233_1000069154 | 254 |
| 1000 | 3300048914 | Ga0496111_0015511 | Ga0496111_0015511_3804_4757 | 254 |
| 1001 | iso_pu_bacteria | 2838029111 | 2838029988 | 254 |
| 1002 | iso_pu_bacteria | 2842475841 | 2842476727 | 254 |
| 1003 | iso_pu_bacteria | 2842502639 | 2842503516 | 254 |
| 1004 | iso_pu_bacteria | 3005416602 | 3005420000 | 254 |
| 1005 | iso_pu_bacteria | 8005314921 | 8005316951 | 254 |
| 1006 | iso_pu_bacteria | 8005645114 | 8005649764 | 254 |
| 1007 | iso_pu_bacteria | 8005682033 | 8005683081 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar