F488052

General Info

Members Datasets Scaffolds Average Seq Length
1007 808 398 268

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0015511|Ga0496111_0015511_3804_4757
Length 317
Sequence MATITMMVPTAPVTVMTMDMITATITMAATMLLRRSRERGAAMLDDFFIRALVAGIGVALTAGPLGCFVVWRRMAYFGDTMAHSALLGVALSLFFEVNLLLSVFGVAVLVSGLLLLLQRRQSLSADALLGILSHSALAIGLVLVAFMTWVRIDLIAFLFGDILAVTPSDIALIWGGGALVVLAMVFLWRPLIASTVSEDVAEAEGMRPAQAKLFFMLLMALVIAIAMKIVGIMLITSLLIIPAATARRFSASPEWMAVFASLIGALAVIGGLFGSLTYDTPSGPSIVVAALLLFIMSLVPAFGRNSAERAANKGVRG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
14 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
17 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
18 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
19 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
20 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
21 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
22 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
23 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
24 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
25 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
26 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
27 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
28 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
29 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
30 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
31 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
32 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
33 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
34 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
35 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
36 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
37 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
38 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
39 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
40 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
41 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
42 2516143018 Ensifer sp. BR816 Isolate Nodule
43 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
44 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
45 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
46 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
47 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
48 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
49 2519899620 Rhizobium sp. Pop5 Isolate Nodule
50 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
51 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
52 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
53 2534681786 Brucella suis 92/29 Isolate Unclassified
54 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
55 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
56 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
57 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
58 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
59 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
60 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
61 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
62 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
63 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
64 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
65 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
66 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
67 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
68 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
69 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
70 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
71 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
72 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
73 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
74 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
75 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
76 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
77 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
78 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
79 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
80 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
81 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
82 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
83 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
84 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
85 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
86 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
87 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
88 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
89 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
90 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
91 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
92 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
93 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
94 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
95 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
96 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
97 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
98 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
99 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
100 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
101 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
102 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
103 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
104 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
105 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
106 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
107 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
108 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
109 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
110 2643221557 Ensifer sp. Root558 Isolate Unclassified
111 2643221558 Rhizobium sp. Root149 Isolate Unclassified
112 2643221568 Rhizobium sp. Root564 Isolate Unclassified
113 2643221580 Devosia sp. Root635 Isolate Unclassified
114 2643221582 Rhizobium sp. Root651 Isolate Unclassified
115 2643221591 Devosia sp. Root685 Isolate Unclassified
116 2643221599 Rhizobium sp. Root708 Isolate Unclassified
117 2643221607 Rhizobium sp. Root73 Isolate Unclassified
118 2643221610 Ensifer sp. Root74 Isolate Unclassified
119 2643221618 Ensifer sp. Root231 Isolate Unclassified
120 2643221626 Ensifer sp. Root31 Isolate Unclassified
121 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
122 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
123 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
124 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
125 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
126 2643221655 Ensifer sp. Root1252 Isolate Unclassified
127 2643221659 Ensifer sp. Root127 Isolate Unclassified
128 2643221668 Ensifer sp. Root423 Isolate Unclassified
129 2643221674 Devosia sp. Root436 Isolate Unclassified
130 2643221675 Ensifer sp. Root1298 Isolate Unclassified
131 2643221680 Ensifer sp. Root1312 Isolate Unclassified
132 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
133 2643221688 Rhizobium sp. Root482 Isolate Unclassified
134 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
135 2643221693 Rhizobium sp. Root491 Isolate Unclassified
136 2643221698 Ensifer sp. Root142 Isolate Unclassified
137 2643221712 Ensifer sp. Root258 Isolate Unclassified
138 2643221718 Rhizobium sp. Root268 Isolate Unclassified
139 2643221719 Rhizobium sp. Root274 Isolate Unclassified
140 2643221723 Ensifer sp. Root278 Isolate Unclassified
141 2643221726 Ensifer sp. Root954 Isolate Unclassified
142 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
143 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
144 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
145 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
146 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
147 2718217882 Rhizobium sp. N741 Isolate Nodule
148 2718217927 Rhizobium sp. N324 Isolate Nodule
149 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
150 2718218009 Rhizobium sp. N561 Isolate Nodule
151 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
152 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
153 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
154 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
155 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
156 2718218363 Rhizobium sp. N113 Isolate Nodule
157 2718218365 Rhizobium sp. N731 Isolate Nodule
158 2718218366 Rhizobium sp. N621 Isolate Nodule
159 2718218423 Rhizobium sp. N941 Isolate Nodule
160 2721755514 Rhizobium sp. N6212 Isolate Nodule
161 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
162 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
163 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
164 2721755809 Rhizobium sp. N541 Isolate Nodule
165 2721755810 Rhizobium sp. N871 Isolate Nodule
166 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
167 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
168 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
169 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
170 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
171 2728369365 Rhizobium sp. N1341 Isolate Nodule
172 2728369397 Rhizobium sp. N1314 Isolate Nodule
173 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
174 2738541293 Rhizobium sp. GV031 Isolate Unclassified
175 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
176 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
177 2751185800 Brucella pituitosa AA2 Isolate Unclassified
178 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
179 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
180 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
181 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
182 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
183 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
184 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
185 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
186 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
187 2791355256 Rhizobium sp. M10 Isolate Nodule
188 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
189 2791355260 Rhizobium sp. L9 Isolate Nodule
190 2791355261 Rhizobium sp. J15 Isolate Nodule
191 2791355262 Rhizobium sp. M1 Isolate Nodule
192 2791355263 Rhizobium chutanense C5 Isolate Nodule
193 2791355264 Rhizobium sp. S9 Isolate Nodule
194 2791355265 Rhizobium sp. H4 Isolate Nodule
195 2791355266 Rhizobium sp. L43 Isolate Nodule
196 2791355267 Rhizobium sp. L18 Isolate Nodule
197 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
198 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
199 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
200 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
201 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
202 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
203 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
204 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
205 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
206 2802429633 Rhizobium anhuiense J3 Isolate Nodule
207 2802429634 Rhizobium anhuiense S10 Isolate Nodule
208 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
209 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
210 2802429637 Rhizobium anhuiense C15 Isolate Nodule
211 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
212 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
213 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
214 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
215 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
216 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
217 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
218 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
219 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
220 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
221 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
222 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
223 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
224 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
225 2838048938 Rhizobium pisi 27/80 Isolate Nodule
226 2838061910 Rhizobium phaseoli L15 Isolate Nodule
227 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
228 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
229 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
230 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
231 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
232 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
233 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
234 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
235 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
236 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
237 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
238 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
239 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
240 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
241 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
242 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
243 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
244 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
245 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
246 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
247 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
248 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
249 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
250 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
251 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
252 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
253 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
254 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
255 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
256 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
257 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
258 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
259 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
260 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
261 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
262 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
263 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
264 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
265 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
266 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
267 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
268 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
269 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
270 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
271 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
272 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
273 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
274 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
275 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
276 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
277 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
278 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
279 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
280 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
281 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
282 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
283 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
284 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
285 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
286 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
287 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
288 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
289 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
290 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
291 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
292 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
293 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
294 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
295 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
296 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
297 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
298 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
299 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
300 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
301 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
302 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
303 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
304 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
305 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
306 2844163670 Ensifer sp. 1H6 Isolate Unclassified
307 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
308 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
309 2847085930 Erwinia persicina B64 Isolate Bulb
310 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
311 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
312 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
313 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
314 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
315 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
316 2854911287 Brucella lupini LUP21 Isolate Unclassified
317 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
318 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
319 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
320 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
321 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
322 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
323 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
324 2865014394 Pantoea sp. R-71966 Isolate Unclassified
325 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
326 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
327 2876601092 Pantoea endophytica 596 Isolate Unclassified
328 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
329 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
330 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
331 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
332 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
333 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
334 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
335 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
336 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
337 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
338 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
339 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
340 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
341 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
342 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
343 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
344 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
345 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
346 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
347 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
348 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
349 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
350 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
351 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
352 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
353 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
354 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
355 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
356 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
357 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
358 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
359 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
360 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
361 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
362 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
363 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
364 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
365 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
366 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
367 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
368 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
369 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
370 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
371 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
372 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
373 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
374 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
375 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
376 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
377 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
378 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
379 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
380 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
381 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
382 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
383 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
384 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
385 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
386 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
387 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
388 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
389 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
390 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
391 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
392 2932401849 Devosia sp. 2618 Isolate Rhizosphere
393 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
394 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
395 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
396 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
397 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
398 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
399 2933599457 Rhizobium phaseoli M3 Isolate Nodule
400 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
401 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
402 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
403 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
404 2936381700 Rhizobium chutanense C16 Isolate Unclassified
405 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
406 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
407 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
408 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
409 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
410 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
411 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
412 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
413 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
414 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
415 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
416 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
417 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
418 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
419 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
420 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
421 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
422 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
423 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
424 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
425 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
426 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
427 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
428 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
429 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
430 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
431 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
432 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
433 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
434 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
435 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
436 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
437 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
438 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
439 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
440 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
441 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
442 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
443 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
444 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
445 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
446 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
447 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
448 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
449 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
450 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
451 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
452 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
453 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
454 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
455 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
456 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
457 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
458 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
459 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
460 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
461 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
462 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
463 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
464 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
465 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
466 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
467 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
468 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
469 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
470 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
471 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
472 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
473 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
474 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
475 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
476 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
477 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
478 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
479 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
480 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
481 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
482 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
483 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
484 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
485 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
486 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
487 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
488 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
489 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
490 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
491 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
492 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
493 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
494 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
495 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
496 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
497 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
498 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
499 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
500 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
501 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
502 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
503 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
504 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
505 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
506 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
507 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
508 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
509 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
510 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
511 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
512 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
513 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
514 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
515 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
516 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
517 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
518 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
519 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
520 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
521 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
522 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
523 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
524 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
525 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
526 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
527 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
528 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
529 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
530 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
531 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
532 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
533 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
534 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
535 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
536 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
537 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
538 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
539 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
540 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
541 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
542 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
543 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
544 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
545 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
546 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
547 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
548 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
549 2996887358 Rhizobium sp. R711 Isolate Nodule
550 2996893221 Rhizobium sp. R635 Isolate Nodule
551 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
552 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
553 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
554 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
555 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
556 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
557 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
558 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
559 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
560 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
561 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
562 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
563 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
564 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
565 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
566 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
567 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
568 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
569 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
570 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
571 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
572 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
573 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
574 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
575 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
576 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
577 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
578 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
579 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
580 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
581 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
582 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
583 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
584 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
585 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
586 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
587 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
588 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
589 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
590 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
591 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
592 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
593 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
594 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
595 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
596 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
597 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
598 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
599 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
600 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
601 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
602 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
603 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
604 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
605 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
606 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
607 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
608 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
609 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
610 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
611 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
612 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
613 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
614 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
615 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
616 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
617 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
618 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
619 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
620 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
621 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
622 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
623 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
624 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
625 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
626 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
627 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
628 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
629 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
630 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
631 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
632 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
633 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
634 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
635 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
641 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
642 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
643 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
644 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
645 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
646 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
647 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
648 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
649 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
650 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
651 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
652 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
653 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
654 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
655 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
656 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
657 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
658 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
659 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
660 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
661 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
662 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
663 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
664 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
665 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
666 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
667 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
668 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
669 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
670 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
671 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
672 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
673 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
674 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
675 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
676 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
677 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
678 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
679 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
680 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
681 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
682 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
683 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
684 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
685 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
686 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
687 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
688 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
689 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
690 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
691 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
692 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
693 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
694 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
695 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
696 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
697 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
698 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
699 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
700 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
701 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
702 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
703 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
704 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
705 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
706 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
707 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
708 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
709 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
710 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
711 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
712 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
713 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
714 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
715 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
716 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
717 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
718 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
719 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
720 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
721 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
722 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
723 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
724 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
725 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
726 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
727 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
728 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
729 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
730 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
731 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
732 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
733 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
734 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
735 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
736 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
737 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
738 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
739 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
740 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
741 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
742 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
743 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
744 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
745 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
746 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
747 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
748 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
749 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
750 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
751 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
752 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
753 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
754 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
755 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
756 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
757 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
758 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
759 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
760 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
761 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
762 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
763 8005258706 Rhizobium sp. R693 Isolate Nodule
764 8005275841 Rhizobium sp. N4311 Isolate Nodule
765 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
766 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
767 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
768 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
769 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
770 8005321885 Rhizobium sp. R72 Isolate Nodule
771 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
772 8005382845 Rhizobium sp. R634 Isolate Nodule
773 8005395548 Rhizobium sp. R339 Isolate Nodule
774 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
775 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
776 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
777 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
778 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
779 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
780 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
781 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
782 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
783 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
784 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
785 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
786 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
787 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
788 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
789 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
790 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
791 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
792 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
793 8018176218 Rhizobium sp. N122 Isolate Nodule
794 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
795 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
796 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
797 8024501048 Rhizobium sp. H4 Isolate Nodule
798 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
799 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
800 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
801 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
802 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
803 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
804 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
805 8056382006 Rhizobium croatiense 13T Isolate Nodule
806 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
807 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
808 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.42
Metatranscriptomes 0.1
Isolates 60.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.7
Bulb 0.1
Endosphere 14.6
Nodule 42.9
Rhizoplane 1.99
Rhizosphere 19.66
Stem 0
Stem Tuber 0.4
Unclassified 19.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000001 3300002704 Bacteria 354543
2 JGI25156J39149_1000001 3300002705 Bacteria 354557
3 JGI25162J39368_1000209 3300002737 Bacteria 61889
4 JGI25162J39368_1000245 3300002737 Bacteria 54142
5 JGI25154J39366_1000011 3300002738 Bacteria 296007
6 JGI25158J39367_1000764 3300002739 Bacteria 6158
7 JGI25157J39369_1000030 3300002741 Bacteria 146112
8 JGI25152J39213_1000570 3300002773 Bacteria 20104
9 JGI25152J39213_1004071 3300002773 Bacteria 4746
10 JGI25152J39213_1011917 3300002773 Bacteria 1897
11 JGI25150J39212_1000326 3300002774 Bacteria 23479
12 JGI25150J39212_1005593 3300002774 Bacteria 2668
13 JGI25159J45721_1000078 3300002987 Bacteria 46708
14 JGI25159J45721_1000199 3300002987 Bacteria 27917
15 JGI25159J45721_1000530 3300002987 Bacteria 17359
16 JGI25151J46595_10000083 3300003187 Bacteria 130658
17 JGI25165J46597_1000302 3300003214 Bacteria 61889
18 JGI25165J46597_1000682 3300003214 Bacteria 27253
19 JGI25153J46596_10000377 3300003215 Bacteria 30499
20 JGI25153J46596_10005215 3300003215 Bacteria 6840
21 JGI25153J46596_10008879 3300003215 Bacteria 4746
22 rootH2_10150379 3300003320 Bacteria 1788
23 JGI25160J50197_1000087 3300003354 Bacteria 93379
24 JGI25160J50197_1000216 3300003354 Bacteria 46708
25 JGI25161J50226_1000066 3300003374 Bacteria 94505
26 JGI25161J50226_1000207 3300003374 Bacteria 38350
27 JGI25161J50226_1000412 3300003374 Bacteria 20844
28 Ga0055526_1000594 3300003771 Bacteria 28489
29 Ga0055526_1003679 3300003771 Bacteria 9591
30 Ga0055526_1028194 3300003771 Bacteria 1706
31 Ga0055524_1001754 3300003775 Bacteria 11976
32 Ga0055524_1001805 3300003775 Bacteria 11731
33 Ga0055524_1025058 3300003775 Bacteria 1875
34 Ga0055528_1000358 3300003790 Bacteria 37118
35 Ga0055528_1019378 3300003790 Bacteria 2257
36 Ga0055540_1012253 3300003792 Bacteria 2705
37 Ga0058692_1000085 3300003856 Bacteria 65543
38 Ga0058692_1000167 3300003856 Bacteria 40623
39 Ga0058692_1000350 3300003856 Bacteria 22460
40 Ga0058692_1006447 3300003856 Bacteria 3219
41 Ga0055543_1000053 3300004625 Bacteria 104589
42 Ga0055543_1000068 3300004625 Bacteria 94795
43 Ga0055543_1000301 3300004625 Bacteria 35189
44 Ga0055543_1001883 3300004625 Bacteria 7624
45 Ga0065165_1000717 3300005262 Bacteria 46746
46 Ga0065165_1000839 3300005262 Bacteria 40355
47 Ga0065165_1005533 3300005262 Bacteria 7050
48 Ga0070668_100205064 3300005347 Bacteria 1620
49 Ga0070669_100215989 3300005353 Bacteria 1515
50 Ga0070671_100084132 3300005355 Bacteria 2661
51 Ga0070667_100245343 3300005367 Bacteria 1600
52 Ga0070665_100543480 3300005548 Bacteria 1174
53 Ga0068854_100046155 3300005578 Bacteria 3101
54 Ga0068856_100035514 3300005614 Bacteria 4886
55 Ga0068851_10061721 3300005834 Bacteria 1922
56 Ga0075365_10000404 3300006038 Bacteria 15855
57 Ga0075365_10040694 3300006038 Bacteria 3032
58 Ga0075364_10224605 3300006051 Bacteria 1275
59 Ga0075362_10094396 3300006177 Bacteria 1392
60 Ga0075367_10006190 3300006178 Bacteria 6026
61 Ga0075367_10014267 3300006178 Bacteria 4297
62 Ga0075367_10130254 3300006178 Bacteria 1554
63 Ga0075367_10277944 3300006178 Bacteria 1052
64 Ga0075369_10000812 3300006186 Bacteria 10265
65 Ga0075369_10014994 3300006186 Bacteria 3103
66 Ga0079104_1000610 3300006946 Bacteria 35237
67 Ga0079104_1013531 3300006946 Bacteria 2509
68 Ga0099826_10000091 3300006948 Bacteria 44824
69 Ga0099826_10012274 3300006948 Bacteria 6455
70 Ga0105250_10003428 3300009092 Bacteria 7517
71 Ga0105240_10000005 3300009093 Bacteria 702630
72 Ga0105243_10023405 3300009148 Bacteria 4704
73 Ga0105237_10000766 3300009545 Bacteria 44044
74 Ga0123342_1012633 3300009766 Bacteria 8735
75 Ga0105239_10001069 3300010375 Bacteria 38061
76 Ga0105246_10009831 3300011119 Bacteria 5898
77 Ga0105246_10017249 3300011119 Bacteria 4587
78 Ga0157373_10000137 3300013100 Bacteria 57817
79 Ga0157373_10007245 3300013100 Bacteria 8273
80 Ga0157371_10000015 3300013102 Bacteria 339838
81 Ga0157371_10000810 3300013102 Bacteria 35896
82 Ga0157371_10016604 3300013102 Bacteria 5489
83 Ga0157370_10000046 3300013104 Bacteria 125612
84 Ga0157370_10000402 3300013104 Bacteria 54601
85 Ga0171463_1003 3300013249 Bacteria 695693
86 Ga0163162_10259195 3300013306 Bacteria 1871
87 Ga0157372_10029974 3300013307 Bacteria 5946
88 Ga0183363_1047 3300015690 Bacteria 39413
89 Ga0214544_1001682 3300021320 Bacteria 46508
90 Ga0214542_1001614 3300021321 Bacteria 46380
91 Ga0214543_1000078 3300021327 Bacteria 119775
92 Ga0214543_1001395 3300021327 Bacteria 46435
93 Ga0228711_1000016 3300022739 Bacteria 126351
94 Ga0228710_1000013 3300022740 Bacteria 145976
95 Ga0209435_100012 3300025206 Bacteria 401621
96 Ga0209760_101106 3300025207 Bacteria 3086
97 Ga0209436_100085 3300025208 Bacteria 46798
98 Ga0209436_103034 3300025208 Bacteria 4648
99 Ga0209436_105400 3300025208 Bacteria 2950
100 Ga0209437_100047 3300025233 Bacteria 405163
101 Ga0209437_100165 3300025233 Bacteria 145009
102 Ga0207425_1000024 3300025245 Bacteria 328978
103 Ga0207425_1001564 3300025245 Bacteria 9306
104 Ga0209646_1000026 3300025246 Bacteria 401621
105 Ga0209026_1000014 3300025250 Bacteria 401621
106 Ga0209677_100656 3300025253 Bacteria 18202
107 Ga0209759_1000012 3300025256 Bacteria 401621
108 Ga0209129_1000069 3300025258 Bacteria 212790
109 Ga0209129_1000184 3300025258 Bacteria 87102
110 Ga0209129_1002960 3300025258 Bacteria 7755
111 Ga0209129_1005886 3300025258 Bacteria 4162
112 Ga0209233_1000048 3300025261 Bacteria 453669
113 Ga0209233_1000069 3300025261 Bacteria 367639
114 Ga0209233_1000195 3300025261 Bacteria 125863
115 Ga0209565_1020981 3300025263 Bacteria 1371
116 Ga0209455_1014550 3300025272 Bacteria 1775
117 Ga0209673_1000010 3300025273 Bacteria 596656
118 Ga0209673_1003537 3300025273 Bacteria 9130
119 Ga0209673_1008196 3300025273 Bacteria 4689
120 Ga0209130_1000021 3300025284 Bacteria 374278
121 Ga0209130_1000029 3300025284 Bacteria 323399
122 Ga0209130_1000081 3300025284 Bacteria 166440
123 Ga0209130_1024642 3300025284 Bacteria 1310
124 Ga0209676_1005409 3300025292 Bacteria 6685
125 Ga0209676_1007095 3300025292 Bacteria 5362
126 Ga0209025_1000050 3300025294 Bacteria 331531
127 Ga0209025_1000094 3300025294 Bacteria 241080
128 Ga0209025_1000119 3300025294 Bacteria 210606
129 Ga0209025_1000959 3300025294 Bacteria 43491
130 Ga0209025_1001225 3300025294 Bacteria 35824
131 Ga0209025_1004412 3300025294 Bacteria 12242
132 Ga0209025_1021372 3300025294 Bacteria 3489
133 Ga0209025_1025145 3300025294 Bacteria 3042
134 Ga0209025_1030438 3300025294 Bacteria 2584
135 Ga0209025_1046039 3300025294 Bacteria 1800
136 Ga0209564_1000260 3300025295 Bacteria 112444
137 Ga0209564_1000278 3300025295 Bacteria 105405
138 Ga0209758_1000083 3300025297 Bacteria 257283
139 Ga0209758_1000418 3300025297 Bacteria 72150
140 Ga0209758_1001270 3300025297 Bacteria 31259
141 Ga0209758_1001756 3300025297 Bacteria 24054
142 Ga0209758_1028658 3300025297 Bacteria 2348
143 Ga0209050_1009223 3300025298 Bacteria 5091
144 Ga0209050_1030063 3300025298 Bacteria 1721
145 Ga0209256_1000042 3300025299 Bacteria 341821
146 Ga0209256_1001127 3300025299 Bacteria 30457
147 Ga0209256_1003234 3300025299 Bacteria 11741
148 Ga0209256_1003768 3300025299 Bacteria 10221
149 Ga0209256_1016068 3300025299 Bacteria 2575
150 Ga0207426_1000008 3300025302 Bacteria 848730
151 Ga0207426_1000010 3300025302 Bacteria 796003
152 Ga0207426_1000074 3300025302 Bacteria 323399
153 Ga0207426_1000952 3300025302 Bacteria 28571
154 Ga0209051_1001051 3300025303 Bacteria 25929
155 Ga0209051_1038275 3300025303 Bacteria 1747
156 Ga0209051_1059233 3300025303 Bacteria 1215
157 Ga0209257_1006328 3300025304 Bacteria 7699
158 Ga0209257_1007766 3300025304 Bacteria 6371
159 Ga0209257_1024647 3300025304 Bacteria 2077
160 Ga0209257_1036739 3300025304 Bacteria 1501
161 Ga0207696_1000062 3300025711 Bacteria 239603
162 Ga0207655_1000007 3300025728 Bacteria 773492
163 Ga0207655_1022807 3300025728 Bacteria 3122
164 Ga0207695_10000011 3300025913 Bacteria 910221
165 Ga0207671_10000241 3300025914 Bacteria 81847
166 Ga0207681_10140175 3300025923 Bacteria 1800
167 Ga0207668_10128587 3300025972 Bacteria 1931
168 Ga0207640_10027070 3300025981 Bacteria 3491
169 Ga0207702_10074236 3300026078 Bacteria 2935
170 Ga0209281_1000036 3300027111 Bacteria 369415
171 Ga0209281_1000047 3300027111 Bacteria 326514
172 Ga0209281_1000221 3300027111 Bacteria 122380
173 Ga0209371_1000005 3300027312 Bacteria 1061740
174 Ga0209371_1000021 3300027312 Bacteria 555864
175 Ga0209371_1000039 3300027312 Bacteria 350081
176 Ga0209371_1000199 3300027312 Bacteria 87337
177 Ga0209371_1000229 3300027312 Bacteria 71827
178 Ga0209371_1002365 3300027312 Bacteria 10675
179 Ga0209371_1004936 3300027312 Bacteria 5543
180 Ga0209282_1000041 3300027666 Bacteria 122268
181 Ga0209282_1000251 3300027666 Bacteria 26915
182 Ga0209282_1054726 3300027666 Bacteria 2262
183 Ga0209813_10033758 3300027866 Bacteria 1523
184 Ga0268266_10197077 3300028379 Bacteria 1842
185 Ga0268266_10397157 3300028379 Bacteria 1303
186 Ga0307515_10000023 3300028794 Bacteria 400846
187 Ga0307515_10013391 3300028794 Bacteria 15338
188 Ga0307515_10084680 3300028794 Bacteria 4068
189 Ga0268256_1000006 3300030500 Bacteria 1063991
190 Ga0268256_1000020 3300030500 Bacteria 557873
191 Ga0268256_1000033 3300030500 Bacteria 420973
192 Ga0268256_1000618 3300030500 Bacteria 27786
193 Ga0268256_1001050 3300030500 Bacteria 18470
194 Ga0268256_1003171 3300030500 Bacteria 7645
195 Ga0268256_1004176 3300030500 Bacteria 6112
196 Ga0316181_1097185 3300030744 Bacteria 1108
197 Ga0307408_100121756 3300031548 Bacteria 2022
198 Ga0307412_10029449 3300031911 Bacteria 3446
199 Ga0307412_10064336 3300031911 Bacteria 2478
200 Ga0307412_10179015 3300031911 Bacteria 1593
201 Ga0315914_1005042 3300031967 Bacteria 19465
202 Ga0307409_100219905 3300031995 Bacteria 1714
203 Ga0307416_100250920 3300032002 Bacteria 1722
204 Ga0315913_1003257 3300033430 Bacteria 19465
205 Ga0315915_1000017 3300033464 Bacteria 148111
206 Ga0400483_079876 3300039062 Bacteria 8635
207 Ga0400483_172620 3300039062 Bacteria 11957
208 Ga0439438_004464 3300041405 Bacteria 5359
209 Ga0439439_0052844 3300041406 Bacteria 1068
210 Ga0439447_002812 3300041407 Bacteria 6266
211 Ga0439465_0003881 3300041413 Bacteria 4879
212 Ga0439465_0011462 3300041413 Bacteria 2782
213 Ga0451791_1542990 3300041451 Bacteria 1143
214 Ga0451833_0387060 3300041491 Bacteria 1178
215 Ga0451835_0183697 3300041492 Bacteria 1002
216 Ga0451835_0197663 3300041492 Bacteria 1555
217 Ga0451837_0688979 3300041494 Bacteria 1760
218 Ga0451839_0261576 3300041496 Bacteria 5053
219 Ga0451841_0575577 3300041498 Bacteria 2710
220 Ga0451846_11831 3300041502 Bacteria 1770
221 Ga0451847_0545570 3300041503 Bacteria 2374
222 Ga0451851_0185573 3300041507 Bacteria 3658
223 Ga0451843_0557105 3300041509 Bacteria 1996
224 Ga0439449_0010911 3300042007 Bacteria 3428
225 Ga0439449_0015007 3300042007 Bacteria 2911
226 Ga0450908_008115 3300042184 Bacteria 1970
227 Ga0466968_0099450 3300044735 Bacteria 1297
228 Ga0466970_0000517 3300044765 Bacteria 19001
229 Ga0466970_0197868 3300044765 Bacteria 1118
230 Ga0466958_0025411 3300045836 Bacteria 3493
231 Ga0495617_007878 3300046452 Bacteria 3685
232 Ga0495591_000007 3300046458 Bacteria 366385
233 Ga0495591_000318 3300046458 Bacteria 43617
234 Ga0495650_0000026 3300046471 Bacteria 476029
235 Ga0495605_0015250 3300046474 Bacteria 4185
236 Ga0495605_0042953 3300046474 Bacteria 2243
237 Ga0495605_0162028 3300046474 Bacteria 992
238 Ga0495585_0019158 3300046492 Bacteria 3949
239 Ga0495585_0019219 3300046492 Bacteria 3942
240 Ga0495607_0014568 3300046501 Bacteria 5113
241 Ga0495607_0066247 3300046501 Bacteria 2033
242 Ga0495606_0001613 3300046507 Bacteria 29410
243 Ga0495606_0012820 3300046507 Bacteria 6679
244 Ga0495606_0108765 3300046507 Bacteria 1675
245 Ga0495610_0027460 3300046512 Bacteria 3023
246 Ga0495616_0051898 3300046513 Bacteria 2043
247 Ga0495631_0005659 3300046518 Bacteria 6519
248 Ga0495631_0039188 3300046518 Bacteria 2104
249 Ga0495632_0016479 3300046519 Bacteria 4109
250 Ga0495643_0039324 3300046522 Bacteria 2587
251 Ga0495644_0001680 3300046523 Bacteria 8985
252 Ga0495648_0009418 3300046524 Bacteria 7577
253 Ga0495654_0000007 3300046530 Bacteria 403529
254 Ga0495654_0000069 3300046530 Bacteria 120853
255 Ga0495633_0015993 3300046558 Bacteria 3881
256 Ga0495633_0082790 3300046558 Bacteria 1493
257 Ga0495633_0147035 3300046558 Bacteria 1089
258 Ga0495625_0047417 3300046660 Bacteria 3098
259 Ga0495625_0202915 3300046660 Bacteria 1307
260 Ga0495671_0022125 3300046692 Bacteria 3333
261 Ga0495649_0019733 3300046694 Bacteria 3785
262 Ga0495589_0003279 3300046794 Bacteria 8788
263 Ga0495660_0000016 3300046810 Bacteria 321859
264 Ga0495660_0029052 3300046810 Bacteria 3121
265 Ga0495672_0000001 3300047320 Bacteria 1458820
266 Ga0495673_0000352 3300047469 Bacteria 57266
267 Ga0495681_0005741 3300047470 Bacteria 8255
268 Ga0495686_0000796 3300047472 Bacteria 41000
269 Ga0495686_0023787 3300047472 Bacteria 4033
270 Ga0496100_0017847 3300048903 Bacteria 4197
271 Ga0496100_0080448 3300048903 Bacteria 2199
272 Ga0496101_0000093 3300048904 Bacteria 95734
273 Ga0496102_0010757 3300048905 Bacteria 7880
274 Ga0496104_0200879 3300048907 Bacteria 1905
275 Ga0496110_0370165 3300048913 Bacteria 1306
276 Ga0496111_0015511 3300048914 Bacteria 5233
277 Ga0496113_0076669 3300048916 Bacteria 2554
278 Ga0496116_0000086 3300048919 Bacteria 217597
279 Ga0496116_0005431 3300048919 Bacteria 11825
280 Ga0496116_0006630 3300048919 Bacteria 10457
281 Ga0496116_0057331 3300048919 Bacteria 2547
282 Ga0496117_0000002 3300048920 Bacteria 2483758
283 Ga0496117_0000353 3300048920 Bacteria 81061
284 Ga0496117_0006313 3300048920 Bacteria 12058
285 Ga0496117_0071508 3300048920 Bacteria 2324
286 Ga0496118_0000204 3300048921 Bacteria 104260
287 Ga0496118_0000355 3300048921 Bacteria 77500
288 Ga0496118_0022010 3300048921 Bacteria 5590
289 Ga0496119_0003501 3300048922 Bacteria 16239
290 Ga0496119_0004804 3300048922 Bacteria 13257
291 Ga0496119_0014717 3300048922 Bacteria 6095
292 Ga0496119_0035312 3300048922 Bacteria 3277
293 Ga0496119_0087118 3300048922 Bacteria 1783
294 Ga0496119_0133318 3300048922 Bacteria 1351
295 Ga0496120_0000002 3300048923 Bacteria 547999
296 Ga0496120_0000116 3300048923 Bacteria 135302
297 Ga0496120_0000917 3300048923 Bacteria 41032
298 Ga0496120_0000941 3300048923 Bacteria 40051
299 Ga0496120_0002795 3300048923 Bacteria 16912
300 Ga0496120_0009779 3300048923 Bacteria 6762
301 Ga0496121_0000378 3300048924 Bacteria 91381
302 Ga0496121_0009399 3300048924 Bacteria 11245
303 Ga0496121_0043020 3300048924 Bacteria 3918
304 Ga0496121_0071342 3300048924 Bacteria 2794
305 Ga0496122_0000001 3300048925 Bacteria 1827766
306 Ga0496122_0000369 3300048925 Bacteria 96672
307 Ga0496122_0000525 3300048925 Bacteria 79294
308 Ga0496122_0003261 3300048925 Bacteria 21531
309 Ga0496122_0004665 3300048925 Bacteria 16828
310 Ga0496122_0008819 3300048925 Bacteria 10769
311 Ga0496122_0012544 3300048925 Bacteria 8418
312 Ga0496122_0024409 3300048925 Bacteria 5291
313 Ga0496122_0032026 3300048925 Bacteria 4358
314 Ga0496122_0072484 3300048925 Bacteria 2448
315 Ga0496122_0243607 3300048925 Bacteria 1011
316 Ga0496123_0000001 3300048926 Bacteria 1831497
317 Ga0496123_0000054 3300048926 Bacteria 234046
318 Ga0496123_0001014 3300048926 Bacteria 42878
319 Ga0496123_0002174 3300048926 Bacteria 25015
320 Ga0496123_0002482 3300048926 Bacteria 22770
321 Ga0496123_0003243 3300048926 Bacteria 18515
322 Ga0496124_0000357 3300048927 Bacteria 83170
323 Ga0496124_0001936 3300048927 Bacteria 28381
324 Ga0496124_0006121 3300048927 Bacteria 13215
325 Ga0496124_0010848 3300048927 Bacteria 9175
326 Ga0496124_0014592 3300048927 Bacteria 7589
327 Ga0496124_0049824 3300048927 Bacteria 3571
328 Ga0496124_0065627 3300048927 Bacteria 3025
329 Ga0496124_0075919 3300048927 Bacteria 2776
330 Ga0496124_0324998 3300048927 Bacteria 1099
331 Ga0496125_0000282 3300048928 Bacteria 101380
332 Ga0496125_0002081 3300048928 Bacteria 26974
333 Ga0496125_0011299 3300048928 Bacteria 8948
334 Ga0496125_0024477 3300048928 Bacteria 5551
335 Ga0496125_0028386 3300048928 Bacteria 5055
336 Ga0496125_0041019 3300048928 Bacteria 3962
337 Ga0496126_0000703 3300048929 Bacteria 61100
338 Ga0496126_0001019 3300048929 Bacteria 47578
339 Ga0496126_0041836 3300048929 Bacteria 4237
340 Ga0496126_0061193 3300048929 Bacteria 3383
341 Ga0496126_0070749 3300048929 Bacteria 3107
342 Ga0496126_0189716 3300048929 Bacteria 1742
343 Ga0496126_0255942 3300048929 Bacteria 1457
344 Ga0495678_001115 3300049459 Bacteria 22363
345 Ga0495682_0000001 3300049460 Bacteria 1559116
346 Ga0501032_0175424 3300049569 Bacteria 1404
347 Ga0501033_0000167 3300049570 Bacteria 63051
348 Ga0501033_0058254 3300049570 Bacteria 2854
349 Ga0501034_0002538 3300049571 Bacteria 21830
350 Ga0501034_0427279 3300049571 Bacteria 1245
351 Ga0501037_0088749 3300049573 Bacteria 2238
352 Ga0501037_0128592 3300049573 Bacteria 1817
353 Ga0501043_0027267 3300049579 Bacteria 4485
354 Ga0501070_0211017 3300049586 Bacteria 1594
355 Ga0501083_0092066 3300049744 Bacteria 2001
356 Ga0501280_000582 3300049776 Bacteria 8435
357 Ga0501035_0006797 3300049822 Bacteria 10686
358 Ga0501035_0195416 3300049822 Bacteria 1738
359 Ga0501044_0091936 3300049823 Bacteria 3060
360 Ga0501044_0263690 3300049823 Bacteria 1661
361 Ga0501044_0280231 3300049823 Bacteria 1601
362 Ga0501044_0355027 3300049823 Bacteria 1385
363 nmdc:mga03683_2318_c1 3300050489 Bacteria 5888
364 nmdc:mga03683_34891_c1 3300050489 Bacteria 2037
365 nmdc:mga03n38_1786_c1 3300050490 Bacteria 6376
366 nmdc:mga00v17_219758_c1 3300050491 Bacteria 1230
367 nmdc:mga00v17_264213_c1 3300050491 Bacteria 1116
368 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
369 nmdc:mga0yw44_33191_c1 3300050492 Bacteria 3014
370 nmdc:mga0yw44_72132_c1 3300050492 Bacteria 2146
371 nmdc:mga06z11_55161_c1 3300050494 Bacteria 2051
372 nmdc:mga06z11_817_c1 3300050494 Bacteria 11396
373 nmdc:mga04h51_23321_c1 3300050495 Bacteria 1883
374 nmdc:mga07m45_161522_c1 3300050496 Bacteria 1301
375 nmdc:mga07m45_176094_c1 3300050496 Bacteria 1244
376 nmdc:mga07m45_928_c1 3300050496 Bacteria 12810
377 nmdc:mga0sz30_12802_c1 3300050516 Bacteria 3269
378 nmdc:mga0sz30_215_c2 3300050516 Bacteria 16156
379 nmdc:mga0sz30_708_c1 3300050516 Bacteria 12251
380 Ga0500560_006454 3300053107 Bacteria 2685
381 Ga0500569_018613 3300053109 Bacteria 1796
382 Ga0500594_0016193 3300053118 Bacteria 1809
383 Ga0500618_000313 3300053125 Bacteria 35843
384 Ga0500618_000604 3300053125 Bacteria 22060
385 Ga0500618_012244 3300053125 Bacteria 2249
386 Ga0500621_000002 3300053126 Bacteria 849473
387 Ga0500658_0000945 3300053134 Bacteria 11858
388 Ga0500561_0000246 3300053137 Bacteria 9524
389 Ga0500568_0001517 3300053139 Bacteria 14797
390 Ga0500573_0000259 3300053140 Bacteria 22228
391 Ga0500616_0000301 3300053153 Bacteria 71758
392 Ga0500616_0004349 3300053153 Bacteria 10137
393 Ga0500616_0019956 3300053153 Bacteria 3770
394 Ga0500622_0001146 3300053156 Bacteria 22058
395 Ga0500627_0063175 3300053158 Bacteria 1632
396 Ga0500634_0079358 3300053161 Bacteria 1696
397 Ga0500636_0000153 3300053177 Bacteria 35853
398 Ga0500636_0001102 3300053177 Bacteria 14459

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046474 Ga0495605_0162028 Ga0495605_0162028_269_964 191
2 3300002773 JGI25152J39213_1000570 JGI25152J39213_10005709 196
3 3300002774 JGI25150J39212_1000326 JGI25150J39212_100032611 196
4 3300003187 JGI25151J46595_10000083 JGI25151J46595_1000008382 196
5 3300003215 JGI25153J46596_10000377 JGI25153J46596_1000037725 196
6 3300006178 Ga0075367_10006190 Ga0075367_100061904 196
7 3300025245 Ga0207425_1000024 Ga0207425_1000024168 196
8 3300025258 Ga0209129_1000184 Ga0209129_100018456 196
9 3300025294 Ga0209025_1000050 Ga0209025_1000050159 196
10 3300025297 Ga0209758_1000083 Ga0209758_100008398 196
11 3300048920 Ga0496117_0071508 Ga0496117_0071508_572_1390 196
12 3300046518 Ga0495631_0005659 Ga0495631_0005659_3365_4174 197
13 3300053158 Ga0500627_0063175 Ga0500627_0063175_533_1342 197
14 3300002773 JGI25152J39213_1011917 JGI25152J39213_10119173 198
15 3300003771 Ga0055526_1028194 Ga0055526_10281942 198
16 3300003775 Ga0055524_1025058 Ga0055524_10250582 198
17 3300005347 Ga0070668_100205064 Ga0070668_1002050642 198
18 3300005355 Ga0070671_100084132 Ga0070671_1000841325 198
19 3300006038 Ga0075365_10000404 Ga0075365_1000040414 198
20 3300006186 Ga0075369_10000812 Ga0075369_100008123 198
21 3300025258 Ga0209129_1005886 Ga0209129_10058868 198
22 3300025294 Ga0209025_1004412 Ga0209025_10044129 198
23 3300025297 Ga0209758_1028658 Ga0209758_10286582 198
24 3300025302 Ga0207426_1000952 Ga0207426_100095215 198
25 3300025972 Ga0207668_10128587 Ga0207668_101285872 198
26 3300048925 Ga0496122_0243607 Ga0496122_0243607_138_950 198
27 3300006178 Ga0075367_10130254 Ga0075367_101302543 199
28 3300025273 Ga0209673_1008196 Ga0209673_10081964 199
29 3300025299 Ga0209256_1016068 Ga0209256_10160683 199
30 3300025303 Ga0209051_1059233 Ga0209051_10592332 199
31 3300028794 Ga0307515_10084680 Ga0307515_100846802 199
32 3300041451 Ga0451791_1542990 Ga0451791_1542990_22_837 199
33 3300041509 Ga0451843_0557105 Ga0451843_0557105_613_1428 199
34 3300046660 Ga0495625_0047417 Ga0495625_0047417_1219_2037 199
35 3300053139 Ga0500568_0001517 Ga0500568_0001517_5787_6605 200
36 3300053153 Ga0500616_0004349 Ga0500616_0004349_5458_6276 200
37 3300009766 Ga0123342_1012633 Ga0123342_10126337 202
38 3300046522 Ga0495643_0039324 Ga0495643_0039324_1190_2023 205
39 3300046660 Ga0495625_0202915 Ga0495625_0202915_35_868 205
40 3300049823 Ga0501044_0355027 Ga0501044_0355027_63_884 205
41 3300053153 Ga0500616_0019956 Ga0500616_0019956_2501_3334 205
42 3300048927 Ga0496124_0065627 Ga0496124_0065627_187_1014 207
43 3300004625 Ga0055543_1001883 Ga0055543_10018835 208
44 3300005578 Ga0068854_100046155 Ga0068854_1000461552 208
45 3300005834 Ga0068851_10061721 Ga0068851_100617213 208
46 3300009093 Ga0105240_10000005 Ga0105240_10000005700 208
47 3300009545 Ga0105237_10000766 Ga0105237_1000076637 208
48 3300010375 Ga0105239_10001069 Ga0105239_1000106921 208
49 3300013104 Ga0157370_10000046 Ga0157370_1000004676 208
50 3300025913 Ga0207695_10000011 Ga0207695_10000011217 208
51 3300025914 Ga0207671_10000241 Ga0207671_1000024124 208
52 3300025981 Ga0207640_10027070 Ga0207640_100270704 208
53 3300048929 Ga0496126_0070749 Ga0496126_0070749_1968_2795 208
54 3300025208 Ga0209436_105400 Ga0209436_1054003 209
55 3300025284 Ga0209130_1000021 Ga0209130_1000021277 209
56 3300025302 Ga0207426_1000010 Ga0207426_100001081 209
57 3300041498 Ga0451841_0575577 Ga0451841_0575577_432_1295 209
58 3300046518 Ga0495631_0039188 Ga0495631_0039188_933_1817 209
59 3300003775 Ga0055524_1001805 Ga0055524_100180511 210
60 3300003790 Ga0055528_1000358 Ga0055528_10003586 210
61 3300025258 Ga0209129_1000069 Ga0209129_100006914 210
62 3300025273 Ga0209673_1000010 Ga0209673_10000106 210
63 3300025294 Ga0209025_1001225 Ga0209025_100122514 210
64 3300025294 Ga0209025_1021372 Ga0209025_10213722 210
65 3300025299 Ga0209256_1001127 Ga0209256_10011276 210
66 3300041491 Ga0451833_0387060 Ga0451833_0387060_209_1081 210
67 3300041492 Ga0451835_0183697 Ga0451835_0183697_56_928 210
68 3300041496 Ga0451839_0261576 Ga0451839_0261576_176_1048 210
69 3300046492 Ga0495585_0019158 Ga0495585_0019158_2196_3044 210
70 3300046513 Ga0495616_0051898 Ga0495616_0051898_592_1458 211
71 3300049586 Ga0501070_0211017 Ga0501070_0211017_137_955 211
72 3300041494 Ga0451837_0688979 Ga0451837_0688979_791_1663 212
73 3300041502 Ga0451846_11831 Ga0451846_11831_840_1712 212
74 3300046492 Ga0495585_0019219 Ga0495585_0019219_2217_3122 212
75 3300041492 Ga0451835_0197663 Ga0451835_0197663_109_981 213
76 3300041503 Ga0451847_0545570 Ga0451847_0545570_843_1760 213
77 3300041507 Ga0451851_0185573 Ga0451851_0185573_1253_2158 213
78 3300046501 Ga0495607_0066247 Ga0495607_0066247_611_1528 213
79 3300046507 Ga0495606_0108765 Ga0495606_0108765_610_1527 213
80 3300046512 Ga0495610_0027460 Ga0495610_0027460_1967_2884 213
81 3300046519 Ga0495632_0016479 Ga0495632_0016479_2310_3227 213
82 3300046810 Ga0495660_0029052 Ga0495660_0029052_1422_2339 213
83 3300047472 Ga0495686_0023787 Ga0495686_0023787_898_1791 213
84 3300050489 nmdc:mga03683_2318_c1 nmdc:mga03683_2318_c1_870_1811 213
85 3300050494 nmdc:mga06z11_817_c1 nmdc:mga06z11_817_c1_3225_4166 213
86 3300050496 nmdc:mga07m45_928_c1 nmdc:mga07m45_928_c1_6193_7134 213
87 3300050516 nmdc:mga0sz30_708_c1 nmdc:mga0sz30_708_c1_6052_6993 213
88 3300053109 Ga0500569_018613 Ga0500569_018613_722_1639 213
89 3300053118 Ga0500594_0016193 Ga0500594_0016193_902_1795 213
90 3300053134 Ga0500658_0000945 Ga0500658_0000945_4480_5397 213
91 3300046474 Ga0495605_0015250 Ga0495605_0015250_86_961 214
92 3300046558 Ga0495633_0082790 Ga0495633_0082790_15_962 214
93 3300048919 Ga0496116_0057331 Ga0496116_0057331_612_1592 214
94 3300048925 Ga0496122_0004665 Ga0496122_0004665_949_1929 214
95 3300048926 Ga0496123_0002482 Ga0496123_0002482_874_1854 214
96 3300048927 Ga0496124_0014592 Ga0496124_0014592_608_1588 214
97 3300048928 Ga0496125_0011299 Ga0496125_0011299_5375_6355 214
98 3300048929 Ga0496126_0255942 Ga0496126_0255942_409_1272 214
99 3300002737 JGI25162J39368_1000209 JGI25162J39368_100020912 215
100 3300003214 JGI25165J46597_1000302 JGI25165J46597_100030212 215
101 3300005614 Ga0068856_100035514 Ga0068856_1000355144 215
102 3300025233 Ga0209437_100047 Ga0209437_100047127 215
103 3300025261 Ga0209233_1000048 Ga0209233_1000048275 215
104 3300026078 Ga0207702_10074236 Ga0207702_100742363 215
105 iso_pu_bacteria 2919493220 2919495545 215
106 iso_pu_bacteria 2919543075 2919544736 215
107 iso_pu_bacteria 2923525760 2923526907 215
108 3300027312 Ga0209371_1004936 Ga0209371_10049363 216
109 3300030500 Ga0268256_1004176 Ga0268256_10041764 216
110 3300025253 Ga0209677_100656 Ga0209677_10065610 217
111 3300025261 Ga0209233_1000195 Ga0209233_1000195119 217
112 3300031548 Ga0307408_100121756 Ga0307408_1001217562 217
113 3300031911 Ga0307412_10064336 Ga0307412_100643362 217
114 3300031995 Ga0307409_100219905 Ga0307409_1002199052 217
115 3300032002 Ga0307416_100250920 Ga0307416_1002509202 217
116 3300042007 Ga0439449_0010911 Ga0439449_0010911_2591_3418 217
117 iso_pu_bacteria 2511231025 2511382934 217
118 iso_pu_bacteria 2511231035 2511435065 217
119 iso_pu_bacteria 2511231221 2512038281 217
120 iso_pu_bacteria 2565956521 2566038038 217
121 iso_pu_bacteria 2608642108 2608669758 217
122 iso_pu_bacteria 2648501693 2650896422 217
123 iso_pu_bacteria 2684622997 2686353702 217
124 iso_pu_bacteria 2844528606 2844528727 217
125 iso_pu_bacteria 2847085930 2847087289 217
126 iso_pu_bacteria 2854601825 2854602271 217
127 iso_pu_bacteria 2858466076 2858467076 217
128 iso_pu_bacteria 2865014394 2865018387 217
129 iso_pu_bacteria 2871272651 2871275206 217
130 iso_pu_bacteria 2871282230 2871285158 217
131 iso_pu_bacteria 2876601092 2876603890 217
132 iso_pu_bacteria 2881609920 2881611545 217
133 iso_pu_bacteria 2897803580 2897808816 217
134 iso_pu_bacteria 2908669403 2908669420 217
135 iso_pu_bacteria 2939602548 2939606103 217
136 iso_pu_bacteria 2945951305 2945952634 217
137 iso_pu_bacteria 2978975091 2978979202 217
138 iso_pu_bacteria 2984494565 2984496991 217
139 iso_pu_bacteria 2990261002 2990262407 217
140 iso_pu_bacteria 8019499862 8019501028 217
141 iso_pu_bacteria 8054002106 8054002871 217
142 3300039062 Ga0400483_079876 Ga0400483_079876_4136_4933 218
143 3300039062 Ga0400483_172620 Ga0400483_172620_9842_10639 218
144 iso_pu_bacteria 2738541276 2738714046 218
145 3300049823 Ga0501044_0280231 Ga0501044_0280231_588_1403 220
146 iso_pu_bacteria 2738541317 2738945435 220
147 iso_pu_bacteria 2913308742 2913310141 220
148 3300003856 Ga0058692_1000085 Ga0058692_100008542 221
149 3300003856 Ga0058692_1000167 Ga0058692_100016742 221
150 3300009092 Ga0105250_10003428 Ga0105250_100034287 221
151 3300011119 Ga0105246_10009831 Ga0105246_100098315 221
152 3300011119 Ga0105246_10017249 Ga0105246_100172495 221
153 3300013100 Ga0157373_10000137 Ga0157373_1000013726 221
154 3300013102 Ga0157371_10000810 Ga0157371_1000081013 221
155 3300013102 Ga0157371_10016604 Ga0157371_100166044 221
156 3300013306 Ga0163162_10259195 Ga0163162_102591951 221
157 3300013307 Ga0157372_10029974 Ga0157372_100299747 221
158 3300025711 Ga0207696_1000062 Ga0207696_100006258 221
159 3300025728 Ga0207655_1000007 Ga0207655_1000007177 221
160 3300025728 Ga0207655_1022807 Ga0207655_10228073 221
161 3300027312 Ga0209371_1000005 Ga0209371_1000005516 221
162 3300027312 Ga0209371_1000039 Ga0209371_1000039299 221
163 3300027312 Ga0209371_1000199 Ga0209371_100019956 221
164 3300027312 Ga0209371_1002365 Ga0209371_10023652 221
165 3300030500 Ga0268256_1000006 Ga0268256_1000006541 221
166 3300030500 Ga0268256_1000033 Ga0268256_100003363 221
167 3300030500 Ga0268256_1000618 Ga0268256_10006183 221
168 3300030500 Ga0268256_1001050 Ga0268256_100105010 221
169 3300041405 Ga0439438_004464 Ga0439438_004464_1609_2394 221
170 3300041407 Ga0439447_002812 Ga0439447_002812_1452_2237 221
171 3300046452 Ga0495617_007878 Ga0495617_007878_1197_1982 221
172 3300046458 Ga0495591_000007 Ga0495591_000007_310064_310849 221
173 3300046458 Ga0495591_000318 Ga0495591_000318_30702_31487 221
174 3300046471 Ga0495650_0000026 Ga0495650_0000026_433343_434128 221
175 3300046474 Ga0495605_0042953 Ga0495605_0042953_203_988 221
176 3300046501 Ga0495607_0014568 Ga0495607_0014568_4094_4879 221
177 3300046507 Ga0495606_0012820 Ga0495606_0012820_5202_5987 221
178 3300046523 Ga0495644_0001680 Ga0495644_0001680_6573_7358 221
179 3300046524 Ga0495648_0009418 Ga0495648_0009418_4715_5500 221
180 3300046530 Ga0495654_0000007 Ga0495654_0000007_347200_347985 221
181 3300046530 Ga0495654_0000069 Ga0495654_0000069_78948_79733 221
182 3300046692 Ga0495671_0022125 Ga0495671_0022125_2469_3254 221
183 3300046694 Ga0495649_0019733 Ga0495649_0019733_2293_3078 221
184 3300046794 Ga0495589_0003279 Ga0495589_0003279_4372_5157 221
185 3300046810 Ga0495660_0000016 Ga0495660_0000016_248002_248787 221
186 3300047320 Ga0495672_0000001 Ga0495672_0000001_478023_478808 221
187 3300047469 Ga0495673_0000352 Ga0495673_0000352_464_1249 221
188 3300048903 Ga0496100_0080448 Ga0496100_0080448_387_1172 221
189 3300048904 Ga0496101_0000093 Ga0496101_0000093_66795_67580 221
190 3300048919 Ga0496116_0000086 Ga0496116_0000086_36621_37406 221
191 3300048919 Ga0496116_0006630 Ga0496116_0006630_25_810 221
192 3300048922 Ga0496119_0003501 Ga0496119_0003501_7181_7966 221
193 3300048922 Ga0496119_0087118 Ga0496119_0087118_57_842 221
194 3300048922 Ga0496119_0133318 Ga0496119_0133318_499_1284 221
195 3300048923 Ga0496120_0000002 Ga0496120_0000002_62953_63738 221
196 3300048923 Ga0496120_0000116 Ga0496120_0000116_64619_65404 221
197 3300048923 Ga0496120_0000917 Ga0496120_0000917_15107_15892 221
198 3300048923 Ga0496120_0002795 Ga0496120_0002795_6958_7743 221
199 3300048925 Ga0496122_0003261 Ga0496122_0003261_16468_17253 221
200 3300048926 Ga0496123_0003243 Ga0496123_0003243_17105_17890 221
201 3300048927 Ga0496124_0000357 Ga0496124_0000357_48002_48787 221
202 3300048927 Ga0496124_0006121 Ga0496124_0006121_8835_9620 221
203 3300048929 Ga0496126_0041836 Ga0496126_0041836_535_1320 221
204 3300049459 Ga0495678_001115 Ga0495678_001115_11028_11813 221
205 3300049460 Ga0495682_0000001 Ga0495682_0000001_621722_622507 221
206 3300053126 Ga0500621_000002 Ga0500621_000002_628439_629224 221
207 iso_pu_bacteria 2558860983 2561466428 221
208 iso_pu_bacteria 2891048133 2891050903 221
209 3300025303 Ga0209051_1038275 Ga0209051_10382753 222
210 iso_pu_bacteria 2757320392 2757571228 222
211 iso_pu_bacteria 2995392953 2995393085 222
212 3300048922 Ga0496119_0014717 Ga0496119_0014717_4074_4988 223
213 3300053153 Ga0500616_0000301 Ga0500616_0000301_63229_64053 223
214 iso_pu_bacteria 2791355082 2792581774 223
215 iso_pu_bacteria 8005658619 8005659257 223
216 iso_pu_bacteria 8049293176 8049294950 223
217 iso_pu_bacteria 8055431914 8055435894 223
218 iso_pu_bacteria 2519899620 2520381517 224
219 iso_pu_bacteria 2643221591 2643964498 224
220 iso_pu_bacteria 2643221674 2644413558 224
221 iso_pu_bacteria 2932401849 2932404507 224
222 3300002987 JGI25159J45721_1000530 JGI25159J45721_100053015 225
223 3300003354 JGI25160J50197_1000087 JGI25160J50197_100008780 225
224 3300003374 JGI25161J50226_1000066 JGI25161J50226_100006616 225
225 3300004625 Ga0055543_1000068 Ga0055543_100006880 225
226 3300005262 Ga0065165_1000839 Ga0065165_100083916 225
227 3300006946 Ga0079104_1013531 Ga0079104_10135313 225
228 3300022739 Ga0228711_1000016 Ga0228711_100001612 225
229 3300022740 Ga0228710_1000013 Ga0228710_1000013122 225
230 3300027111 Ga0209281_1000221 Ga0209281_10002218 225
231 3300027666 Ga0209282_1000041 Ga0209282_10000418 225
232 3300031967 Ga0315914_1005042 Ga0315914_10050428 225
233 3300033430 Ga0315913_1003257 Ga0315913_100325716 225
234 3300033464 Ga0315915_1000017 Ga0315915_100001744 225
235 3300048925 Ga0496122_0032026 Ga0496122_0032026_1755_2573 225
236 3300048928 Ga0496125_0028386 Ga0496125_0028386_2042_2860 225
237 3300049571 Ga0501034_0427279 Ga0501034_0427279_260_1063 225
238 3300053125 Ga0500618_000313 Ga0500618_000313_4946_5767 225
239 3300053125 Ga0500618_012244 Ga0500618_012244_952_1779 225
240 iso_pu_bacteria 2510461069 2510841077 225
241 iso_pu_bacteria 2585427528 2585538038 225
242 iso_pu_bacteria 2585427593 2585835986 225
243 iso_pu_bacteria 2643221653 2644300354 225
244 iso_pu_bacteria 2643221719 2644658578 225
245 iso_pu_bacteria 2818991272 2819242027 225
246 iso_pu_bacteria 2899803654 2899809004 225
247 iso_pu_bacteria 2989776772 2989778697 225
248 iso_pu_bacteria 8005246636 8005250729 225
249 3300025284 Ga0209130_1024642 Ga0209130_10246421 226
250 3300044765 Ga0466970_0000517 Ga0466970_0000517_22_966 226
251 3300045836 Ga0466958_0025411 Ga0466958_0025411_1593_2492 226
252 3300048903 Ga0496100_0017847 Ga0496100_0017847_2700_3653 226
253 3300048905 Ga0496102_0010757 Ga0496102_0010757_1100_2053 226
254 3300048919 Ga0496116_0005431 Ga0496116_0005431_2012_2965 226
255 3300048920 Ga0496117_0000353 Ga0496117_0000353_22830_23783 226
256 3300048921 Ga0496118_0000204 Ga0496118_0000204_48182_49135 226
257 3300048922 Ga0496119_0004804 Ga0496119_0004804_9355_10308 226
258 3300048923 Ga0496120_0009779 Ga0496120_0009779_1760_2713 226
259 3300048924 Ga0496121_0000378 Ga0496121_0000378_66170_67123 226
260 3300048925 Ga0496122_0008819 Ga0496122_0008819_3922_4875 226
261 3300048926 Ga0496123_0002174 Ga0496123_0002174_19337_20290 226
262 3300049573 Ga0501037_0088749 Ga0501037_0088749_749_1558 226
263 3300049822 Ga0501035_0195416 Ga0501035_0195416_417_1226 226
264 3300049823 Ga0501044_0091936 Ga0501044_0091936_1561_2370 226
265 iso_pu_bacteria 2534681796 2535516599 226
266 iso_pu_bacteria 2751185800 2753357176 226
267 iso_pu_bacteria 2758568016 2758639582 226
268 iso_pu_bacteria 2915650412 2915652038 226
269 iso_pu_bacteria 2513237144 2513914100 227
270 iso_pu_bacteria 2513237146 2513926077 227
271 iso_pu_bacteria 2516143018 2516209680 227
272 iso_pu_bacteria 2582581294 2585200279 227
273 iso_pu_bacteria 2599185170 2599417550 227
274 iso_pu_bacteria 2615840624 2616293520 227
275 iso_pu_bacteria 2690316117 2692315858 227
276 iso_pu_bacteria 2718217882 2719181656 227
277 iso_pu_bacteria 2718218009 2719732320 227
278 iso_pu_bacteria 2718218363 2721147748 227
279 iso_pu_bacteria 2718218365 2721159196 227
280 iso_pu_bacteria 2718218366 2721164583 227
281 iso_pu_bacteria 2721755514 2722840753 227
282 iso_pu_bacteria 2721755810 2724045076 227
283 iso_pu_bacteria 2724679232 2725952708 227
284 iso_pu_bacteria 2728369365 2730164891 227
285 iso_pu_bacteria 2728369397 2730298828 227
286 iso_pu_bacteria 2751185821 2753461852 227
287 iso_pu_bacteria 2791355091 2792620157 227
288 iso_pu_bacteria 2791355092 2792626423 227
289 iso_pu_bacteria 2791355094 2792639371 227
290 iso_pu_bacteria 2791355260 2793320520 227
291 iso_pu_bacteria 2791355261 2793330440 227
292 iso_pu_bacteria 2791355263 2793344286 227
293 iso_pu_bacteria 2791355264 2793348728 227
294 iso_pu_bacteria 2838035591 2838038238 227
295 iso_pu_bacteria 2838042994 2838043824 227
296 iso_pu_bacteria 2838661181 2838661885 227
297 iso_pu_bacteria 2847417321 2847419077 227
298 iso_pu_bacteria 2848992105 2848994108 227
299 iso_pu_bacteria 2855872281 2855876753 227
300 iso_pu_bacteria 2933016740 2933018390 227
301 iso_pu_bacteria 2936381700 2936383040 227
302 iso_pu_bacteria 2996893221 2996898686 227
303 iso_pu_bacteria 3005409236 3005414987 227
304 iso_pu_bacteria 643692032 643825963 227
305 iso_pu_bacteria 8005301065 8005302961 227
306 iso_pu_bacteria 8005382845 8005386502 227
307 iso_pu_bacteria 8005395548 8005396280 227
308 iso_pu_bacteria 8005688590 8005692270 227
309 iso_pu_bacteria 8018127388 8018133926 227
310 3300025292 Ga0209676_1007095 Ga0209676_10070953 228
311 3300025297 Ga0209758_1000418 Ga0209758_10004185 228
312 3300025298 Ga0209050_1009223 Ga0209050_10092232 228
313 3300025303 Ga0209051_1001051 Ga0209051_10010516 228
314 3300025304 Ga0209257_1007766 Ga0209257_10077665 228
315 3300048928 Ga0496125_0000282 Ga0496125_0000282_70081_70899 228
316 3300048929 Ga0496126_0000703 Ga0496126_0000703_46471_47286 228
317 iso_pu_bacteria 2509276033 2509446848 228
318 iso_pu_bacteria 2510065019 2510133800 228
319 iso_pu_bacteria 2510461076 2510895229 228
320 iso_pu_bacteria 2510917028 2511181650 228
321 iso_pu_bacteria 2510917030 2511194381 228
322 iso_pu_bacteria 2513237084 2513574159 228
323 iso_pu_bacteria 2513237085 2513576805 228
324 iso_pu_bacteria 2513237088 2513594686 228
325 iso_pu_bacteria 2513237093 2513629549 228
326 iso_pu_bacteria 2513237103 2513708190 228
327 iso_pu_bacteria 2513237138 2513864754 228
328 iso_pu_bacteria 2513237162 2514020151 228
329 iso_pu_bacteria 2515075009 2515112846 228
330 iso_pu_bacteria 2515154113 2515636467 228
331 iso_pu_bacteria 2515154114 2515640817 228
332 iso_pu_bacteria 2515154116 2515655499 228
333 iso_pu_bacteria 2515154134 2515739343 228
334 iso_pu_bacteria 2516653077 2517036553 228
335 iso_pu_bacteria 2516653085 2517076923 228
336 iso_pu_bacteria 2517093000 2517095685 228
337 iso_pu_bacteria 2517287029 2517407249 228
338 iso_pu_bacteria 2529292951 2530646157 228
339 iso_pu_bacteria 2582581298 2585222622 228
340 iso_pu_bacteria 2582581867 2585402116 228
341 iso_pu_bacteria 2585427526 2585527301 228
342 iso_pu_bacteria 2585427529 2585545205 228
343 iso_pu_bacteria 2585427590 2585821901 228
344 iso_pu_bacteria 2643221568 2643857660 228
345 iso_pu_bacteria 2643221599 2644003868 228
346 iso_pu_bacteria 2657244999 2657681176 228
347 iso_pu_bacteria 2718217927 2719386189 228
348 iso_pu_bacteria 2718217997 2719665997 228
349 iso_pu_bacteria 2718218199 2720492417 228
350 iso_pu_bacteria 2718218232 2720613772 228
351 iso_pu_bacteria 2718218233 2720620560 228
352 iso_pu_bacteria 2718218235 2720631985 228
353 iso_pu_bacteria 2718218269 2720775713 228
354 iso_pu_bacteria 2718218423 2721399971 228
355 iso_pu_bacteria 2721755556 2723027320 228
356 iso_pu_bacteria 2721755684 2723560939 228
357 iso_pu_bacteria 2721755685 2723567532 228
358 iso_pu_bacteria 2721755809 2724038784 228
359 iso_pu_bacteria 2721755819 2724090320 228
360 iso_pu_bacteria 2721755822 2724104797 228
361 iso_pu_bacteria 2721755823 2724110598 228
362 iso_pu_bacteria 2728369352 2730108256 228
363 iso_pu_bacteria 2738541333 2739032695 228
364 iso_pu_bacteria 2765235942 2766065722 228
365 iso_pu_bacteria 2791355256 2793298714 228
366 iso_pu_bacteria 2791355259 2793314684 228
367 iso_pu_bacteria 2791355262 2793338337 228
368 iso_pu_bacteria 2791355265 2793351981 228
369 iso_pu_bacteria 2791355267 2793370334 228
370 iso_pu_bacteria 2802429268 2804752375 228
371 iso_pu_bacteria 2802429605 2805931004 228
372 iso_pu_bacteria 2802429606 2805937981 228
373 iso_pu_bacteria 2802429633 2806043675 228
374 iso_pu_bacteria 2802429634 2806050394 228
375 iso_pu_bacteria 2802429635 2806057211 228
376 iso_pu_bacteria 2802429636 2806064592 228
377 iso_pu_bacteria 2802429637 2806071859 228
378 iso_pu_bacteria 2838016132 2838017815 228
379 iso_pu_bacteria 2838048938 2838051893 228
380 iso_pu_bacteria 2838061910 2838068487 228
381 iso_pu_bacteria 2838068647 2838070305 228
382 iso_pu_bacteria 2838668709 2838674157 228
383 iso_pu_bacteria 2838680041 2838681756 228
384 iso_pu_bacteria 2838686498 2838687197 228
385 iso_pu_bacteria 2838694306 2838696328 228
386 iso_pu_bacteria 2838729681 2838729831 228
387 iso_pu_bacteria 2838742623 2838743154 228
388 iso_pu_bacteria 2841851746 2841852640 228
389 iso_pu_bacteria 2841864319 2841869941 228
390 iso_pu_bacteria 2842118031 2842118884 228
391 iso_pu_bacteria 2842156927 2842157900 228
392 iso_pu_bacteria 2842163707 2842167551 228
393 iso_pu_bacteria 2842180545 2842181519 228
394 iso_pu_bacteria 2842192696 2842198420 228
395 iso_pu_bacteria 2842205361 2842205635 228
396 iso_pu_bacteria 2842217011 2842217783 228
397 iso_pu_bacteria 2842229732 2842230430 228
398 iso_pu_bacteria 2842243621 2842244332 228
399 iso_pu_bacteria 2842250916 2842256351 228
400 iso_pu_bacteria 2842257432 2842257582 228
401 iso_pu_bacteria 2842264693 2842265647 228
402 iso_pu_bacteria 2842271015 2842271265 228
403 iso_pu_bacteria 2842278818 2842279092 228
404 iso_pu_bacteria 2842285085 2842285755 228
405 iso_pu_bacteria 2842311132 2842315071 228
406 iso_pu_bacteria 2842341865 2842346312 228
407 iso_pu_bacteria 2842363717 2842369109 228
408 iso_pu_bacteria 2842370503 2842372323 228
409 iso_pu_bacteria 2842384541 2842385394 228
410 iso_pu_bacteria 2842395702 2842401924 228
411 iso_pu_bacteria 2842402390 2842403115 228
412 iso_pu_bacteria 2842409023 2842409512 228
413 iso_pu_bacteria 2842415677 2842416165 228
414 iso_pu_bacteria 2842422224 2842423919 228
415 iso_pu_bacteria 2842447887 2842452936 228
416 iso_pu_bacteria 2842495871 2842496983 228
417 iso_pu_bacteria 2844454524 2844458563 228
418 iso_pu_bacteria 2857516855 2857517584 228
419 iso_pu_bacteria 2913295892 2913300847 228
420 iso_pu_bacteria 2919100787 2919106505 228
421 iso_pu_bacteria 2919166419 2919167840 228
422 iso_pu_bacteria 2923556063 2923558035 228
423 iso_pu_bacteria 2933570622 2933570701 228
424 iso_pu_bacteria 2933586486 2933591205 228
425 iso_pu_bacteria 2933599457 2933601110 228
426 iso_pu_bacteria 2935894831 2935900667 228
427 iso_pu_bacteria 2935901341 2935902100 228
428 iso_pu_bacteria 2936367885 2936372191 228
429 iso_pu_bacteria 2936375103 2936381006 228
430 iso_pu_bacteria 2978969890 2978974292 228
431 iso_pu_bacteria 2984587000 2984589634 228
432 iso_pu_bacteria 2996887358 2996891812 228
433 iso_pu_bacteria 3005445848 3005448241 228
434 iso_pu_bacteria 639633055 639649049 228
435 iso_pu_bacteria 8005258706 8005263143 228
436 iso_pu_bacteria 8005275841 8005280978 228
437 iso_pu_bacteria 8005282627 8005285149 228
438 iso_pu_bacteria 8005289223 8005293486 228
439 iso_pu_bacteria 8005307578 8005312688 228
440 iso_pu_bacteria 8005321885 8005326339 228
441 iso_pu_bacteria 8005376324 8005380777 228
442 iso_pu_bacteria 8005430974 8005434991 228
443 iso_pu_bacteria 8005460587 8005463520 228
444 iso_pu_bacteria 8005497431 8005500730 228
445 iso_pu_bacteria 8005542996 8005545257 228
446 iso_pu_bacteria 8005563573 8005567841 228
447 iso_pu_bacteria 8005570704 8005573614 228
448 iso_pu_bacteria 8005619151 8005622106 228
449 iso_pu_bacteria 8005626139 8005632412 228
450 iso_pu_bacteria 8005668836 8005672149 228
451 iso_pu_bacteria 8005695170 8005699733 228
452 iso_pu_bacteria 8018163183 8018166243 228
453 iso_pu_bacteria 8018176218 8018181474 228
454 iso_pu_bacteria 8023680758 8023683315 228
455 iso_pu_bacteria 8024479707 8024483016 228
456 iso_pu_bacteria 8024501048 8024503915 228
457 iso_pu_bacteria 8056375014 8056378364 228
458 iso_pu_bacteria 8056382006 8056386570 228
459 iso_pu_bacteria 8057874678 8057877391 228
460 3300044765 Ga0466970_0197868 Ga0466970_0197868_46_873 229
461 3300053140 Ga0500573_0000259 Ga0500573_0000259_13111_13932 229
462 iso_pu_bacteria 2508501122 2509111387 229
463 iso_pu_bacteria 2509276019 2509375674 229
464 iso_pu_bacteria 2510065057 2510303300 229
465 iso_pu_bacteria 2511231052 2511501959 229
466 iso_pu_bacteria 2512047086 2512533330 229
467 iso_pu_bacteria 2512875026 2512971115 229
468 iso_pu_bacteria 2513237086 2513584743 229
469 iso_pu_bacteria 2513237089 2513604528 229
470 iso_pu_bacteria 2513237091 2513615451 229
471 iso_pu_bacteria 2513237140 2513881239 229
472 iso_pu_bacteria 2513237143 2513902371 229
473 iso_pu_bacteria 2513237156 2513984613 229
474 iso_pu_bacteria 2513237160 2514007581 229
475 iso_pu_bacteria 2515154107 2515608749 229
476 iso_pu_bacteria 2516653046 2516893254 229
477 iso_pu_bacteria 2517487022 2517570001 229
478 iso_pu_bacteria 2524023207 2524448844 229
479 iso_pu_bacteria 2537561587 2537877728 229
480 iso_pu_bacteria 2551306084 2551674933 229
481 iso_pu_bacteria 2551306084 2551680187 229
482 iso_pu_bacteria 2551306085 2551684836 229
483 iso_pu_bacteria 2551306086 2551695934 229
484 iso_pu_bacteria 2551306087 2551704472 229
485 iso_pu_bacteria 2551306089 2551711463 229
486 iso_pu_bacteria 2551306090 2551720832 229
487 iso_pu_bacteria 2551306091 2551728684 229
488 iso_pu_bacteria 2551306092 2551735015 229
489 iso_pu_bacteria 2551306093 2551739435 229
490 iso_pu_bacteria 2554235003 2554247610 229
491 iso_pu_bacteria 2558860100 2558867990 229
492 iso_pu_bacteria 2558860242 2559294743 229
493 iso_pu_bacteria 2582581299 2585229901 229
494 iso_pu_bacteria 2582581304 2585254865 229
495 iso_pu_bacteria 2585427594 2585846824 229
496 iso_pu_bacteria 2599185210 2599604007 229
497 iso_pu_bacteria 2643221558 2643811649 229
498 iso_pu_bacteria 2643221582 2643919230 229
499 iso_pu_bacteria 2643221634 2644192607 229
500 iso_pu_bacteria 2643221643 2644239675 229
501 iso_pu_bacteria 2643221693 2644522136 229
502 iso_pu_bacteria 2738541293 2738804214 229
503 iso_pu_bacteria 2802428858 2802719496 229
504 iso_pu_bacteria 2802428859 2802726911 229
505 iso_pu_bacteria 2802428860 2802732230 229
506 iso_pu_bacteria 2802428861 2802739833 229
507 iso_pu_bacteria 2802428862 2802745339 229
508 iso_pu_bacteria 2802428863 2802752731 229
509 iso_pu_bacteria 2808606387 2808985488 229
510 iso_pu_bacteria 2818991439 2819559971 229
511 iso_pu_bacteria 2837678835 2837679770 229
512 iso_pu_bacteria 2838074704 2838079602 229
513 iso_pu_bacteria 2838675328 2838676336 229
514 iso_pu_bacteria 2838714209 2838715219 229
515 iso_pu_bacteria 2838719591 2838720981 229
516 iso_pu_bacteria 2838724970 2838725977 229
517 iso_pu_bacteria 2841846520 2841847939 229
518 iso_pu_bacteria 2841859092 2841859509 229
519 iso_pu_bacteria 2842124991 2842126031 229
520 iso_pu_bacteria 2842130223 2842131230 229
521 iso_pu_bacteria 2842152218 2842153600 229
522 iso_pu_bacteria 2842170452 2842171462 229
523 iso_pu_bacteria 2842175837 2842177220 229
524 iso_pu_bacteria 2842187318 2842188327 229
525 iso_pu_bacteria 2842211629 2842212638 229
526 iso_pu_bacteria 2842224351 2842225743 229
527 iso_pu_bacteria 2842515876 2842516294 229
528 iso_pu_bacteria 2850079185 2850081150 229
529 iso_pu_bacteria 2855825444 2855825980 229
530 iso_pu_bacteria 2855839649 2855841326 229
531 iso_pu_bacteria 2858800743 2858802307 229
532 iso_pu_bacteria 2889790730 2889795854 229
533 iso_pu_bacteria 2889914905 2889917769 229
534 iso_pu_bacteria 2896384573 2896389945 229
535 iso_pu_bacteria 2899792073 2899796306 229
536 iso_pu_bacteria 2899845264 2899849472 229
537 iso_pu_bacteria 2915980308 2915981911 229
538 iso_pu_bacteria 2915986958 2915991354 229
539 iso_pu_bacteria 2915993759 2915994372 229
540 iso_pu_bacteria 2916000859 2916002202 229
541 iso_pu_bacteria 2916007675 2916009176 229
542 iso_pu_bacteria 2916014648 2916018208 229
543 iso_pu_bacteria 2916021584 2916022727 229
544 iso_pu_bacteria 2916028427 2916029424 229
545 iso_pu_bacteria 2916035215 2916035988 229
546 iso_pu_bacteria 2916041962 2916042529 229
547 iso_pu_bacteria 2916048683 2916052269 229
548 iso_pu_bacteria 2916055098 2916061455 229
549 iso_pu_bacteria 2916061851 2916067597 229
550 iso_pu_bacteria 2916076590 2916080856 229
551 iso_pu_bacteria 2919114240 2919115311 229
552 iso_pu_bacteria 2920760137 2920766102 229
553 iso_pu_bacteria 2921201388 2921201945 229
554 iso_pu_bacteria 2921208531 2921210484 229
555 iso_pu_bacteria 2921237296 2921238983 229
556 iso_pu_bacteria 2921244191 2921244569 229
557 iso_pu_bacteria 2921250672 2921251194 229
558 iso_pu_bacteria 2921257292 2921262481 229
559 iso_pu_bacteria 2921263974 2921270815 229
560 iso_pu_bacteria 2921282425 2921284314 229
561 iso_pu_bacteria 2921289301 2921291261 229
562 iso_pu_bacteria 2921296804 2921300803 229
563 iso_pu_bacteria 2924144063 2924144444 229
564 iso_pu_bacteria 2924150972 2924152328 229
565 iso_pu_bacteria 2924158325 2924160756 229
566 iso_pu_bacteria 2924172951 2924173630 229
567 iso_pu_bacteria 2924179722 2924181191 229
568 iso_pu_bacteria 2924186466 2924187731 229
569 iso_pu_bacteria 2924193448 2924200436 229
570 iso_pu_bacteria 2924200457 2924206871 229
571 iso_pu_bacteria 2924207177 2924213965 229
572 iso_pu_bacteria 2924214083 2924214962 229
573 iso_pu_bacteria 2924221636 2924222979 229
574 iso_pu_bacteria 2924228884 2924229325 229
575 iso_pu_bacteria 2926754445 2926756357 229
576 iso_pu_bacteria 2926760298 2926760579 229
577 iso_pu_bacteria 2929138655 2929140442 229
578 iso_pu_bacteria 2933006813 2933008243 229
579 iso_pu_bacteria 2933011516 2933013064 229
580 iso_pu_bacteria 2936996657 2937002092 229
581 iso_pu_bacteria 2937002841 2937003433 229
582 iso_pu_bacteria 2937009748 2937014130 229
583 iso_pu_bacteria 2937016420 2937018625 229
584 iso_pu_bacteria 2937023124 2937028959 229
585 iso_pu_bacteria 2937029754 2937033430 229
586 iso_pu_bacteria 2937036028 2937038605 229
587 iso_pu_bacteria 2937042894 2937044353 229
588 iso_pu_bacteria 2937049772 2937051073 229
589 iso_pu_bacteria 2937056579 2937062332 229
590 iso_pu_bacteria 2937063883 2937065237 229
591 iso_pu_bacteria 2937071275 2937072407 229
592 iso_pu_bacteria 2937078374 2937079777 229
593 iso_pu_bacteria 2937084907 2937088082 229
594 iso_pu_bacteria 2937091812 2937097581 229
595 iso_pu_bacteria 2937098957 2937099528 229
596 iso_pu_bacteria 2937106411 2937110002 229
597 iso_pu_bacteria 2937113482 2937119017 229
598 iso_pu_bacteria 2937119839 2937126051 229
599 iso_pu_bacteria 2937126314 2937126844 229
600 iso_pu_bacteria 2957375807 2957376562 229
601 iso_pu_bacteria 2957382221 2957388456 229
602 iso_pu_bacteria 2957388812 2957394837 229
603 iso_pu_bacteria 2957395598 2957398283 229
604 iso_pu_bacteria 2957402308 2957408798 229
605 iso_pu_bacteria 2957408893 2957414738 229
606 iso_pu_bacteria 2957415311 2957416011 229
607 iso_pu_bacteria 2957422303 2957424207 229
608 iso_pu_bacteria 2957430029 2957430987 229
609 iso_pu_bacteria 2957437181 2957441243 229
610 iso_pu_bacteria 2957443900 2957444981 229
611 iso_pu_bacteria 2957450854 2957451404 229
612 iso_pu_bacteria 2957457609 2957458670 229
613 iso_pu_bacteria 2957464669 2957471101 229
614 iso_pu_bacteria 2957471148 2957472068 229
615 iso_pu_bacteria 2957478035 2957484437 229
616 iso_pu_bacteria 2957484790 2957486192 229
617 iso_pu_bacteria 2957491536 2957492019 229
618 iso_pu_bacteria 2957498199 2957503697 229
619 iso_pu_bacteria 2957505466 2957507114 229
620 iso_pu_bacteria 2960584000 2960586187 229
621 iso_pu_bacteria 2960591022 2960592738 229
622 iso_pu_bacteria 2960597568 2960598009 229
623 iso_pu_bacteria 2960603979 2960604775 229
624 iso_pu_bacteria 2960610863 2960612413 229
625 iso_pu_bacteria 2960617483 2960620021 229
626 iso_pu_bacteria 2960624210 2960629235 229
627 iso_pu_bacteria 2960631154 2960632856 229
628 iso_pu_bacteria 2960637947 2960640061 229
629 iso_pu_bacteria 2960645483 2960647101 229
630 iso_pu_bacteria 2960652885 2960655289 229
631 iso_pu_bacteria 2960660292 2960660857 229
632 iso_pu_bacteria 2960667422 2960673781 229
633 iso_pu_bacteria 2960674078 2960675559 229
634 iso_pu_bacteria 2960680706 2960681838 229
635 iso_pu_bacteria 2960687367 2960688007 229
636 iso_pu_bacteria 2960693952 2960700550 229
637 iso_pu_bacteria 2964607997 2964609704 229
638 iso_pu_bacteria 2964615318 2964616563 229
639 iso_pu_bacteria 2964621998 2964623732 229
640 iso_pu_bacteria 2964628898 2964629433 229
641 iso_pu_bacteria 2964636051 2964640939 229
642 iso_pu_bacteria 2964643177 2964649046 229
643 iso_pu_bacteria 2964649959 2964651794 229
644 iso_pu_bacteria 2964656573 2964661018 229
645 iso_pu_bacteria 2964663802 2964670789 229
646 iso_pu_bacteria 2964670856 2964673622 229
647 iso_pu_bacteria 2964678106 2964680024 229
648 iso_pu_bacteria 2964685014 2964686269 229
649 iso_pu_bacteria 2964691889 2964693088 229
650 iso_pu_bacteria 2964698721 2964699848 229
651 iso_pu_bacteria 2964705432 2964706093 229
652 iso_pu_bacteria 2964712639 2964713945 229
653 iso_pu_bacteria 2964719344 2964721500 229
654 iso_pu_bacteria 2967664464 2967665508 229
655 iso_pu_bacteria 2967671571 2967671982 229
656 iso_pu_bacteria 2967678726 2967681864 229
657 iso_pu_bacteria 2967686174 2967691679 229
658 iso_pu_bacteria 2967693043 2967695262 229
659 iso_pu_bacteria 2967699805 2967701918 229
660 iso_pu_bacteria 2967706974 2967708231 229
661 iso_pu_bacteria 2967714385 2967716654 229
662 iso_pu_bacteria 2967721400 2967721655 229
663 iso_pu_bacteria 2967728569 2967734962 229
664 iso_pu_bacteria 2967735183 2967736853 229
665 iso_pu_bacteria 2967742019 2967744349 229
666 iso_pu_bacteria 2967748971 2967753310 229
667 iso_pu_bacteria 2967755722 2967758736 229
668 iso_pu_bacteria 2967762386 2967765372 229
669 iso_pu_bacteria 2967769361 2967770964 229
670 iso_pu_bacteria 2967775926 2967778384 229
671 iso_pu_bacteria 2970019648 2970026526 229
672 iso_pu_bacteria 2970026789 2970031033 229
673 iso_pu_bacteria 2970033650 2970039713 229
674 iso_pu_bacteria 2970040964 2970041321 229
675 iso_pu_bacteria 2970047711 2970053627 229
676 iso_pu_bacteria 2970054988 2970061209 229
677 iso_pu_bacteria 2970061556 2970063307 229
678 iso_pu_bacteria 2970068827 2970073008 229
679 iso_pu_bacteria 2970076120 2970082721 229
680 iso_pu_bacteria 2970082768 2970083733 229
681 iso_pu_bacteria 2970088815 2970089290 229
682 iso_pu_bacteria 2970095765 2970096769 229
683 iso_pu_bacteria 2970102677 2970107486 229
684 iso_pu_bacteria 2970109326 2970116095 229
685 iso_pu_bacteria 2970116247 2970122173 229
686 iso_pu_bacteria 2970122695 2970122959 229
687 iso_pu_bacteria 2970129317 2970131676 229
688 iso_pu_bacteria 2970136068 2970138449 229
689 iso_pu_bacteria 2970143518 2970144121 229
690 iso_pu_bacteria 2970149975 2970150821 229
691 iso_pu_bacteria 2970164137 2970170385 229
692 iso_pu_bacteria 2970177841 2970178384 229
693 iso_pu_bacteria 2970184632 2970186169 229
694 iso_pu_bacteria 2970191845 2970192271 229
695 iso_pu_bacteria 2977516862 2977522410 229
696 iso_pu_bacteria 2977523885 2977524373 229
697 iso_pu_bacteria 2977530762 2977531648 229
698 iso_pu_bacteria 2977537788 2977544334 229
699 iso_pu_bacteria 2977544691 2977549063 229
700 iso_pu_bacteria 2977551784 2977554425 229
701 iso_pu_bacteria 2977558990 2977560894 229
702 iso_pu_bacteria 2977565890 2977572654 229
703 iso_pu_bacteria 2977572785 2977579610 229
704 iso_pu_bacteria 2977579622 2977580166 229
705 iso_pu_bacteria 2979089926 2979094141 229
706 iso_pu_bacteria 2979095461 2979098478 229
707 iso_pu_bacteria 2979100975 2979106095 229
708 iso_pu_bacteria 2984509177 2984512116 229
709 iso_pu_bacteria 2984518228 2984521523 229
710 iso_pu_bacteria 2984537506 2984540817 229
711 iso_pu_bacteria 2984601300 2984603085 229
712 iso_pu_bacteria 3005452660 3005454349 229
713 iso_pu_bacteria 648276728 648741750 229
714 iso_pu_bacteria 650716007 650739993 229
715 iso_pu_bacteria 8003570095 8003570992 229
716 iso_pu_bacteria 8003992118 8003993835 229
717 iso_pu_bacteria 8003999396 8004001372 229
718 iso_pu_bacteria 8054460903 8054462316 229
719 3300049570 Ga0501033_0000167 Ga0501033_0000167_7258_8199 230
720 3300049744 Ga0501083_0092066 Ga0501083_0092066_972_1787 230
721 3300049776 Ga0501280_000582 Ga0501280_000582_4277_5191 230
722 3300049822 Ga0501035_0006797 Ga0501035_0006797_5716_6657 230
723 iso_pu_bacteria 2599185156 2599331571 230
724 iso_pu_bacteria 2599185352 2600193102 230
725 iso_pu_bacteria 2643221557 2643803601 230
726 iso_pu_bacteria 2643221610 2644067569 230
727 iso_pu_bacteria 2643221618 2644107716 230
728 iso_pu_bacteria 2643221626 2644148613 230
729 iso_pu_bacteria 2643221655 2644309110 230
730 iso_pu_bacteria 2643221659 2644332937 230
731 iso_pu_bacteria 2643221668 2644375248 230
732 iso_pu_bacteria 2643221675 2644418622 230
733 iso_pu_bacteria 2643221680 2644451989 230
734 iso_pu_bacteria 2643221698 2644545891 230
735 iso_pu_bacteria 2643221712 2644615052 230
736 iso_pu_bacteria 2643221723 2644676588 230
737 iso_pu_bacteria 2643221726 2644690751 230
738 iso_pu_bacteria 2842922631 2842923969 230
739 iso_pu_bacteria 2844163670 2844167571 230
740 iso_pu_bacteria 2891373044 2891373151 230
741 iso_pu_bacteria 2920822456 2920824711 230
742 iso_pu_bacteria 2941499720 2941504987 230
743 iso_pu_bacteria 2989349275 2989349409 230
744 iso_pu_bacteria 2989771324 2989773853 230
745 iso_pu_bacteria 8056875544 8056877773 230
746 3300025299 Ga0209256_1003768 Ga0209256_100376811 231
747 3300042007 Ga0439449_0015007 Ga0439449_0015007_238_1059 231
748 iso_pu_bacteria 2510917026 2511171678 231
749 iso_pu_bacteria 2513237159 2513997076 231
750 iso_pu_bacteria 2582581283 2585166120 231
751 iso_pu_bacteria 2582581306 2585267675 231
752 iso_pu_bacteria 2582581865 2585386734 231
753 iso_pu_bacteria 2582581866 2585393038 231
754 iso_pu_bacteria 2585427633 2585996018 231
755 iso_pu_bacteria 2585427634 2586000622 231
756 iso_pu_bacteria 2643221607 2644050748 231
757 iso_pu_bacteria 2643221636 2644205222 231
758 iso_pu_bacteria 2643221637 2644210235 231
759 iso_pu_bacteria 2643221686 2644483666 231
760 iso_pu_bacteria 2643221688 2644491791 231
761 iso_pu_bacteria 2643221689 2644501337 231
762 iso_pu_bacteria 2643221718 2644653787 231
763 iso_pu_bacteria 2837651117 2837652182 231
764 iso_pu_bacteria 2842521101 2842522682 231
765 iso_pu_bacteria 2919171160 2919174971 231
766 iso_pu_bacteria 8054558443 8054560250 231
767 3300002739 JGI25158J39367_1000764 JGI25158J39367_10007645 232
768 3300002773 JGI25152J39213_1004071 JGI25152J39213_10040716 232
769 3300002774 JGI25150J39212_1005593 JGI25150J39212_10055931 232
770 3300002987 JGI25159J45721_1000199 JGI25159J45721_100019916 232
771 3300003215 JGI25153J46596_10005215 JGI25153J46596_100052152 232
772 3300003215 JGI25153J46596_10008879 JGI25153J46596_100088792 232
773 3300003374 JGI25161J50226_1000207 JGI25161J50226_100020745 232
774 3300003771 Ga0055526_1003679 Ga0055526_10036792 232
775 3300003790 Ga0055528_1019378 Ga0055528_10193784 232
776 3300003792 Ga0055540_1012253 Ga0055540_10122535 232
777 3300004625 Ga0055543_1000053 Ga0055543_100005329 232
778 3300005353 Ga0070669_100215989 Ga0070669_1002159892 232
779 3300021320 Ga0214544_1001682 Ga0214544_100168212 232
780 3300021321 Ga0214542_1001614 Ga0214542_100161411 232
781 3300021327 Ga0214543_1001395 Ga0214543_100139511 232
782 3300025208 Ga0209436_100085 Ga0209436_10008517 232
783 3300025245 Ga0207425_1001564 Ga0207425_10015647 232
784 3300025258 Ga0209129_1002960 Ga0209129_10029608 232
785 3300025273 Ga0209673_1003537 Ga0209673_10035373 232
786 3300025284 Ga0209130_1000081 Ga0209130_100008159 232
787 3300025294 Ga0209025_1025145 Ga0209025_10251454 232
788 3300025295 Ga0209564_1000260 Ga0209564_100026080 232
789 3300025297 Ga0209758_1001270 Ga0209758_100127012 232
790 3300025297 Ga0209758_1001756 Ga0209758_100175620 232
791 3300025302 Ga0207426_1000008 Ga0207426_1000008539 232
792 3300025304 Ga0209257_1036739 Ga0209257_10367393 232
793 3300025923 Ga0207681_10140175 Ga0207681_101401753 232
794 3300028379 Ga0268266_10197077 Ga0268266_101970772 232
795 3300041413 Ga0439465_0011462 Ga0439465_0011462_910_1725 232
796 3300048924 Ga0496121_0009399 Ga0496121_0009399_6505_7320 232
797 3300048927 Ga0496124_0049824 Ga0496124_0049824_1591_2406 232
798 3300048928 Ga0496125_0041019 Ga0496125_0041019_186_1001 232
799 3300049571 Ga0501034_0002538 Ga0501034_0002538_17540_18367 232
800 3300053156 Ga0500622_0001146 Ga0500622_0001146_14428_15243 232
801 iso_pu_bacteria 2510917022 2511135221 232
802 iso_pu_bacteria 2524023209 2524460169 232
803 iso_pu_bacteria 2582581307 2585270958 232
804 iso_pu_bacteria 2582581308 2585277307 232
805 iso_pu_bacteria 2585427527 2585533958 232
806 iso_pu_bacteria 2585427530 2585552191 232
807 iso_pu_bacteria 2585427531 2585558682 232
808 iso_pu_bacteria 2585427609 2585904348 232
809 iso_pu_bacteria 2585428125 2587980535 232
810 iso_pu_bacteria 2599185236 2599720972 232
811 iso_pu_bacteria 2600254933 2600375710 232
812 iso_pu_bacteria 2615840626 2616308686 232
813 iso_pu_bacteria 2667528174 2671111617 232
814 iso_pu_bacteria 2818991453 2819637805 232
815 iso_pu_bacteria 2818991461 2819684743 232
816 iso_pu_bacteria 2821123053 2821129486 232
817 iso_pu_bacteria 2838736955 2838738482 232
818 iso_pu_bacteria 2841840854 2841841149 232
819 iso_pu_bacteria 2842140634 2842140927 232
820 iso_pu_bacteria 2842298080 2842301929 232
821 iso_pu_bacteria 2842357229 2842357605 232
822 iso_pu_bacteria 2842509118 2842511321 232
823 iso_pu_bacteria 2919408235 2919411588 232
824 iso_pu_bacteria 8005484373 8005485251 232
825 iso_pu_bacteria 8018150411 8018155577 232
826 iso_pu_bacteria 8046767195 8046770427 232
827 iso_pu_bacteria 8057575449 8057575932 232
828 3300003320 rootH2_10150379 rootH2_101503792 233
829 3300003856 Ga0058692_1000350 Ga0058692_10003507 233
830 3300003856 Ga0058692_1006447 Ga0058692_10064475 233
831 3300006051 Ga0075364_10224605 Ga0075364_102246052 233
832 3300006178 Ga0075367_10014267 Ga0075367_100142673 233
833 3300006178 Ga0075367_10277944 Ga0075367_102779442 233
834 3300006186 Ga0075369_10014994 Ga0075369_100149942 233
835 3300006948 Ga0099826_10012274 Ga0099826_100122744 233
836 3300009148 Ga0105243_10023405 Ga0105243_100234055 233
837 3300013100 Ga0157373_10007245 Ga0157373_100072455 233
838 3300013102 Ga0157371_10000015 Ga0157371_1000001546 233
839 3300013104 Ga0157370_10000402 Ga0157370_1000040218 233
840 3300021327 Ga0214543_1000078 Ga0214543_100007814 233
841 3300025272 Ga0209455_1014550 Ga0209455_10145501 233
842 3300025294 Ga0209025_1000094 Ga0209025_100009451 233
843 3300027312 Ga0209371_1000021 Ga0209371_1000021150 233
844 3300027312 Ga0209371_1000229 Ga0209371_100022912 233
845 3300027666 Ga0209282_1054726 Ga0209282_10547261 233
846 3300027866 Ga0209813_10033758 Ga0209813_100337582 233
847 3300030500 Ga0268256_1000020 Ga0268256_1000020156 233
848 3300030500 Ga0268256_1003171 Ga0268256_10031715 233
849 3300030744 Ga0316181_1097185 Ga0316181_10971852 233
850 3300047470 Ga0495681_0005741 Ga0495681_0005741_2473_3291 233
851 3300048921 Ga0496118_0000355 Ga0496118_0000355_5048_5866 233
852 3300048925 Ga0496122_0012544 Ga0496122_0012544_6415_7233 233
853 3300050490 nmdc:mga03n38_1786_c1 nmdc:mga03n38_1786_c1_990_1808 233
854 3300050491 nmdc:mga00v17_219758_c1 nmdc:mga00v17_219758_c1_156_974 233
855 3300050491 nmdc:mga00v17_6_c1 nmdc:mga00v17_6_c1_72100_72918 233
856 3300050492 nmdc:mga0yw44_72132_c1 nmdc:mga0yw44_72132_c1_672_1490 233
857 3300050494 nmdc:mga06z11_55161_c1 nmdc:mga06z11_55161_c1_306_1124 233
858 3300050495 nmdc:mga04h51_23321_c1 nmdc:mga04h51_23321_c1_346_1164 233
859 3300050496 nmdc:mga07m45_161522_c1 nmdc:mga07m45_161522_c1_73_891 233
860 3300050516 nmdc:mga0sz30_12802_c1 nmdc:mga0sz30_12802_c1_342_1160 233
861 3300050516 nmdc:mga0sz30_215_c2 nmdc:mga0sz30_215_c2_10335_11153 233
862 3300053137 Ga0500561_0000246 Ga0500561_0000246_6710_7528 233
863 3300002987 JGI25159J45721_1000078 JGI25159J45721_100007824 234
864 3300003354 JGI25160J50197_1000216 JGI25160J50197_100021626 234
865 3300003374 JGI25161J50226_1000412 JGI25161J50226_10004129 234
866 3300003771 Ga0055526_1000594 Ga0055526_10005943 234
867 3300003775 Ga0055524_1001754 Ga0055524_100175412 234
868 3300004625 Ga0055543_1000301 Ga0055543_100030124 234
869 3300005262 Ga0065165_1000717 Ga0065165_100071726 234
870 3300005262 Ga0065165_1005533 Ga0065165_10055335 234
871 3300006177 Ga0075362_10094396 Ga0075362_100943962 234
872 3300013249 Ga0171463_1003 Ga0171463_1003650 234
873 3300015690 Ga0183363_1047 Ga0183363_104732 234
874 3300025208 Ga0209436_103034 Ga0209436_1030343 234
875 3300025263 Ga0209565_1020981 Ga0209565_10209812 234
876 3300025284 Ga0209130_1000029 Ga0209130_1000029273 234
877 3300025292 Ga0209676_1005409 Ga0209676_100540911 234
878 3300025294 Ga0209025_1000119 Ga0209025_100011998 234
879 3300025294 Ga0209025_1000959 Ga0209025_100095919 234
880 3300025294 Ga0209025_1030438 Ga0209025_10304382 234
881 3300025294 Ga0209025_1046039 Ga0209025_10460392 234
882 3300025295 Ga0209564_1000278 Ga0209564_100027895 234
883 3300025298 Ga0209050_1030063 Ga0209050_10300633 234
884 3300025299 Ga0209256_1000042 Ga0209256_100004213 234
885 3300025299 Ga0209256_1003234 Ga0209256_10032345 234
886 3300025302 Ga0207426_1000074 Ga0207426_100007425 234
887 3300025304 Ga0209257_1006328 Ga0209257_100632812 234
888 3300025304 Ga0209257_1024647 Ga0209257_10246472 234
889 3300028794 Ga0307515_10000023 Ga0307515_10000023301 234
890 3300028794 Ga0307515_10013391 Ga0307515_1001339117 234
891 3300031911 Ga0307412_10029449 Ga0307412_100294494 234
892 3300041406 Ga0439439_0052844 Ga0439439_0052844_43_876 234
893 3300046558 Ga0495633_0147035 Ga0495633_0147035_45_878 234
894 3300048920 Ga0496117_0006313 Ga0496117_0006313_6300_7130 234
895 3300048925 Ga0496122_0000525 Ga0496122_0000525_29951_30781 234
896 3300048926 Ga0496123_0001014 Ga0496123_0001014_6562_7392 234
897 3300048928 Ga0496125_0002081 Ga0496125_0002081_11528_12358 234
898 3300048929 Ga0496126_0189716 Ga0496126_0189716_619_1449 234
899 3300049570 Ga0501033_0058254 Ga0501033_0058254_699_1538 234
900 3300049573 Ga0501037_0128592 Ga0501037_0128592_583_1413 234
901 3300049579 Ga0501043_0027267 Ga0501043_0027267_1698_2528 234
902 3300049823 Ga0501044_0263690 Ga0501044_0263690_425_1255 234
903 iso_pu_bacteria 2643221580 2643909757 234
904 3300006038 Ga0075365_10040694 Ga0075365_100406943 235
905 3300005548 Ga0070665_100543480 Ga0070665_1005434801 236
906 3300006946 Ga0079104_1000610 Ga0079104_100061011 236
907 3300025206 Ga0209435_100012 Ga0209435_100012165 236
908 3300025246 Ga0209646_1000026 Ga0209646_1000026165 236
909 3300025250 Ga0209026_1000014 Ga0209026_1000014165 236
910 3300025256 Ga0209759_1000012 Ga0209759_1000012165 236
911 3300027111 Ga0209281_1000036 Ga0209281_1000036270 236
912 3300027111 Ga0209281_1000047 Ga0209281_1000047212 236
913 3300028379 Ga0268266_10397157 Ga0268266_103971572 236
914 3300047472 Ga0495686_0000796 Ga0495686_0000796_3478_4305 236
915 3300048913 Ga0496110_0370165 Ga0496110_0370165_448_1275 236
916 3300048924 Ga0496121_0043020 Ga0496121_0043020_38_865 236
917 3300048925 Ga0496122_0000369 Ga0496122_0000369_91832_92659 236
918 3300048925 Ga0496122_0024409 Ga0496122_0024409_2944_3771 236
919 3300048926 Ga0496123_0000054 Ga0496123_0000054_150148_150975 236
920 3300050491 nmdc:mga00v17_264213_c1 nmdc:mga00v17_264213_c1_150_977 236
921 3300053125 Ga0500618_000604 Ga0500618_000604_16654_17481 236
922 iso_pu_bacteria 2534681786 2535485924 236
923 iso_pu_bacteria 2854911287 2854916825 236
924 3300005367 Ga0070667_100245343 Ga0070667_1002453432 237
925 3300046507 Ga0495606_0001613 Ga0495606_0001613_6125_6961 239
926 3300048924 Ga0496121_0071342 Ga0496121_0071342_176_1012 239
927 3300050492 nmdc:mga0yw44_33191_c1 nmdc:mga0yw44_33191_c1_1175_2011 239
928 3300031911 Ga0307412_10179015 Ga0307412_101790151 240
929 3300044735 Ga0466968_0099450 Ga0466968_0099450_14_898 240
930 iso_pu_bacteria 2509276021 2509392200 240
931 iso_pu_bacteria 2600255279 2601608265 240
932 iso_pu_bacteria 2600255308 2601745039 240
933 iso_pu_bacteria 2933594066 2933597749 240
934 iso_pu_bacteria 2585427608 2585898047 242
935 3300048922 Ga0496119_0035312 Ga0496119_0035312_1527_2444 243
936 3300048925 Ga0496122_0072484 Ga0496122_0072484_1309_2226 243
937 iso_pu_bacteria 2791355266 2793363844 243
938 iso_pu_bacteria 2852387548 2852390012 243
939 3300006948 Ga0099826_10000091 Ga0099826_1000009137 244
940 3300027666 Ga0209282_1000251 Ga0209282_100025120 244
941 3300046558 Ga0495633_0015993 Ga0495633_0015993_500_1351 244
942 3300048921 Ga0496118_0022010 Ga0496118_0022010_4609_5460 244
943 3300053177 Ga0500636_0001102 Ga0500636_0001102_6361_7299 244
944 iso_pu_bacteria 2854896431 2854899349 245
945 3300048927 Ga0496124_0010848 Ga0496124_0010848_7322_8200 246
946 3300048929 Ga0496126_0001019 Ga0496126_0001019_28407_29285 246
947 3300049569 Ga0501032_0175424 Ga0501032_0175424_32_904 246
948 iso_pu_bacteria 2582581315 2585323521 246
949 iso_pu_bacteria 2818991448 2819608967 246
950 iso_pu_bacteria 2838022645 2838028590 246
951 iso_pu_bacteria 2842110456 2842114833 246
952 iso_pu_bacteria 2842198810 2842204618 246
953 iso_pu_bacteria 2842304105 2842304893 246
954 iso_pu_bacteria 2854916844 2854917962 246
955 iso_pu_bacteria 8005556819 8005557164 246
956 3300050496 nmdc:mga07m45_176094_c1 nmdc:mga07m45_176094_c1_29_889 247
957 3300053177 Ga0500636_0000153 Ga0500636_0000153_9451_10335 247
958 iso_pu_bacteria 2838701080 2838706597 247
959 iso_pu_bacteria 2842146304 2842151332 247
960 iso_pu_bacteria 2842317721 2842320553 247
961 iso_pu_bacteria 2842434925 2842436329 247
962 iso_pu_bacteria 2842441272 2842442676 247
963 iso_pu_bacteria 2842462802 2842464137 247
964 iso_pu_bacteria 2842469257 2842470658 247
965 iso_pu_bacteria 2842489311 2842490425 247
966 3300048927 Ga0496124_0001936 Ga0496124_0001936_19462_20346 248
967 3300053107 Ga0500560_006454 Ga0500560_006454_1659_2525 248
968 3300053161 Ga0500634_0079358 Ga0500634_0079358_306_1172 248
969 iso_pu_bacteria 2775507266 2778174118 248
970 iso_pu_bacteria 2838707686 2838710433 248
971 iso_pu_bacteria 2842077413 2842078607 248
972 iso_pu_bacteria 2842237096 2842239845 248
973 iso_pu_bacteria 2842291075 2842292269 248
974 iso_pu_bacteria 2842377471 2842378666 248
975 3300042184 Ga0450908_008115 Ga0450908_008115_422_1357 249
976 3300048907 Ga0496104_0200879 Ga0496104_0200879_840_1715 249
977 3300048928 Ga0496125_0024477 Ga0496125_0024477_1901_2824 249
978 3300050489 nmdc:mga03683_34891_c1 nmdc:mga03683_34891_c1_164_1099 249
979 iso_pu_bacteria 2582581316 2585331656 249
980 iso_pu_bacteria 2615840698 2616557010 249
981 iso_pu_bacteria 2617270742 2617385782 250
982 3300048916 Ga0496113_0076669 Ga0496113_0076669_1112_2050 251
983 3300048920 Ga0496117_0000002 Ga0496117_0000002_1076255_1077193 251
984 3300048923 Ga0496120_0000941 Ga0496120_0000941_26142_27080 251
985 3300048925 Ga0496122_0000001 Ga0496122_0000001_382708_383646 251
986 3300048926 Ga0496123_0000001 Ga0496123_0000001_386439_387377 251
987 3300048927 Ga0496124_0075919 Ga0496124_0075919_1700_2635 251
988 3300048927 Ga0496124_0324998 Ga0496124_0324998_184_1077 251
989 3300041413 Ga0439465_0003881 Ga0439465_0003881_1810_2793 252
990 3300048929 Ga0496126_0061193 Ga0496126_0061193_96_995 252
991 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001115 254
992 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001217 254
993 3300002737 JGI25162J39368_1000245 JGI25162J39368_100024552 254
994 3300002738 JGI25154J39366_1000011 JGI25154J39366_1000011166 254
995 3300002741 JGI25157J39369_1000030 JGI25157J39369_100003019 254
996 3300003214 JGI25165J46597_1000682 JGI25165J46597_10006829 254
997 3300025207 Ga0209760_101106 Ga0209760_1011063 254
998 3300025233 Ga0209437_100165 Ga0209437_10016524 254
999 3300025261 Ga0209233_1000069 Ga0209233_1000069154 254
1000 3300048914 Ga0496111_0015511 Ga0496111_0015511_3804_4757 254
1001 iso_pu_bacteria 2838029111 2838029988 254
1002 iso_pu_bacteria 2842475841 2842476727 254
1003 iso_pu_bacteria 2842502639 2842503516 254
1004 iso_pu_bacteria 3005416602 3005420000 254
1005 iso_pu_bacteria 8005314921 8005316951 254
1006 iso_pu_bacteria 8005645114 8005649764 254
1007 iso_pu_bacteria 8005682033 8005683081 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00950

ABC-3

ABC 3 transport family

44

301

0.99

Feature Viewer

pLDDT pTM Quality
59.22 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map