F488014

General Info

Members Datasets Scaffolds Average Seq Length
1006 357 1005 226

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0194673|Ga0495628_0194673_753_1436
Length 227
Sequence MDKNDRPTHVSLAAVLQVRGGELQVLLWERARDPFSGAFALPGGYLARGETLEASIRRHLAAKVDVQELSHLEQLITLSDPGRSPDWQLATAYLGLVPSDLDPSVPDDTGWHPVDGMPPMAFDHGRIVLAARDRLRAKLSYTNLGFALAPEQFSISELRILYRAALGHAVSATNLQRVLLRRGLLEATGERRESGRTGGRPAQLFKFRSRELAITDQFAVLRPPDER

Samples

Sample ID Description Type Environment
1 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
194 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
281 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 7.06
Rhizosphere 92.05
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10170312 3300005328 Bacteria 1408
2 Ga0070676_10274992 3300005328 Bacteria 1133
3 Ga0070683_100010526 3300005329 Bacteria 7953
4 Ga0070683_100030721 3300005329 Bacteria 4880
5 Ga0070683_100093732 3300005329 Bacteria 2822
6 Ga0070683_100108788 3300005329 Bacteria 2614
7 Ga0070683_100673014 3300005329 Bacteria 991
8 Ga0070690_100058141 3300005330 Bacteria 2482
9 Ga0070690_100675360 3300005330 Bacteria 791
10 Ga0070670_100004558 3300005331 Bacteria 11621
11 Ga0070670_100445513 3300005331 Bacteria 1147
12 Ga0070670_100506941 3300005331 Bacteria 1073
13 Ga0070677_10117878 3300005333 Bacteria 1195
14 Ga0068869_100134891 3300005334 Bacteria 1901
15 Ga0068869_100266316 3300005334 Bacteria 1373
16 Ga0070666_10261571 3300005335 Bacteria 1227
17 Ga0070680_100046414 3300005336 Bacteria 3534
18 Ga0070680_100058836 3300005336 Bacteria 3143
19 Ga0070680_100089834 3300005336 Bacteria 2542
20 Ga0070682_100027742 3300005337 Bacteria 3399
21 Ga0070682_100080855 3300005337 Bacteria 2102
22 Ga0070682_100209756 3300005337 Bacteria 1380
23 Ga0068868_100007316 3300005338 Bacteria 7858
24 Ga0068868_100021354 3300005338 Bacteria 4875
25 Ga0068868_100339510 3300005338 Bacteria 1284
26 Ga0068868_100350397 3300005338 Bacteria 1264
27 Ga0070660_100010010 3300005339 Bacteria 6686
28 Ga0070660_100127818 3300005339 Bacteria 2032
29 Ga0070660_100197194 3300005339 Bacteria 1632
30 Ga0070689_100040095 3300005340 Bacteria 3588
31 Ga0070691_10013064 3300005341 Bacteria 3802
32 Ga0070691_10063264 3300005341 Bacteria 1783
33 Ga0070687_100098299 3300005343 Bacteria 1634
34 Ga0070687_100251789 3300005343 Bacteria 1098
35 Ga0070687_100281023 3300005343 Unclassified 1048
36 Ga0070661_100005618 3300005344 Bacteria 8640
37 Ga0070661_100172986 3300005344 Bacteria 1641
38 Ga0070692_10018623 3300005345 Bacteria 3342
39 Ga0070692_10022668 3300005345 Bacteria 3069
40 Ga0070692_10043384 3300005345 Bacteria 2312
41 Ga0070692_10055417 3300005345 Bacteria 2073
42 Ga0070668_100052295 3300005347 Bacteria 3148
43 Ga0070669_100303530 3300005353 Bacteria 1285
44 Ga0070669_100360689 3300005353 Bacteria 1182
45 Ga0070675_100008298 3300005354 Bacteria 8059
46 Ga0070675_100020892 3300005354 Bacteria 5227
47 Ga0070675_100064048 3300005354 Bacteria 3039
48 Ga0070671_100099507 3300005355 Bacteria 2439
49 Ga0070671_100235294 3300005355 Bacteria 1555
50 Ga0070674_100004873 3300005356 Bacteria 7692
51 Ga0070674_100032821 3300005356 Bacteria 3451
52 Ga0070673_100015557 3300005364 Bacteria 5349
53 Ga0070673_100101873 3300005364 Bacteria 2366
54 Ga0070673_100198516 3300005364 Bacteria 1727
55 Ga0070688_100001368 3300005365 Bacteria 12116
56 Ga0070659_100021773 3300005366 Bacteria 4887
57 Ga0070659_100104689 3300005366 Bacteria 2280
58 Ga0070659_100297361 3300005366 Bacteria 1345
59 Ga0070709_10102125 3300005434 Bacteria 1912
60 Ga0070709_10106861 3300005434 Bacteria 1874
61 Ga0070709_10139929 3300005434 Bacteria 1662
62 Ga0070709_10384252 3300005434 Bacteria 1044
63 Ga0070714_100006361 3300005435 Bacteria 9110
64 Ga0070714_100027611 3300005435 Bacteria 4702
65 Ga0070714_100439123 3300005435 Bacteria 1238
66 Ga0070713_100046229 3300005436 Bacteria 3571
67 Ga0070713_100163717 3300005436 Bacteria 1987
68 Ga0070710_10024620 3300005437 Bacteria 3178
69 Ga0070710_10055042 3300005437 Bacteria 2246
70 Ga0070710_10365305 3300005437 Bacteria 959
71 Ga0070701_10074375 3300005438 Bacteria 1824
72 Ga0070701_10322995 3300005438 Bacteria 955
73 Ga0070701_10374607 3300005438 Bacteria 895
74 Ga0070711_100031456 3300005439 Bacteria 3523
75 Ga0070711_100151483 3300005439 Bacteria 1749
76 Ga0070705_100016331 3300005440 Bacteria 3857
77 Ga0070705_100126314 3300005440 Bacteria 1661
78 Ga0070705_100166789 3300005440 Bacteria 1478
79 Ga0070700_100258893 3300005441 Bacteria 1252
80 Ga0070694_100129494 3300005444 Bacteria 1821
81 Ga0070694_100312771 3300005444 Unclassified 1207
82 Ga0070694_100315843 3300005444 Bacteria 1201
83 Ga0070708_100111799 3300005445 Bacteria 2511
84 Ga0070663_100463186 3300005455 Bacteria 1047
85 Ga0070678_100047065 3300005456 Bacteria 3097
86 Ga0070678_100120198 3300005456 Bacteria 2070
87 Ga0070662_100025843 3300005457 Bacteria 4059
88 Ga0070662_100047877 3300005457 Bacteria 3078
89 Ga0070662_100049741 3300005457 Bacteria 3023
90 Ga0070681_10010646 3300005458 Bacteria 9090
91 Ga0070681_10072510 3300005458 Bacteria 3406
92 Ga0070681_10109385 3300005458 Bacteria 2704
93 Ga0070681_10111208 3300005458 Bacteria 2679
94 Ga0070681_10157304 3300005458 Bacteria 2197
95 Ga0070681_10525567 3300005458 Bacteria 1096
96 Ga0068867_100125736 3300005459 Bacteria 1987
97 Ga0068867_100368487 3300005459 Bacteria 1203
98 Ga0068867_100600759 3300005459 Bacteria 959
99 Ga0070685_10079141 3300005466 Bacteria 1966
100 Ga0070706_100079668 3300005467 Bacteria 3032
101 Ga0070706_100417551 3300005467 Bacteria 1249
102 Ga0070707_100045152 3300005468 Bacteria 4217
103 Ga0070707_100576395 3300005468 Bacteria 1088
104 Ga0070698_100003809 3300005471 Bacteria 16569
105 Ga0070698_100093669 3300005471 Bacteria 2983
106 Ga0070698_100165592 3300005471 Bacteria 2154
107 Ga0070699_100018076 3300005518 Bacteria 6056
108 Ga0070699_100129624 3300005518 Bacteria 2223
109 Ga0070699_100346905 3300005518 Bacteria 1337
110 Ga0070679_100019573 3300005530 Bacteria 6585
111 Ga0070679_100079277 3300005530 Bacteria 3274
112 Ga0070684_100032413 3300005535 Bacteria 4453
113 Ga0070684_100054320 3300005535 Bacteria 3490
114 Ga0070684_100058008 3300005535 Bacteria 3382
115 Ga0070684_100064221 3300005535 Bacteria 3220
116 Ga0070684_100108152 3300005535 Bacteria 2491
117 Ga0070684_100146967 3300005535 Bacteria 2134
118 Ga0070684_100150315 3300005535 Bacteria 2109
119 Ga0070684_100363746 3300005535 Bacteria 1331
120 Ga0070697_100449917 3300005536 Bacteria 1122
121 Ga0068853_100238839 3300005539 Bacteria 1665
122 Ga0068853_100462979 3300005539 Bacteria 1193
123 Ga0070672_100052860 3300005543 Bacteria 3174
124 Ga0070672_100133499 3300005543 Bacteria 2042
125 Ga0070686_100036145 3300005544 Bacteria 3057
126 Ga0070686_100096566 3300005544 Bacteria 1987
127 Ga0070686_100270999 3300005544 Bacteria 1248
128 Ga0070695_100037784 3300005545 Bacteria 3044
129 Ga0070696_100102904 3300005546 Bacteria 2049
130 Ga0070696_100104935 3300005546 Bacteria 2030
131 Ga0070696_100140374 3300005546 Bacteria 1766
132 Ga0070696_100221629 3300005546 Bacteria 1419
133 Ga0070696_100281641 3300005546 Bacteria 1268
134 Ga0070696_100298038 3300005546 Bacteria 1234
135 Ga0070693_100020916 3300005547 Bacteria 3458
136 Ga0070693_100042085 3300005547 Bacteria 2573
137 Ga0070693_100055327 3300005547 Bacteria 2285
138 Ga0070665_100005986 3300005548 Bacteria 12445
139 Ga0070665_100517631 3300005548 Bacteria 1205
140 Ga0070704_100054906 3300005549 Bacteria 2821
141 Ga0070704_100456241 3300005549 Bacteria 1101
142 Ga0070704_100687007 3300005549 Bacteria 906
143 Ga0068855_100042188 3300005563 Bacteria 5406
144 Ga0068855_100060313 3300005563 Bacteria 4437
145 Ga0068855_100060464 3300005563 Bacteria 4430
146 Ga0068855_100180637 3300005563 Bacteria 2386
147 Ga0068855_100218143 3300005563 Bacteria 2140
148 Ga0070664_100015002 3300005564 Bacteria 6324
149 Ga0070664_100018297 3300005564 Bacteria 5752
150 Ga0070664_100098010 3300005564 Bacteria 2546
151 Ga0070664_100186476 3300005564 Bacteria 1846
152 Ga0070664_100249567 3300005564 Bacteria 1595
153 Ga0068857_100080037 3300005577 Bacteria 2917
154 Ga0068857_100237502 3300005577 Bacteria 1668
155 Ga0068857_100608227 3300005577 Bacteria 1034
156 Ga0068854_100069129 3300005578 Bacteria 2577
157 Ga0068856_100013325 3300005614 Bacteria 7961
158 Ga0068856_100043524 3300005614 Bacteria 4418
159 Ga0068856_100094581 3300005614 Bacteria 2975
160 Ga0068856_100228427 3300005614 Bacteria 1876
161 Ga0068856_100265400 3300005614 Bacteria 1732
162 Ga0068856_100274019 3300005614 Bacteria 1703
163 Ga0070702_100040560 3300005615 Bacteria 2605
164 Ga0070702_100122272 3300005615 Bacteria 1631
165 Ga0070702_100162239 3300005615 Bacteria 1446
166 Ga0068852_100032201 3300005616 Bacteria 4338
167 Ga0068852_100057505 3300005616 Bacteria 3365
168 Ga0068852_100194564 3300005616 Bacteria 1915
169 Ga0068859_100048871 3300005617 Bacteria 4249
170 Ga0068864_100015513 3300005618 Bacteria 6334
171 Ga0068864_100151816 3300005618 Bacteria 2099
172 Ga0068866_10361364 3300005718 Bacteria 926
173 Ga0068861_100024868 3300005719 Bacteria 4336
174 Ga0068861_100216134 3300005719 Bacteria 1617
175 Ga0068861_100407148 3300005719 Bacteria 1209
176 Ga0068863_100331038 3300005841 Bacteria 1480
177 Ga0068863_100426302 3300005841 Bacteria 1300
178 Ga0068863_100431081 3300005841 Bacteria 1292
179 Ga0068860_100243658 3300005843 Bacteria 1749
180 Ga0081455_10027092 3300005937 Bacteria 5257
181 Ga0081455_10046689 3300005937 Bacteria 3755
182 Ga0081455_10090237 3300005937 Bacteria 2485
183 Ga0081538_10000076 3300005981 Bacteria 94022
184 Ga0081538_10000300 3300005981 Bacteria 57016
185 Ga0081538_10026055 3300005981 Bacteria 4102
186 Ga0081538_10048346 3300005981 Unclassified 2596
187 Ga0081538_10051989 3300005981 Bacteria 2453
188 Ga0081540_1003715 3300005983 Bacteria 11960
189 Ga0081540_1005515 3300005983 Bacteria 9433
190 Ga0081540_1063637 3300005983 Bacteria 1745
191 Ga0070717_10011361 3300006028 Bacteria 6759
192 Ga0070717_10094777 3300006028 Bacteria 2525
193 Ga0075365_10066531 3300006038 Bacteria 2418
194 Ga0075364_10086130 3300006051 Bacteria 2081
195 Ga0070716_100292805 3300006173 Bacteria 1129
196 Ga0070712_100008629 3300006175 Bacteria 6417
197 Ga0070712_100083956 3300006175 Bacteria 2314
198 Ga0075367_10017839 3300006178 Bacteria 3903
199 Ga0097621_100485250 3300006237 Bacteria 1117
200 Ga0068871_100053405 3300006358 Bacteria 3275
201 Ga0068871_100629787 3300006358 Bacteria 977
202 Ga0075428_100136001 3300006844 Bacteria 2672
203 Ga0075430_100082750 3300006846 Bacteria 2689
204 Ga0075431_100296531 3300006847 Bacteria 1634
205 Ga0075431_100576961 3300006847 Bacteria 1110
206 Ga0075431_100960151 3300006847 Bacteria 823
207 Ga0075433_10140395 3300006852 Bacteria 2147
208 Ga0075433_10142622 3300006852 Bacteria 2129
209 Ga0075433_10440588 3300006852 Bacteria 1148
210 Ga0075434_100025155 3300006871 Bacteria 5824
211 Ga0075434_100026803 3300006871 Bacteria 5652
212 Ga0075434_100186900 3300006871 Bacteria 2092
213 Ga0075434_100858593 3300006871 Bacteria 923
214 Ga0068865_100124461 3300006881 Bacteria 1922
215 Ga0075436_100093264 3300006914 Bacteria 2093
216 Ga0097620_100048873 3300006931 Bacteria 4249
217 Ga0075435_100018197 3300007076 Bacteria 5336
218 Ga0075435_100080322 3300007076 Bacteria 2677
219 Ga0105244_10064564 3300009036 Bacteria 1836
220 Ga0105240_10519878 3300009093 Bacteria 1321
221 Ga0111539_10056105 3300009094 Bacteria 4683
222 Ga0111539_10072315 3300009094 Bacteria 4067
223 Ga0111539_10132468 3300009094 Bacteria 2919
224 Ga0111539_10155021 3300009094 Bacteria 2680
225 Ga0111539_10158252 3300009094 Bacteria 2650
226 Ga0111539_10160340 3300009094 Bacteria 2631
227 Ga0111539_10250665 3300009094 Bacteria 2061
228 Ga0111539_11136095 3300009094 Bacteria 908
229 Ga0105245_10005762 3300009098 Bacteria 10870
230 Ga0105245_10068041 3300009098 Bacteria 3226
231 Ga0105245_10073128 3300009098 Bacteria 3116
232 Ga0105245_10102412 3300009098 Bacteria 2651
233 Ga0105245_10108727 3300009098 Bacteria 2576
234 Ga0105245_10167952 3300009098 Bacteria 2087
235 Ga0105245_10224154 3300009098 Bacteria 1815
236 Ga0105247_10041847 3300009101 Bacteria 2804
237 Ga0114129_10024803 3300009147 Bacteria 8501
238 Ga0114129_10141735 3300009147 Bacteria 3294
239 Ga0114129_10157542 3300009147 Bacteria 3104
240 Ga0114129_10327665 3300009147 Bacteria 2034
241 Ga0114129_10696914 3300009147 Bacteria 1306
242 Ga0114129_11054611 3300009147 Bacteria 1020
243 Ga0114129_11254601 3300009147 Bacteria 920
244 Ga0105243_10004817 3300009148 Bacteria 10599
245 Ga0105243_10131101 3300009148 Bacteria 2126
246 Ga0105243_10234139 3300009148 Bacteria 1631
247 Ga0105241_10074465 3300009174 Bacteria 2644
248 Ga0105242_10020716 3300009176 Bacteria 5158
249 Ga0105242_10043812 3300009176 Bacteria 3621
250 Ga0105242_10066830 3300009176 Bacteria 2970
251 Ga0105242_10519592 3300009176 Bacteria 1136
252 Ga0105242_10578191 3300009176 Bacteria 1081
253 Ga0105248_10034523 3300009177 Bacteria 5657
254 Ga0105248_10679717 3300009177 Bacteria 1161
255 Ga0105237_10214426 3300009545 Bacteria 1925
256 Ga0105237_10772343 3300009545 Bacteria 968
257 Ga0105238_10107501 3300009551 Bacteria 2771
258 Ga0105238_10166990 3300009551 Bacteria 2177
259 Ga0105249_10005728 3300009553 Bacteria 10745
260 Ga0105249_10382062 3300009553 Bacteria 1434
261 Ga0105239_10011273 3300010375 Bacteria 9970
262 Ga0105239_10040782 3300010375 Bacteria 5087
263 Ga0105239_10055777 3300010375 Bacteria 4334
264 Ga0105239_10118833 3300010375 Bacteria 2933
265 Ga0105239_10142102 3300010375 Bacteria 2675
266 Ga0105246_10018147 3300011119 Bacteria 4481
267 Ga0105246_10509397 3300011119 Unclassified 1024
268 Ga0157314_1011093 3300012500 Bacteria 789
269 Ga0157373_10076066 3300013100 Bacteria 2369
270 Ga0157371_10014451 3300013102 Bacteria 5957
271 Ga0157371_10407839 3300013102 Bacteria 995
272 Ga0157371_10414982 3300013102 Bacteria 986
273 Ga0157370_10147976 3300013104 Bacteria 2186
274 Ga0157369_10011625 3300013105 Bacteria 9996
275 Ga0157369_10057246 3300013105 Bacteria 4206
276 Ga0157369_10527492 3300013105 Bacteria 1221
277 Ga0157374_10093309 3300013296 Bacteria 2874
278 Ga0157378_10096674 3300013297 Bacteria 2691
279 Ga0163162_10186609 3300013306 Bacteria 2201
280 Ga0163162_10267808 3300013306 Bacteria 1840
281 Ga0163162_10590259 3300013306 Bacteria 1237
282 Ga0157372_10132768 3300013307 Bacteria 2866
283 Ga0157372_10399051 3300013307 Bacteria 1603
284 Ga0157372_10479918 3300013307 Bacteria 1449
285 Ga0157372_10756652 3300013307 Unclassified 1130
286 Ga0157372_10853533 3300013307 Bacteria 1057
287 Ga0157375_10033349 3300013308 Bacteria 4891
288 Ga0157375_10090847 3300013308 Bacteria 3113
289 Ga0157375_10308447 3300013308 Bacteria 1747
290 Ga0157375_10651570 3300013308 Unclassified 1209
291 Ga0157380_10177687 3300014326 Bacteria 1867
292 Ga0157380_10374611 3300014326 Bacteria 1341
293 Ga0182008_10123316 3300014497 Bacteria 1289
294 Ga0157377_10003642 3300014745 Bacteria 6984
295 Ga0157377_10008029 3300014745 Bacteria 5130
296 Ga0157377_10010514 3300014745 Bacteria 4580
297 Ga0157377_10404594 3300014745 Bacteria 931
298 Ga0157379_10018230 3300014968 Bacteria 6186
299 Ga0157376_10214912 3300014969 Bacteria 1777
300 Ga0163161_10116736 3300017792 Bacteria 2001
301 Ga0163161_10125777 3300017792 Bacteria 1930
302 Ga0213871_10010655 3300021441 Bacteria 2091
303 Ga0207656_10094560 3300025321 Bacteria 1362
304 Ga0207692_10012888 3300025898 Bacteria 3606
305 Ga0207642_10048351 3300025899 Unclassified 1907
306 Ga0207642_10283007 3300025899 Bacteria 954
307 Ga0207710_10044172 3300025900 Bacteria 1984
308 Ga0207688_10003730 3300025901 Bacteria 8311
309 Ga0207688_10017875 3300025901 Bacteria 3859
310 Ga0207688_10033778 3300025901 Bacteria 2830
311 Ga0207647_10082493 3300025904 Bacteria 1926
312 Ga0207685_10091519 3300025905 Bacteria 1282
313 Ga0207699_10083295 3300025906 Bacteria 1989
314 Ga0207699_10305052 3300025906 Bacteria 1113
315 Ga0207699_10435918 3300025906 Bacteria 938
316 Ga0207645_10068502 3300025907 Bacteria 2269
317 Ga0207645_10148234 3300025907 Bacteria 1531
318 Ga0207643_10012440 3300025908 Bacteria 4600
319 Ga0207684_10115414 3300025910 Bacteria 2300
320 Ga0207707_10063261 3300025912 Bacteria 3220
321 Ga0207707_10180597 3300025912 Bacteria 1842
322 Ga0207707_10575366 3300025912 Bacteria 955
323 Ga0207707_10599383 3300025912 Unclassified 933
324 Ga0207695_10550267 3300025913 Bacteria 1036
325 Ga0207671_10328029 3300025914 Bacteria 1212
326 Ga0207693_10000576 3300025915 Bacteria 32918
327 Ga0207693_10008025 3300025915 Bacteria 8669
328 Ga0207693_10053620 3300025915 Bacteria 3164
329 Ga0207693_10133673 3300025915 Bacteria 1950
330 Ga0207663_10003164 3300025916 Bacteria 8006
331 Ga0207663_10099633 3300025916 Bacteria 1948
332 Ga0207660_10116957 3300025917 Bacteria 2014
333 Ga0207662_10047174 3300025918 Bacteria 2551
334 Ga0207662_10231916 3300025918 Bacteria 1206
335 Ga0207657_10004578 3300025919 Bacteria 14619
336 Ga0207657_10023123 3300025919 Bacteria 5795
337 Ga0207657_10071551 3300025919 Bacteria 2936
338 Ga0207657_10122606 3300025919 Bacteria 2138
339 Ga0207652_10016442 3300025921 Bacteria 6042
340 Ga0207652_10138059 3300025921 Bacteria 2178
341 Ga0207652_10176264 3300025921 Bacteria 1920
342 Ga0207652_10856779 3300025921 Unclassified 804
343 Ga0207646_10001540 3300025922 Bacteria 28247
344 Ga0207646_10012924 3300025922 Bacteria 8002
345 Ga0207646_10276679 3300025922 Bacteria 1517
346 Ga0207681_10187593 3300025923 Bacteria 1580
347 Ga0207681_10411870 3300025923 Bacteria 1094
348 Ga0207681_10459448 3300025923 Bacteria 1037
349 Ga0207694_10075943 3300025924 Bacteria 2631
350 Ga0207650_10393815 3300025925 Bacteria 1145
351 Ga0207659_10293672 3300025926 Unclassified 1332
352 Ga0207659_10555281 3300025926 Bacteria 976
353 Ga0207687_10010823 3300025927 Bacteria 5962
354 Ga0207687_10020460 3300025927 Bacteria 4389
355 Ga0207687_10034840 3300025927 Bacteria 3421
356 Ga0207687_10064593 3300025927 Bacteria 2596
357 Ga0207687_10105718 3300025927 Bacteria 2080
358 Ga0207687_10367497 3300025927 Bacteria 1176
359 Ga0207700_10126602 3300025928 Bacteria 2079
360 Ga0207700_10127263 3300025928 Bacteria 2074
361 Ga0207700_10177384 3300025928 Bacteria 1781
362 Ga0207664_10014478 3300025929 Bacteria 5697
363 Ga0207664_10030449 3300025929 Bacteria 4120
364 Ga0207644_10073448 3300025931 Bacteria 2508
365 Ga0207644_10285008 3300025931 Bacteria 1327
366 Ga0207690_10128471 3300025932 Bacteria 1851
367 Ga0207706_10004721 3300025933 Bacteria 12757
368 Ga0207706_10013517 3300025933 Bacteria 7419
369 Ga0207706_10060822 3300025933 Bacteria 3326
370 Ga0207706_10061263 3300025933 Bacteria 3313
371 Ga0207686_10247532 3300025934 Bacteria 1300
372 Ga0207686_10534999 3300025934 Bacteria 914
373 Ga0207709_10011368 3300025935 Bacteria 4910
374 Ga0207709_10664862 3300025935 Bacteria 831
375 Ga0207669_10011806 3300025937 Bacteria 4268
376 Ga0207669_10241208 3300025937 Bacteria 1340
377 Ga0207669_10497768 3300025937 Unclassified 974
378 Ga0207669_10573348 3300025937 Bacteria 914
379 Ga0207665_10009724 3300025939 Bacteria 6313
380 Ga0207665_10065530 3300025939 Bacteria 2470
381 Ga0207665_10398255 3300025939 Bacteria 1048
382 Ga0207691_10045494 3300025940 Bacteria 4034
383 Ga0207691_10060473 3300025940 Bacteria 3442
384 Ga0207691_10751816 3300025940 Bacteria 821
385 Ga0207711_10640946 3300025941 Bacteria 991
386 Ga0207711_10774224 3300025941 Bacteria 894
387 Ga0207689_10034038 3300025942 Bacteria 4231
388 Ga0207689_10154754 3300025942 Bacteria 1890
389 Ga0207661_10000830 3300025944 Bacteria 20256
390 Ga0207661_10016847 3300025944 Bacteria 5397
391 Ga0207661_10023423 3300025944 Bacteria 4665
392 Ga0207661_10029103 3300025944 Bacteria 4239
393 Ga0207661_10049324 3300025944 Bacteria 3350
394 Ga0207661_10082592 3300025944 Bacteria 2656
395 Ga0207661_10578391 3300025944 Bacteria 1030
396 Ga0207661_10822703 3300025944 Bacteria 855
397 Ga0207679_10096985 3300025945 Bacteria 2295
398 Ga0207679_10247459 3300025945 Bacteria 1514
399 Ga0207679_10276545 3300025945 Bacteria 1438
400 Ga0207679_10625353 3300025945 Unclassified 972
401 Ga0207667_10040231 3300025949 Bacteria 4979
402 Ga0207667_10125515 3300025949 Bacteria 2643
403 Ga0207651_10401240 3300025960 Bacteria 1166
404 Ga0207712_10053891 3300025961 Bacteria 2824
405 Ga0207668_10101542 3300025972 Bacteria 2138
406 Ga0207640_10031394 3300025981 Bacteria 3282
407 Ga0207640_10068885 3300025981 Bacteria 2373
408 Ga0207640_10395191 3300025981 Unclassified 1124
409 Ga0207658_10071913 3300025986 Bacteria 2621
410 Ga0207677_10095392 3300026023 Bacteria 2174
411 Ga0207677_10167403 3300026023 Unclassified 1714
412 Ga0207703_10382441 3300026035 Bacteria 1302
413 Ga0207639_10042771 3300026041 Bacteria 3397
414 Ga0207678_10064647 3300026067 Bacteria 3143
415 Ga0207678_10078022 3300026067 Bacteria 2837
416 Ga0207678_10112999 3300026067 Bacteria 2317
417 Ga0207708_10001284 3300026075 Bacteria 18862
418 Ga0207708_10029296 3300026075 Bacteria 4172
419 Ga0207708_10081901 3300026075 Bacteria 2481
420 Ga0207708_10098610 3300026075 Bacteria 2259
421 Ga0207702_10032325 3300026078 Bacteria 4366
422 Ga0207702_10056494 3300026078 Bacteria 3333
423 Ga0207702_10110418 3300026078 Bacteria 2444
424 Ga0207702_10417827 3300026078 Bacteria 1296
425 Ga0207702_10540710 3300026078 Bacteria 1139
426 Ga0207641_10117834 3300026088 Bacteria 2365
427 Ga0207641_10300625 3300026088 Bacteria 1516
428 Ga0207648_10008265 3300026089 Bacteria 10106
429 Ga0207648_10175589 3300026089 Bacteria 1895
430 Ga0207676_10130276 3300026095 Bacteria 2137
431 Ga0207676_10143690 3300026095 Unclassified 2046
432 Ga0207676_10666462 3300026095 Bacteria 1005
433 Ga0207674_10055272 3300026116 Bacteria 4037
434 Ga0207674_10098354 3300026116 Bacteria 2909
435 Ga0207674_10247760 3300026116 Bacteria 1728
436 Ga0207675_100000792 3300026118 Bacteria 31451
437 Ga0207675_100007683 3300026118 Bacteria 10172
438 Ga0207675_100052001 3300026118 Bacteria 3823
439 Ga0207683_10000898 3300026121 Bacteria 27389
440 Ga0207683_10063501 3300026121 Bacteria 3253
441 Ga0207683_10263121 3300026121 Bacteria 1575
442 Ga0207683_10349106 3300026121 Bacteria 1358
443 Ga0207698_10343875 3300026142 Bacteria 1406
444 Ga0207698_10615290 3300026142 Bacteria 1072
445 Ga0207428_10013003 3300027907 Bacteria 7290
446 Ga0207428_10402711 3300027907 Bacteria 1002
447 Ga0268266_10548620 3300028379 Bacteria 1107
448 Ga0268265_10237570 3300028380 Bacteria 1606
449 Ga0265338_10004598 3300028800 Bacteria 18567
450 Ga0265338_10006450 3300028800 Bacteria 14955
451 Ga0265338_10011093 3300028800 Bacteria 10448
452 Ga0265338_10029240 3300028800 Bacteria 5467
453 Ga0265320_10023981 3300031240 Bacteria 3236
454 Ga0265339_10028524 3300031249 Bacteria 3173
455 Ga0265327_10044202 3300031251 Unclassified 2377
456 Ga0265327_10201583 3300031251 Bacteria 901
457 Ga0265316_10053799 3300031344 Bacteria 3153
458 Ga0265314_10020439 3300031711 Bacteria 5110
459 Ga0307410_10083699 3300031852 Bacteria 2247
460 Ga0307412_10243138 3300031911 Bacteria 1393
461 Ga0307409_100079707 3300031995 Bacteria 2640
462 Ga0373930_0041076 3300034816 Bacteria 986
463 Ga0373948_0017891 3300034817 Bacteria 1326
464 Ga0373959_0006484 3300034820 Bacteria 1944
465 Ga0373944_0028793 3300035089 Bacteria 1655
466 Ga0373944_0065560 3300035089 Bacteria 1173
467 Ga0373952_0015088 3300035092 Bacteria 1556
468 Ga0373932_0008243 3300035112 Bacteria 2490
469 Ga0373936_0038087 3300035113 Bacteria 1922
470 Ga0373939_0037580 3300035114 Bacteria 1439
471 Ga0373941_0043517 3300035115 Bacteria 1398
472 Ga0373945_0015864 3300035116 Bacteria 2538
473 Ga0373943_0006250 3300035170 Bacteria 5351
474 Ga0373943_0011455 3300035170 Bacteria 3990
475 Ga0373943_0021180 3300035170 Bacteria 3001
476 Ga0373946_0019592 3300035171 Bacteria 2608
477 Ga0373946_0180973 3300035171 Bacteria 1000
478 Ga0373961_0009301 3300035241 Bacteria 2403
479 Ga0373961_0051566 3300035241 Bacteria 1222
480 Ga0373962_0056646 3300035242 Bacteria 1142
481 Ga0373931_0419401 3300035691 Bacteria 850
482 Ga0373935_0003142 3300035692 Bacteria 9527
483 Ga0373935_0098036 3300035692 Bacteria 1929
484 Ga0373935_0143669 3300035692 Bacteria 1614
485 Ga0373927_0044249 3300035695 Bacteria 2881
486 Ga0373927_0139482 3300035695 Bacteria 1585
487 Ga0373947_0005913 3300035725 Bacteria 7128
488 Ga0373947_0035992 3300035725 Bacteria 2933
489 Ga0373947_0071012 3300035725 Bacteria 2135
490 Ga0373947_0134731 3300035725 Bacteria 1580
491 Ga0373947_0498335 3300035725 Bacteria 827
492 Ga0373937_0064158 3300036401 Bacteria 3379
493 Ga0373937_0104136 3300036401 Unclassified 2636
494 Ga0373925_0002557 3300037068 Bacteria 14492
495 Ga0373925_0103583 3300037068 Bacteria 2191
496 Ga0373925_0176254 3300037068 Bacteria 1690
497 Ga0395899_0003978 3300037312 Bacteria 11644
498 Ga0395899_0004636 3300037312 Bacteria 10720
499 Ga0395899_0005711 3300037312 Bacteria 9658
500 Ga0395899_0005949 3300037312 Bacteria 9475
501 Ga0395899_0043736 3300037312 Bacteria 3339
502 Ga0395899_0062943 3300037312 Bacteria 2731
503 Ga0395899_0162380 3300037312 Bacteria 1577
504 Ga0395900_0001538 3300037418 Bacteria 27416
505 Ga0395900_0002131 3300037418 Bacteria 22136
506 Ga0395900_0017645 3300037418 Bacteria 7284
507 Ga0395900_0032901 3300037418 Bacteria 5334
508 Ga0395900_0039455 3300037418 Bacteria 4865
509 Ga0395900_0074450 3300037418 Bacteria 3491
510 Ga0395900_0106737 3300037418 Bacteria 2877
511 Ga0395900_0155628 3300037418 Bacteria 2334
512 Ga0395900_0295472 3300037418 Unclassified 1608
513 Ga0395900_0726084 3300037418 Bacteria 925
514 Ga0395898_0001713 3300037466 Bacteria 29061
515 Ga0395898_0006214 3300037466 Bacteria 12794
516 Ga0395898_0007822 3300037466 Bacteria 11347
517 Ga0395898_0013668 3300037466 Bacteria 8351
518 Ga0395898_0019994 3300037466 Bacteria 6807
519 Ga0395898_0022082 3300037466 Bacteria 6447
520 Ga0395898_0042127 3300037466 Bacteria 4506
521 Ga0395898_0068826 3300037466 Bacteria 3425
522 Ga0395898_0123763 3300037466 Bacteria 2478
523 Ga0395898_0139205 3300037466 Bacteria 2324
524 Ga0395898_0139418 3300037466 Bacteria 2321
525 Ga0395898_0217029 3300037466 Bacteria 1824
526 Ga0395898_0679637 3300037466 Bacteria 972
527 Ga0395905_0000568 3300037471 Bacteria 50013
528 Ga0395905_0003732 3300037471 Bacteria 16136
529 Ga0395905_0016012 3300037471 Bacteria 7128
530 Ga0395905_0018371 3300037471 Bacteria 6637
531 Ga0395905_0135514 3300037471 Bacteria 2316
532 Ga0395905_0194296 3300037471 Unclassified 1903
533 Ga0395905_0500715 3300037471 Bacteria 1115
534 Ga0395901_0009430 3300038443 Bacteria 9904
535 Ga0395901_0017370 3300038443 Bacteria 7344
536 Ga0395901_0018641 3300038443 Bacteria 7087
537 Ga0395901_0020467 3300038443 Bacteria 6771
538 Ga0395901_0026136 3300038443 Bacteria 5993
539 Ga0395901_0069980 3300038443 Bacteria 3655
540 Ga0395901_0076085 3300038443 Bacteria 3502
541 Ga0395901_0085143 3300038443 Bacteria 3304
542 Ga0395901_0213821 3300038443 Bacteria 2017
543 Ga0395901_0264320 3300038443 Bacteria 1790
544 Ga0395901_0339255 3300038443 Bacteria 1553
545 Ga0436360_0031091 3300039438 Bacteria 2733
546 Ga0436360_1357140 3300039438 Bacteria 11037
547 Ga0451833_0356990 3300041491 Bacteria 821
548 Ga0451853_0568896 3300041512 Bacteria 1573
549 Ga0439448_0024436 3300042005 Bacteria 1889
550 Ga0439448_0106799 3300042005 Bacteria 954
551 Ga0450916_003096 3300042530 Bacteria 1808
552 Ga0466965_0050569 3300044683 Bacteria 2061
553 Ga0466965_0063514 3300044683 Bacteria 1848
554 Ga0466961_0105175 3300044693 Bacteria 1777
555 Ga0466963_0000078 3300044694 Bacteria 33439
556 Ga0466963_0011463 3300044694 Bacteria 5399
557 Ga0466963_0016740 3300044694 Bacteria 4562
558 Ga0466963_0021180 3300044694 Bacteria 4098
559 Ga0466963_0028613 3300044694 Bacteria 3580
560 Ga0466963_0041189 3300044694 Bacteria 3028
561 Ga0466963_0041747 3300044694 Bacteria 3009
562 Ga0466964_0002212 3300044706 Bacteria 6880
563 Ga0466964_0006461 3300044706 Bacteria 4369
564 Ga0466964_0014756 3300044706 Bacteria 2972
565 Ga0466964_0025021 3300044706 Bacteria 2329
566 Ga0466971_0031655 3300044719 Bacteria 2369
567 Ga0466968_0001161 3300044735 Bacteria 9335
568 Ga0466968_0019006 3300044735 Bacteria 2761
569 Ga0466968_0038202 3300044735 Bacteria 2017
570 Ga0466970_0005539 3300044765 Bacteria 6271
571 Ga0466957_0017365 3300044842 Bacteria 4212
572 Ga0466957_0018612 3300044842 Bacteria 4080
573 Ga0466957_0024965 3300044842 Bacteria 3540
574 Ga0466960_0004248 3300044901 Bacteria 5580
575 Ga0466959_0003883 3300045049 Bacteria 9918
576 Ga0451576_0042487 3300045051 Bacteria 4798
577 Ga0466958_0005370 3300045836 Bacteria 6886
578 Ga0466958_0021049 3300045836 Bacteria 3807
579 Ga0466958_0035475 3300045836 Bacteria 2980
580 Ga0466958_0047614 3300045836 Bacteria 2588
581 Ga0466967_0001286 3300045976 Bacteria 14281
582 Ga0466967_0015711 3300045976 Bacteria 5945
583 Ga0466967_0017616 3300045976 Bacteria 5679
584 Ga0466967_0058874 3300045976 Bacteria 3397
585 Ga0466967_0085623 3300045976 Bacteria 2853
586 Ga0466967_0172295 3300045976 Bacteria 2037
587 Ga0466967_0226828 3300045976 Bacteria 1777
588 Ga0466967_0357259 3300045976 Bacteria 1415
589 Ga0466967_0454653 3300045976 Bacteria 1252
590 Ga0466967_0494239 3300045976 Unclassified 1200
591 Ga0466967_0589405 3300045976 Bacteria 1096
592 Ga0495617_082333 3300046452 Bacteria 1054
593 Ga0495592_0001100 3300046454 Bacteria 18772
594 Ga0495592_0150679 3300046454 Bacteria 1609
595 Ga0495603_0001085 3300046455 Bacteria 15790
596 Ga0495603_0021259 3300046455 Bacteria 3929
597 Ga0495603_0235373 3300046455 Bacteria 1055
598 Ga0495629_0031019 3300046459 Bacteria 3786
599 Ga0495629_0096666 3300046459 Bacteria 2060
600 Ga0495629_0117051 3300046459 Bacteria 1857
601 Ga0495641_0006376 3300046461 Bacteria 7656
602 Ga0495641_0007577 3300046461 Bacteria 6756
603 Ga0495641_0015690 3300046461 Bacteria 4026
604 Ga0495641_0065788 3300046461 Bacteria 1632
605 Ga0495641_0171947 3300046461 Bacteria 969
606 Ga0495641_0251006 3300046461 Unclassified 795
607 Ga0495651_0000008 3300046462 Bacteria 156989
608 Ga0495651_0367769 3300046462 Bacteria 946
609 Ga0495653_0000897 3300046463 Bacteria 23064
610 Ga0495653_0020261 3300046463 Bacteria 5392
611 Ga0495653_0253515 3300046463 Bacteria 1167
612 Ga0495580_0006136 3300046472 Bacteria 9829
613 Ga0495582_0009374 3300046473 Bacteria 5392
614 Ga0495582_0024199 3300046473 Bacteria 3321
615 Ga0495582_0055400 3300046473 Bacteria 2186
616 Ga0495582_0057706 3300046473 Bacteria 2140
617 Ga0495582_0112155 3300046473 Bacteria 1532
618 Ga0495582_0122001 3300046473 Bacteria 1469
619 Ga0495605_0067662 3300046474 Bacteria 1694
620 Ga0495605_0080990 3300046474 Bacteria 1519
621 Ga0495605_0088248 3300046474 Bacteria 1441
622 Ga0495605_0098368 3300046474 Bacteria 1348
623 Ga0495639_0000501 3300046475 Bacteria 18483
624 Ga0495639_0221951 3300046475 Bacteria 929
625 Ga0495662_0001886 3300046476 Bacteria 10513
626 Ga0495664_0002065 3300046477 Bacteria 10743
627 Ga0495664_0128889 3300046477 Unclassified 1531
628 Ga0495664_0190698 3300046477 Bacteria 1242
629 Ga0495664_0323347 3300046477 Bacteria 930
630 Ga0495584_0066994 3300046491 Bacteria 1806
631 Ga0495584_0214495 3300046491 Bacteria 978
632 Ga0495594_0062163 3300046499 Bacteria 2067
633 Ga0495608_0002739 3300046511 Bacteria 12647
634 Ga0495608_0034644 3300046511 Bacteria 3407
635 Ga0495608_0125010 3300046511 Bacteria 1648
636 Ga0495618_0005615 3300046514 Bacteria 7629
637 Ga0495618_0034614 3300046514 Bacteria 3168
638 Ga0495618_0088301 3300046514 Bacteria 1983
639 Ga0495618_0131883 3300046514 Bacteria 1599
640 Ga0495618_0178829 3300046514 Bacteria 1348
641 Ga0495628_0000016 3300046516 Bacteria 170260
642 Ga0495628_0059003 3300046516 Bacteria 3014
643 Ga0495628_0134071 3300046516 Bacteria 1894
644 Ga0495628_0138982 3300046516 Bacteria 1854
645 Ga0495628_0194673 3300046516 Bacteria 1530
646 Ga0495630_0002033 3300046517 Bacteria 14060
647 Ga0495630_0024442 3300046517 Bacteria 4467
648 Ga0495630_0300069 3300046517 Bacteria 1227
649 Ga0495644_0008508 3300046523 Bacteria 3952
650 Ga0495663_0015359 3300046525 Bacteria 2157
651 Ga0495663_0151074 3300046525 Bacteria 792
652 Ga0495642_0067778 3300046528 Bacteria 1489
653 Ga0495652_0000045 3300046529 Bacteria 122469
654 Ga0495652_0042153 3300046529 Bacteria 3936
655 Ga0495652_0053980 3300046529 Bacteria 3423
656 Ga0495652_0094719 3300046529 Bacteria 2435
657 Ga0495652_0103526 3300046529 Bacteria 2304
658 Ga0495652_0117373 3300046529 Bacteria 2129
659 Ga0495665_0001055 3300046531 Bacteria 14632
660 Ga0495665_0041667 3300046531 Bacteria 2445
661 Ga0495665_0092438 3300046531 Bacteria 1590
662 Ga0495640_0013846 3300046533 Bacteria 6125
663 Ga0495586_0003415 3300046535 Bacteria 8516
664 Ga0495586_0167880 3300046535 Bacteria 1239
665 Ga0495587_0000275 3300046536 Bacteria 36839
666 Ga0495609_0047591 3300046538 Bacteria 1919
667 Ga0495645_0000068 3300046543 Bacteria 72552
668 Ga0495645_0039361 3300046543 Bacteria 3448
669 Ga0495633_0167924 3300046558 Bacteria 1012
670 Ga0495667_0135084 3300046559 Bacteria 1590
671 Ga0495667_0194273 3300046559 Bacteria 1300
672 Ga0495667_0281579 3300046559 Bacteria 1055
673 Ga0495667_0290741 3300046559 Unclassified 1036
674 Ga0495656_0013736 3300046615 Bacteria 3019
675 Ga0495634_0008960 3300046642 Bacteria 7409
676 Ga0495634_0025336 3300046642 Bacteria 4152
677 Ga0495634_0084281 3300046642 Bacteria 2072
678 Ga0495635_0011230 3300046663 Bacteria 6279
679 Ga0495635_0072700 3300046663 Bacteria 2356
680 Ga0495635_0321520 3300046663 Bacteria 1035
681 Ga0495588_0023673 3300046674 Bacteria 3042
682 Ga0495657_0034070 3300046675 Bacteria 3540
683 Ga0495657_0065711 3300046675 Bacteria 2385
684 Ga0495657_0160855 3300046675 Bacteria 1389
685 Ga0495599_0187364 3300046678 Unclassified 1274
686 Ga0495623_0000418 3300046679 Bacteria 28005
687 Ga0495623_0026350 3300046679 Bacteria 3743
688 Ga0495646_0042520 3300046680 Bacteria 2788
689 Ga0495647_0000727 3300046681 Bacteria 9738
690 Ga0495647_0030306 3300046681 Bacteria 2006
691 Ga0495658_0000785 3300046683 Bacteria 17124
692 Ga0495658_0046801 3300046683 Bacteria 2433
693 Ga0495658_0183985 3300046683 Bacteria 1297
694 Ga0495613_0026907 3300046689 Bacteria 4282
695 Ga0495613_0087313 3300046689 Bacteria 2261
696 Ga0495613_0111817 3300046689 Bacteria 1968
697 Ga0495613_0116148 3300046689 Bacteria 1925
698 Ga0495613_0433742 3300046689 Bacteria 892
699 Ga0495624_0008642 3300046690 Bacteria 7092
700 Ga0495624_0027399 3300046690 Bacteria 3731
701 Ga0495624_0364988 3300046690 Bacteria 868
702 Ga0495600_0076415 3300046809 Bacteria 2187
703 Ga0495660_0048675 3300046810 Bacteria 2318
704 Ga0495581_0005357 3300047315 Bacteria 7420
705 Ga0495581_0042870 3300047315 Bacteria 2618
706 Ga0495604_0000111 3300047317 Bacteria 68576
707 Ga0495604_0195457 3300047317 Bacteria 1407
708 Ga0495636_0193453 3300047318 Bacteria 926
709 Ga0495674_0039026 3300047319 Bacteria 4257
710 Ga0495674_0039406 3300047319 Bacteria 4235
711 Ga0495674_0077523 3300047319 Bacteria 2857
712 Ga0495676_0007744 3300047321 Bacteria 9855
713 Ga0495676_0023091 3300047321 Bacteria 5403
714 Ga0495676_0041233 3300047321 Bacteria 3801
715 Ga0495680_0019156 3300047322 Bacteria 5789
716 Ga0495680_0035061 3300047322 Bacteria 4045
717 Ga0495680_0035134 3300047322 Bacteria 4039
718 Ga0495680_0101234 3300047322 Bacteria 2146
719 Ga0495675_0000269 3300047444 Bacteria 37748
720 Ga0495685_051438 3300047447 Bacteria 1397
721 Ga0495685_156318 3300047447 Bacteria 740
722 Ga0495684_0007069 3300047471 Bacteria 8713
723 Ga0495684_0019190 3300047471 Bacteria 5262
724 Ga0495684_0028360 3300047471 Bacteria 4298
725 Ga0495684_0072972 3300047471 Bacteria 2607
726 Ga0495593_0001801 3300047673 Bacteria 12729
727 Ga0495602_0006456 3300048088 Bacteria 12295
728 Ga0495602_0058330 3300048088 Bacteria 3379
729 Ga0495602_0276630 3300048088 Bacteria 1239
730 Ga0495614_0001124 3300048089 Bacteria 11490
731 Ga0495614_0086288 3300048089 Bacteria 1363
732 Ga0496100_0081197 3300048903 Bacteria 2190
733 Ga0496100_0155982 3300048903 Bacteria 1633
734 Ga0496101_0054399 3300048904 Unclassified 2890
735 Ga0496101_0063607 3300048904 Bacteria 2686
736 Ga0496101_0291893 3300048904 Bacteria 1276
737 Ga0496101_0308477 3300048904 Bacteria 1240
738 Ga0496102_0042738 3300048905 Bacteria 4108
739 Ga0496102_0113738 3300048905 Bacteria 2525
740 Ga0496102_0276811 3300048905 Bacteria 1582
741 Ga0496103_0025317 3300048906 Bacteria 3585
742 Ga0496104_0006439 3300048907 Bacteria 10322
743 Ga0496104_0028580 3300048907 Bacteria 5168
744 Ga0496104_0036322 3300048907 Bacteria 4606
745 Ga0496104_0118833 3300048907 Bacteria 2538
746 Ga0496104_0388266 3300048907 Bacteria 1308
747 Ga0496105_0001401 3300048908 Bacteria 16942
748 Ga0496105_0011337 3300048908 Bacteria 7040
749 Ga0496105_0043302 3300048908 Bacteria 3713
750 Ga0496105_0048667 3300048908 Bacteria 3499
751 Ga0496106_0019249 3300048909 Bacteria 5063
752 Ga0496106_0148408 3300048909 Bacteria 1848
753 Ga0496106_0544241 3300048909 Unclassified 932
754 Ga0496107_0105074 3300048910 Bacteria 2073
755 Ga0496107_0121564 3300048910 Bacteria 1924
756 Ga0496107_0394022 3300048910 Bacteria 1030
757 Ga0496107_0414886 3300048910 Bacteria 1001
758 Ga0496107_0438241 3300048910 Bacteria 971
759 Ga0496107_0527720 3300048910 Bacteria 875
760 Ga0496108_0015080 3300048911 Bacteria 6309
761 Ga0496108_0062022 3300048911 Bacteria 3148
762 Ga0496108_0098698 3300048911 Bacteria 2488
763 Ga0496108_0111143 3300048911 Bacteria 2343
764 Ga0496108_0380606 3300048911 Bacteria 1232
765 Ga0496108_0750480 3300048911 Bacteria 844
766 Ga0496109_0007539 3300048912 Bacteria 9221
767 Ga0496109_0024995 3300048912 Bacteria 5317
768 Ga0496109_0025340 3300048912 Bacteria 5284
769 Ga0496109_0034439 3300048912 Bacteria 4560
770 Ga0496109_0037616 3300048912 Bacteria 4372
771 Ga0496109_0056106 3300048912 Bacteria 3594
772 Ga0496109_0540410 3300048912 Bacteria 1099
773 Ga0496110_0001330 3300048913 Bacteria 17765
774 Ga0496110_0004457 3300048913 Bacteria 10855
775 Ga0496110_0014989 3300048913 Bacteria 6445
776 Ga0496110_0126452 3300048913 Bacteria 2306
777 Ga0496110_0178148 3300048913 Bacteria 1930
778 Ga0496110_0200048 3300048913 Bacteria 1815
779 Ga0496110_0221527 3300048913 Bacteria 1720
780 Ga0496110_0339570 3300048913 Bacteria 1368
781 Ga0496110_0648437 3300048913 Bacteria 956
782 Ga0496111_0000032 3300048914 Bacteria 55961
783 Ga0496111_0068765 3300048914 Bacteria 2574
784 Ga0496111_0175602 3300048914 Bacteria 1592
785 Ga0496112_0062538 3300048915 Bacteria 3672
786 Ga0496112_0080458 3300048915 Bacteria 3222
787 Ga0496112_0127978 3300048915 Bacteria 2510
788 Ga0496112_0266672 3300048915 Bacteria 1661
789 Ga0496113_0002660 3300048916 Bacteria 10470
790 Ga0496113_0066603 3300048916 Bacteria 2728
791 Ga0496113_0135654 3300048916 Bacteria 1934
792 Ga0496113_0572661 3300048916 Bacteria 905
793 Ga0496114_0020590 3300048917 Bacteria 5354
794 Ga0496114_0030412 3300048917 Bacteria 4443
795 Ga0496114_0101522 3300048917 Bacteria 2456
796 Ga0496114_0145592 3300048917 Bacteria 2053
797 Ga0496114_0223164 3300048917 Bacteria 1654
798 Ga0496114_0255138 3300048917 Unclassified 1543
799 Ga0496115_0033089 3300048918 Bacteria 4080
800 Ga0496115_0046857 3300048918 Bacteria 3456
801 Ga0496115_0067297 3300048918 Bacteria 2897
802 Ga0496115_0136910 3300048918 Bacteria 2019
803 Ga0501031_0004130 3300049568 Bacteria 9380
804 Ga0501031_0021989 3300049568 Bacteria 4156
805 Ga0501031_0031234 3300049568 Bacteria 3474
806 Ga0501031_0145221 3300049568 Bacteria 1550
807 Ga0501031_0190213 3300049568 Bacteria 1340
808 Ga0501031_0302569 3300049568 Bacteria 1036
809 Ga0501032_0025748 3300049569 Bacteria 4055
810 Ga0501033_0024673 3300049570 Bacteria 4534
811 Ga0501033_0153308 3300049570 Bacteria 1661
812 Ga0501033_0425716 3300049570 Bacteria 924
813 Ga0501034_0147911 3300049571 Bacteria 2326
814 Ga0501034_0180252 3300049571 Bacteria 2077
815 Ga0501036_0008004 3300049572 Bacteria 8650
816 Ga0501036_0016593 3300049572 Bacteria 6150
817 Ga0501036_0024991 3300049572 Bacteria 5038
818 Ga0501036_0025945 3300049572 Bacteria 4944
819 Ga0501036_0190515 3300049572 Bacteria 1725
820 Ga0501036_0262728 3300049572 Bacteria 1446
821 Ga0501037_0198657 3300049573 Bacteria 1418
822 Ga0501038_0007786 3300049574 Bacteria 9871
823 Ga0501038_0022966 3300049574 Bacteria 5583
824 Ga0501038_0027466 3300049574 Bacteria 5062
825 Ga0501038_0057562 3300049574 Bacteria 3337
826 Ga0501038_0215717 3300049574 Bacteria 1533
827 Ga0501039_0012132 3300049575 Bacteria 6570
828 Ga0501039_0015380 3300049575 Bacteria 5857
829 Ga0501039_0015712 3300049575 Bacteria 5791
830 Ga0501039_0143576 3300049575 Bacteria 1875
831 Ga0501039_0192535 3300049575 Bacteria 1603
832 Ga0501040_0004395 3300049576 Bacteria 9157
833 Ga0501040_0010534 3300049576 Bacteria 6047
834 Ga0501040_0013989 3300049576 Bacteria 5283
835 Ga0501040_0014456 3300049576 Bacteria 5200
836 Ga0501040_0015141 3300049576 Bacteria 5095
837 Ga0501040_0044449 3300049576 Bacteria 3028
838 Ga0501040_0605599 3300049576 Bacteria 791
839 Ga0501041_0009218 3300049577 Bacteria 5812
840 Ga0501041_0017314 3300049577 Bacteria 4288
841 Ga0501041_0027728 3300049577 Bacteria 3414
842 Ga0501041_0087337 3300049577 Bacteria 1924
843 Ga0501042_0027464 3300049578 Bacteria 4002
844 Ga0501042_0062802 3300049578 Bacteria 2654
845 Ga0501042_0078920 3300049578 Bacteria 2358
846 Ga0501042_0097272 3300049578 Bacteria 2115
847 Ga0501042_0120088 3300049578 Bacteria 1892
848 Ga0501042_0141559 3300049578 Bacteria 1734
849 Ga0501043_0068441 3300049579 Bacteria 2787
850 Ga0501043_0189854 3300049579 Bacteria 1598
851 Ga0501046_0095509 3300049580 Bacteria 2283
852 Ga0501046_0103821 3300049580 Bacteria 2178
853 Ga0501046_0105497 3300049580 Bacteria 2158
854 Ga0501046_0118277 3300049580 Bacteria 2018
855 Ga0501046_0133899 3300049580 Bacteria 1878
856 Ga0501046_0179797 3300049580 Bacteria 1582
857 Ga0501046_0395322 3300049580 Bacteria 999
858 Ga0501048_0091882 3300049582 Bacteria 2140
859 Ga0501048_0110777 3300049582 Bacteria 1938
860 Ga0501048_0117411 3300049582 Bacteria 1879
861 Ga0501048_0121674 3300049582 Bacteria 1844
862 Ga0501067_0004259 3300049583 Bacteria 7890
863 Ga0501067_0091179 3300049583 Bacteria 1692
864 Ga0501068_0003825 3300049584 Bacteria 8165
865 Ga0501068_0012024 3300049584 Bacteria 4897
866 Ga0501068_0022024 3300049584 Bacteria 3724
867 Ga0501068_0234268 3300049584 Unclassified 1168
868 Ga0501069_0006559 3300049585 Bacteria 6085
869 Ga0501069_0108936 3300049585 Bacteria 1576
870 Ga0501070_0057731 3300049586 Bacteria 3218
871 Ga0501070_0112778 3300049586 Bacteria 2247
872 Ga0501070_0171936 3300049586 Bacteria 1784
873 Ga0501070_0553486 3300049586 Unclassified 921
874 Ga0501071_0000662 3300049587 Bacteria 17990
875 Ga0501071_0002358 3300049587 Bacteria 11428
876 Ga0501071_0003764 3300049587 Bacteria 9525
877 Ga0501071_0017605 3300049587 Bacteria 4932
878 Ga0501071_0109438 3300049587 Bacteria 2041
879 Ga0501071_0124740 3300049587 Bacteria 1910
880 Ga0501072_0009405 3300049588 Bacteria 7433
881 Ga0501072_0014926 3300049588 Bacteria 5953
882 Ga0501072_0043954 3300049588 Bacteria 3512
883 Ga0501072_0165441 3300049588 Bacteria 1764
884 Ga0501072_0746376 3300049588 Bacteria 768
885 Ga0501073_0017993 3300049589 Bacteria 5110
886 Ga0501073_0028772 3300049589 Bacteria 3970
887 Ga0501073_0121910 3300049589 Bacteria 1807
888 Ga0501074_0025399 3300049590 Bacteria 4302
889 Ga0501074_0054282 3300049590 Bacteria 2890
890 Ga0501074_0202049 3300049590 Bacteria 1416
891 Ga0501075_0006475 3300049591 Bacteria 8059
892 Ga0501075_0009784 3300049591 Bacteria 6719
893 Ga0501075_0021498 3300049591 Bacteria 4705
894 Ga0501075_0141940 3300049591 Bacteria 1830
895 Ga0501075_0302866 3300049591 Bacteria 1218
896 Ga0501075_0305890 3300049591 Bacteria 1211
897 Ga0501076_0002743 3300049592 Bacteria 12198
898 Ga0501076_0004119 3300049592 Bacteria 10281
899 Ga0501076_0008503 3300049592 Bacteria 7522
900 Ga0501076_0022464 3300049592 Bacteria 4847
901 Ga0501076_0034678 3300049592 Bacteria 3945
902 Ga0501076_0131669 3300049592 Bacteria 2028
903 Ga0501077_0011297 3300049593 Bacteria 5576
904 Ga0501077_0011863 3300049593 Bacteria 5449
905 Ga0501077_0013786 3300049593 Bacteria 5069
906 Ga0501077_0015480 3300049593 Bacteria 4802
907 Ga0501077_0059599 3300049593 Bacteria 2422
908 Ga0501077_0116353 3300049593 Bacteria 1694
909 Ga0501079_0001035 3300049741 Bacteria 19256
910 Ga0501079_0006655 3300049741 Bacteria 8692
911 Ga0501079_0019804 3300049741 Bacteria 5141
912 Ga0501079_0030888 3300049741 Bacteria 4116
913 Ga0501079_0124106 3300049741 Bacteria 2009
914 Ga0501079_0698593 3300049741 Unclassified 798
915 Ga0501080_0003647 3300049742 Bacteria 13590
916 Ga0501080_0029574 3300049742 Bacteria 5101
917 Ga0501080_0040480 3300049742 Bacteria 4346
918 Ga0501080_0051488 3300049742 Bacteria 3831
919 Ga0501080_0102925 3300049742 Bacteria 2648
920 Ga0501080_0244698 3300049742 Bacteria 1636
921 Ga0501081_0013919 3300049743 Bacteria 5295
922 Ga0501081_0048542 3300049743 Bacteria 2921
923 Ga0501081_0063891 3300049743 Bacteria 2555
924 Ga0501081_0099746 3300049743 Bacteria 2052
925 Ga0501081_0099892 3300049743 Bacteria 2050
926 Ga0501081_0120340 3300049743 Bacteria 1869
927 Ga0501081_0125495 3300049743 Bacteria 1830
928 Ga0501081_0130527 3300049743 Bacteria 1795
929 Ga0501081_0471520 3300049743 Unclassified 934
930 Ga0501083_0016349 3300049744 Bacteria 5195
931 Ga0501083_0048521 3300049744 Bacteria 2865
932 Ga0501083_0104507 3300049744 Bacteria 1866
933 Ga0501035_0011508 3300049822 Bacteria 8199
934 Ga0501035_0036848 3300049822 Bacteria 4431
935 Ga0501035_0586551 3300049822 Bacteria 910
936 Ga0501044_0659558 3300049823 Unclassified 935
937 Ga0501045_0012025 3300049824 Bacteria 6084
938 Ga0501045_0045550 3300049824 Bacteria 3193
939 Ga0501045_0100698 3300049824 Bacteria 2138
940 Ga0501045_0134883 3300049824 Bacteria 1835
941 Ga0501045_0375467 3300049824 Bacteria 1058
942 nmdc:mga00v17_151205_c1 3300050491 Bacteria 1492
943 nmdc:mga0yw44_13142_c1 3300050492 Bacteria 4347
944 nmdc:mga0yw44_486881_c1 3300050492 Bacteria 837
945 nmdc:mga05p37_33357_c1 3300050507 Bacteria 6306
946 nmdc:mga05p37_468043_c1 3300050507 Bacteria 1455
947 nmdc:mga05p37_828795_c1 3300050507 Bacteria 1008
948 nmdc:mga0qj67_81380_c1 3300050509 Bacteria 2596
949 nmdc:mga06r32_623040_c1 3300050510 Bacteria 1048
950 nmdc:mga06r32_664645_c1 3300050510 Bacteria 1009
951 nmdc:mga08y16_220279_c1 3300050511 Bacteria 1965
952 nmdc:mga08y16_226420_c1 3300050511 Bacteria 1935
953 nmdc:mga08y16_301178_c1 3300050511 Bacteria 1652
954 nmdc:mga08y16_71033_c1 3300050511 Bacteria 3629
955 nmdc:mga08y16_80438_c1 3300050511 Bacteria 3397
956 nmdc:mga0n895_1025339_c1 3300050512 Bacteria 805
957 nmdc:mga0n895_180440_c1 3300050512 Bacteria 2143
958 nmdc:mga0n895_18289_c1 3300050512 Bacteria 6481
959 nmdc:mga0n895_25870_c1 3300050512 Bacteria 5551
960 nmdc:mga0rr50_13713_c1 3300050513 Bacteria 5288
961 nmdc:mga0rr50_37076_c1 3300050513 Bacteria 3516
962 nmdc:mga0rr50_3765_c2 3300050513 Bacteria 4255
963 nmdc:mga0rr50_41479_c1 3300050513 Bacteria 3354
964 nmdc:mga0rr50_635422_c1 3300050513 Bacteria 911
965 nmdc:mga08x19_661623_c1 3300050514 Bacteria 741
966 nmdc:mga08x19_9687_c1 3300050514 Bacteria 5768
967 nmdc:mga0a205_130345_c1 3300050515 Bacteria 2415
968 nmdc:mga0a205_35285_c1 3300050515 Bacteria 4802
969 nmdc:mga0a205_615979_c1 3300050515 Bacteria 938
970 nmdc:mga0a205_85268_c1 3300050515 Bacteria 3051
971 Ga0495601_0000390 3300053077 Bacteria 23265
972 Ga0495601_0001759 3300053077 Bacteria 11994
973 Ga0495601_0030181 3300053077 Bacteria 3365
974 Ga0495601_0162919 3300053077 Bacteria 1457
975 Ga0495601_0247728 3300053077 Unclassified 1163
976 Ga0495612_0001906 3300053078 Bacteria 8581
977 Ga0495612_0016196 3300053078 Bacteria 2987
978 Ga0495595_0011388 3300053084 Bacteria 3717
979 Ga0495595_0024017 3300053084 Bacteria 2689
980 Ga0495595_0028065 3300053084 Bacteria 2512
981 Ga0495595_0127114 3300053084 Bacteria 1244
982 Ga0495595_0263214 3300053084 Bacteria 864
983 Ga0495595_0335714 3300053084 Unclassified 762
984 Ga0495619_0004098 3300053085 Bacteria 9329
985 Ga0495619_0038421 3300053085 Bacteria 3123
986 Ga0495619_0111793 3300053085 Bacteria 1867
987 Ga0495619_0139034 3300053085 Bacteria 1672
988 Ga0501084_0004616 3300054114 Bacteria 11251
989 Ga0501084_0027772 3300054114 Bacteria 4729
990 Ga0501084_0095950 3300054114 Bacteria 2490
991 Ga0501084_0125126 3300054114 Bacteria 2163
992 Ga0501084_0146704 3300054114 Bacteria 1987
993 Ga0501084_0153509 3300054114 Bacteria 1941
994 Ga0501084_0736170 3300054114 Bacteria 831
995 Ga0501082_0006621 3300060353 Bacteria 10026
996 Ga0501082_0016686 3300060353 Bacteria 6324
997 Ga0501082_0024304 3300060353 Bacteria 5223
998 Ga0501082_0026950 3300060353 Bacteria 4951
999 Ga0501082_0086289 3300060353 Bacteria 2707
1000 Ga0530510_0017996 3300061734 Bacteria 5008
1001 Ga0530510_0117033 3300061734 Bacteria 1954
1002 Ga0530510_0118013 3300061734 Bacteria 1946
1003 Ga0530510_0259018 3300061734 Bacteria 1297
1004 Ga0530510_0578857 3300061734 Unclassified 853
1005 Ga0530510_0614558 3300061734 Bacteria 827

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041491 Ga0451833_0356990 Ga0451833_0356990_142_732 173
2 3300037418 Ga0395900_0295472 Ga0395900_0295472_450_1148 192
3 3300037312 Ga0395899_0043736 Ga0395899_0043736_2069_2782 193
4 3300037418 Ga0395900_0032901 Ga0395900_0032901_509_1222 193
5 3300037466 Ga0395898_0042127 Ga0395898_0042127_967_1680 193
6 3300038443 Ga0395901_0026136 Ga0395901_0026136_4248_4961 193
7 3300046511 Ga0495608_0125010 Ga0495608_0125010_65_769 193
8 3300046559 Ga0495667_0281579 Ga0495667_0281579_57_761 193
9 3300026023 Ga0207677_10095392 Ga0207677_100953923 197
10 3300044901 Ga0466960_0004248 Ga0466960_0004248_1713_2411 198
11 3300005937 Ga0081455_10027092 Ga0081455_100270923 201
12 3300025926 Ga0207659_10555281 Ga0207659_105552811 201
13 3300026116 Ga0207674_10098354 Ga0207674_100983544 201
14 3300005440 Ga0070705_100016331 Ga0070705_1000163313 202
15 3300005467 Ga0070706_100079668 Ga0070706_1000796682 202
16 3300005468 Ga0070707_100576395 Ga0070707_1005763951 202
17 3300005518 Ga0070699_100018076 Ga0070699_1000180765 202
18 3300046689 Ga0495613_0433742 Ga0495613_0433742_265_879 202
19 3300049588 Ga0501072_0746376 Ga0501072_0746376_18_629 202
20 3300050507 nmdc:mga05p37_828795_c1 nmdc:mga05p37_828795_c1_357_992 204
21 3300046463 Ga0495653_0253515 Ga0495653_0253515_190_810 205
22 3300046514 Ga0495618_0088301 Ga0495618_0088301_779_1399 205
23 3300046559 Ga0495667_0194273 Ga0495667_0194273_447_1067 205
24 3300053084 Ga0495595_0263214 Ga0495595_0263214_141_761 205
25 3300053085 Ga0495619_0139034 Ga0495619_0139034_644_1264 205
26 3300009094 Ga0111539_10132468 Ga0111539_101324683 208
27 3300010375 Ga0105239_10118833 Ga0105239_101188332 208
28 3300014745 Ga0157377_10404594 Ga0157377_104045941 208
29 3300046455 Ga0495603_0235373 Ga0495603_0235373_79_708 208
30 3300046473 Ga0495582_0055400 Ga0495582_0055400_770_1399 208
31 3300048913 Ga0496110_0221527 Ga0496110_0221527_692_1321 208
32 3300049568 Ga0501031_0021989 Ga0501031_0021989_371_1000 208
33 3300049568 Ga0501031_0302569 Ga0501031_0302569_88_717 208
34 3300049570 Ga0501033_0153308 Ga0501033_0153308_658_1287 208
35 3300049570 Ga0501033_0425716 Ga0501033_0425716_94_723 208
36 3300049571 Ga0501034_0147911 Ga0501034_0147911_1236_1865 208
37 3300049572 Ga0501036_0024991 Ga0501036_0024991_708_1337 208
38 3300049572 Ga0501036_0025945 Ga0501036_0025945_827_1456 208
39 3300049574 Ga0501038_0007786 Ga0501038_0007786_6076_6705 208
40 3300049575 Ga0501039_0015380 Ga0501039_0015380_3117_3746 208
41 3300049576 Ga0501040_0014456 Ga0501040_0014456_3852_4481 208
42 3300049576 Ga0501040_0044449 Ga0501040_0044449_1826_2455 208
43 3300049577 Ga0501041_0027728 Ga0501041_0027728_366_995 208
44 3300049578 Ga0501042_0062802 Ga0501042_0062802_176_805 208
45 3300049578 Ga0501042_0097272 Ga0501042_0097272_759_1388 208
46 3300049579 Ga0501043_0189854 Ga0501043_0189854_809_1438 208
47 3300049580 Ga0501046_0118277 Ga0501046_0118277_652_1281 208
48 3300049580 Ga0501046_0133899 Ga0501046_0133899_639_1268 208
49 3300049582 Ga0501048_0091882 Ga0501048_0091882_571_1200 208
50 3300049582 Ga0501048_0121674 Ga0501048_0121674_1130_1759 208
51 3300049584 Ga0501068_0012024 Ga0501068_0012024_3443_4072 208
52 3300049585 Ga0501069_0108936 Ga0501069_0108936_781_1410 208
53 3300049586 Ga0501070_0171936 Ga0501070_0171936_720_1349 208
54 3300049587 Ga0501071_0002358 Ga0501071_0002358_10043_10672 208
55 3300049587 Ga0501071_0109438 Ga0501071_0109438_238_867 208
56 3300049588 Ga0501072_0043954 Ga0501072_0043954_686_1315 208
57 3300049588 Ga0501072_0165441 Ga0501072_0165441_770_1399 208
58 3300049589 Ga0501073_0028772 Ga0501073_0028772_2955_3584 208
59 3300049590 Ga0501074_0054282 Ga0501074_0054282_56_685 208
60 3300049591 Ga0501075_0009784 Ga0501075_0009784_622_1251 208
61 3300049591 Ga0501075_0305890 Ga0501075_0305890_515_1144 208
62 3300049592 Ga0501076_0004119 Ga0501076_0004119_4723_5352 208
63 3300049592 Ga0501076_0034678 Ga0501076_0034678_2324_2953 208
64 3300049593 Ga0501077_0011863 Ga0501077_0011863_3004_3633 208
65 3300049593 Ga0501077_0013786 Ga0501077_0013786_189_818 208
66 3300049593 Ga0501077_0015480 Ga0501077_0015480_244_873 208
67 3300049741 Ga0501079_0030888 Ga0501079_0030888_371_1000 208
68 3300049741 Ga0501079_0124106 Ga0501079_0124106_708_1337 208
69 3300049742 Ga0501080_0102925 Ga0501080_0102925_72_701 208
70 3300049742 Ga0501080_0244698 Ga0501080_0244698_390_1019 208
71 3300049743 Ga0501081_0099892 Ga0501081_0099892_1130_1759 208
72 3300049743 Ga0501081_0120340 Ga0501081_0120340_857_1486 208
73 3300049822 Ga0501035_0011508 Ga0501035_0011508_659_1288 208
74 3300049824 Ga0501045_0012025 Ga0501045_0012025_5075_5704 208
75 3300049824 Ga0501045_0134883 Ga0501045_0134883_203_832 208
76 3300050511 nmdc:mga08y16_80438_c1 nmdc:mga08y16_80438_c1_1842_2471 208
77 3300054114 Ga0501084_0146704 Ga0501084_0146704_762_1391 208
78 3300060353 Ga0501082_0024304 Ga0501082_0024304_4076_4705 208
79 3300060353 Ga0501082_0026950 Ga0501082_0026950_4056_4685 208
80 3300061734 Ga0530510_0117033 Ga0530510_0117033_752_1381 208
81 3300061734 Ga0530510_0614558 Ga0530510_0614558_114_743 208
82 3300005437 Ga0070710_10365305 Ga0070710_103653052 209
83 3300009147 Ga0114129_10327665 Ga0114129_103276652 209
84 3300009176 Ga0105242_10578191 Ga0105242_105781912 209
85 3300031995 Ga0307409_100079707 Ga0307409_1000797072 209
86 3300037312 Ga0395899_0003978 Ga0395899_0003978_5299_5931 209
87 3300037418 Ga0395900_0002131 Ga0395900_0002131_18647_19279 209
88 3300037466 Ga0395898_0007822 Ga0395898_0007822_3648_4280 209
89 3300037471 Ga0395905_0000568 Ga0395905_0000568_7556_8188 209
90 3300038443 Ga0395901_0069980 Ga0395901_0069980_1934_2566 209
91 3300049741 Ga0501079_0698593 Ga0501079_0698593_134_769 209
92 3300049743 Ga0501081_0099746 Ga0501081_0099746_1086_1721 209
93 3300054114 Ga0501084_0125126 Ga0501084_0125126_1201_1836 209
94 3300031240 Ga0265320_10023981 Ga0265320_100239813 210
95 3300031344 Ga0265316_10053799 Ga0265316_100537992 210
96 3300005328 Ga0070676_10274992 Ga0070676_102749922 211
97 3300005329 Ga0070683_100010526 Ga0070683_1000105263 211
98 3300005329 Ga0070683_100108788 Ga0070683_1001087881 211
99 3300005331 Ga0070670_100004558 Ga0070670_10000455811 211
100 3300005331 Ga0070670_100445513 Ga0070670_1004455131 211
101 3300005331 Ga0070670_100506941 Ga0070670_1005069411 211
102 3300005333 Ga0070677_10117878 Ga0070677_101178782 211
103 3300005334 Ga0068869_100266316 Ga0068869_1002663162 211
104 3300005335 Ga0070666_10261571 Ga0070666_102615712 211
105 3300005336 Ga0070680_100058836 Ga0070680_1000588364 211
106 3300005336 Ga0070680_100089834 Ga0070680_1000898341 211
107 3300005337 Ga0070682_100027742 Ga0070682_1000277422 211
108 3300005337 Ga0070682_100209756 Ga0070682_1002097562 211
109 3300005338 Ga0068868_100007316 Ga0068868_1000073166 211
110 3300005338 Ga0068868_100350397 Ga0068868_1003503972 211
111 3300005339 Ga0070660_100010010 Ga0070660_1000100107 211
112 3300005339 Ga0070660_100127818 Ga0070660_1001278182 211
113 3300005340 Ga0070689_100040095 Ga0070689_1000400955 211
114 3300005341 Ga0070691_10013064 Ga0070691_100130645 211
115 3300005343 Ga0070687_100251789 Ga0070687_1002517892 211
116 3300005343 Ga0070687_100281023 Ga0070687_1002810232 211
117 3300005344 Ga0070661_100005618 Ga0070661_1000056183 211
118 3300005344 Ga0070661_100172986 Ga0070661_1001729862 211
119 3300005345 Ga0070692_10018623 Ga0070692_100186234 211
120 3300005345 Ga0070692_10043384 Ga0070692_100433842 211
121 3300005345 Ga0070692_10055417 Ga0070692_100554171 211
122 3300005353 Ga0070669_100303530 Ga0070669_1003035301 211
123 3300005353 Ga0070669_100360689 Ga0070669_1003606892 211
124 3300005354 Ga0070675_100008298 Ga0070675_1000082987 211
125 3300005354 Ga0070675_100020892 Ga0070675_1000208924 211
126 3300005354 Ga0070675_100064048 Ga0070675_1000640482 211
127 3300005355 Ga0070671_100099507 Ga0070671_1000995074 211
128 3300005355 Ga0070671_100235294 Ga0070671_1002352942 211
129 3300005356 Ga0070674_100004873 Ga0070674_1000048735 211
130 3300005364 Ga0070673_100015557 Ga0070673_1000155576 211
131 3300005364 Ga0070673_100101873 Ga0070673_1001018732 211
132 3300005364 Ga0070673_100198516 Ga0070673_1001985163 211
133 3300005365 Ga0070688_100001368 Ga0070688_1000013689 211
134 3300005366 Ga0070659_100021773 Ga0070659_1000217732 211
135 3300005366 Ga0070659_100104689 Ga0070659_1001046891 211
136 3300005434 Ga0070709_10139929 Ga0070709_101399293 211
137 3300005438 Ga0070701_10322995 Ga0070701_103229951 211
138 3300005440 Ga0070705_100166789 Ga0070705_1001667892 211
139 3300005441 Ga0070700_100258893 Ga0070700_1002588932 211
140 3300005444 Ga0070694_100312771 Ga0070694_1003127712 211
141 3300005455 Ga0070663_100463186 Ga0070663_1004631861 211
142 3300005456 Ga0070678_100120198 Ga0070678_1001201982 211
143 3300005457 Ga0070662_100049741 Ga0070662_1000497413 211
144 3300005458 Ga0070681_10525567 Ga0070681_105255672 211
145 3300005459 Ga0068867_100125736 Ga0068867_1001257363 211
146 3300005459 Ga0068867_100368487 Ga0068867_1003684871 211
147 3300005466 Ga0070685_10079141 Ga0070685_100791412 211
148 3300005518 Ga0070699_100346905 Ga0070699_1003469051 211
149 3300005535 Ga0070684_100054320 Ga0070684_1000543202 211
150 3300005535 Ga0070684_100058008 Ga0070684_1000580082 211
151 3300005535 Ga0070684_100150315 Ga0070684_1001503152 211
152 3300005535 Ga0070684_100363746 Ga0070684_1003637462 211
153 3300005539 Ga0068853_100462979 Ga0068853_1004629792 211
154 3300005543 Ga0070672_100052860 Ga0070672_1000528605 211
155 3300005543 Ga0070672_100133499 Ga0070672_1001334992 211
156 3300005544 Ga0070686_100096566 Ga0070686_1000965662 211
157 3300005546 Ga0070696_100140374 Ga0070696_1001403741 211
158 3300005546 Ga0070696_100221629 Ga0070696_1002216292 211
159 3300005547 Ga0070693_100020916 Ga0070693_1000209162 211
160 3300005547 Ga0070693_100055327 Ga0070693_1000553273 211
161 3300005548 Ga0070665_100005986 Ga0070665_10000598612 211
162 3300005548 Ga0070665_100517631 Ga0070665_1005176312 211
163 3300005549 Ga0070704_100456241 Ga0070704_1004562412 211
164 3300005549 Ga0070704_100687007 Ga0070704_1006870071 211
165 3300005563 Ga0068855_100060313 Ga0068855_1000603135 211
166 3300005564 Ga0070664_100018297 Ga0070664_1000182972 211
167 3300005564 Ga0070664_100098010 Ga0070664_1000980103 211
168 3300005564 Ga0070664_100249567 Ga0070664_1002495673 211
169 3300005577 Ga0068857_100608227 Ga0068857_1006082272 211
170 3300005578 Ga0068854_100069129 Ga0068854_1000691292 211
171 3300005614 Ga0068856_100043524 Ga0068856_1000435246 211
172 3300005614 Ga0068856_100274019 Ga0068856_1002740192 211
173 3300005615 Ga0070702_100040560 Ga0070702_1000405602 211
174 3300005615 Ga0070702_100122272 Ga0070702_1001222723 211
175 3300005616 Ga0068852_100032201 Ga0068852_1000322016 211
176 3300005616 Ga0068852_100194564 Ga0068852_1001945642 211
177 3300005617 Ga0068859_100048871 Ga0068859_1000488713 211
178 3300005618 Ga0068864_100015513 Ga0068864_10001551310 211
179 3300005718 Ga0068866_10361364 Ga0068866_103613641 211
180 3300005719 Ga0068861_100216134 Ga0068861_1002161342 211
181 3300005719 Ga0068861_100407148 Ga0068861_1004071482 211
182 3300005841 Ga0068863_100331038 Ga0068863_1003310381 211
183 3300005937 Ga0081455_10090237 Ga0081455_100902372 211
184 3300006038 Ga0075365_10066531 Ga0075365_100665313 211
185 3300006051 Ga0075364_10086130 Ga0075364_100861302 211
186 3300006178 Ga0075367_10017839 Ga0075367_100178396 211
187 3300006237 Ga0097621_100485250 Ga0097621_1004852502 211
188 3300006358 Ga0068871_100629787 Ga0068871_1006297872 211
189 3300006847 Ga0075431_100296531 Ga0075431_1002965312 211
190 3300006852 Ga0075433_10440588 Ga0075433_104405881 211
191 3300006871 Ga0075434_100858593 Ga0075434_1008585932 211
192 3300006931 Ga0097620_100048873 Ga0097620_1000488734 211
193 3300007076 Ga0075435_100018197 Ga0075435_1000181972 211
194 3300009036 Ga0105244_10064564 Ga0105244_100645642 211
195 3300009094 Ga0111539_10072315 Ga0111539_100723153 211
196 3300009094 Ga0111539_10160340 Ga0111539_101603401 211
197 3300009094 Ga0111539_11136095 Ga0111539_111360952 211
198 3300009098 Ga0105245_10005762 Ga0105245_100057628 211
199 3300009098 Ga0105245_10068041 Ga0105245_100680413 211
200 3300009098 Ga0105245_10224154 Ga0105245_102241542 211
201 3300009101 Ga0105247_10041847 Ga0105247_100418473 211
202 3300009147 Ga0114129_10696914 Ga0114129_106969141 211
203 3300009148 Ga0105243_10004817 Ga0105243_100048179 211
204 3300009148 Ga0105243_10234139 Ga0105243_102341392 211
205 3300009176 Ga0105242_10020716 Ga0105242_100207163 211
206 3300009176 Ga0105242_10043812 Ga0105242_100438122 211
207 3300009177 Ga0105248_10034523 Ga0105248_100345232 211
208 3300009545 Ga0105237_10214426 Ga0105237_102144262 211
209 3300009551 Ga0105238_10166990 Ga0105238_101669902 211
210 3300009553 Ga0105249_10382062 Ga0105249_103820622 211
211 3300010375 Ga0105239_10055777 Ga0105239_100557772 211
212 3300011119 Ga0105246_10018147 Ga0105246_100181474 211
213 3300011119 Ga0105246_10509397 Ga0105246_105093972 211
214 3300013102 Ga0157371_10014451 Ga0157371_100144512 211
215 3300013102 Ga0157371_10414982 Ga0157371_104149821 211
216 3300013296 Ga0157374_10093309 Ga0157374_100933093 211
217 3300013297 Ga0157378_10096674 Ga0157378_100966742 211
218 3300013306 Ga0163162_10590259 Ga0163162_105902592 211
219 3300013307 Ga0157372_10399051 Ga0157372_103990512 211
220 3300013307 Ga0157372_10756652 Ga0157372_107566522 211
221 3300013307 Ga0157372_10853533 Ga0157372_108535332 211
222 3300013308 Ga0157375_10308447 Ga0157375_103084472 211
223 3300013308 Ga0157375_10651570 Ga0157375_106515701 211
224 3300014326 Ga0157380_10177687 Ga0157380_101776872 211
225 3300014326 Ga0157380_10374611 Ga0157380_103746112 211
226 3300014745 Ga0157377_10003642 Ga0157377_100036423 211
227 3300014745 Ga0157377_10010514 Ga0157377_100105142 211
228 3300014968 Ga0157379_10018230 Ga0157379_100182307 211
229 3300017792 Ga0163161_10125777 Ga0163161_101257772 211
230 3300025321 Ga0207656_10094560 Ga0207656_100945601 211
231 3300025899 Ga0207642_10048351 Ga0207642_100483512 211
232 3300025899 Ga0207642_10283007 Ga0207642_102830072 211
233 3300025900 Ga0207710_10044172 Ga0207710_100441722 211
234 3300025901 Ga0207688_10003730 Ga0207688_100037304 211
235 3300025901 Ga0207688_10017875 Ga0207688_100178753 211
236 3300025901 Ga0207688_10033778 Ga0207688_100337782 211
237 3300025904 Ga0207647_10082493 Ga0207647_100824932 211
238 3300025906 Ga0207699_10305052 Ga0207699_103050522 211
239 3300025907 Ga0207645_10068502 Ga0207645_100685022 211
240 3300025908 Ga0207643_10012440 Ga0207643_100124406 211
241 3300025912 Ga0207707_10180597 Ga0207707_101805973 211
242 3300025912 Ga0207707_10575366 Ga0207707_105753662 211
243 3300025912 Ga0207707_10599383 Ga0207707_105993832 211
244 3300025914 Ga0207671_10328029 Ga0207671_103280292 211
245 3300025918 Ga0207662_10047174 Ga0207662_100471742 211
246 3300025919 Ga0207657_10023123 Ga0207657_100231234 211
247 3300025919 Ga0207657_10071551 Ga0207657_100715513 211
248 3300025921 Ga0207652_10856779 Ga0207652_108567792 211
249 3300025923 Ga0207681_10187593 Ga0207681_101875932 211
250 3300025923 Ga0207681_10459448 Ga0207681_104594482 211
251 3300025924 Ga0207694_10075943 Ga0207694_100759433 211
252 3300025925 Ga0207650_10393815 Ga0207650_103938151 211
253 3300025926 Ga0207659_10293672 Ga0207659_102936722 211
254 3300025927 Ga0207687_10020460 Ga0207687_100204606 211
255 3300025931 Ga0207644_10073448 Ga0207644_100734483 211
256 3300025931 Ga0207644_10285008 Ga0207644_102850082 211
257 3300025933 Ga0207706_10004721 Ga0207706_100047219 211
258 3300025933 Ga0207706_10060822 Ga0207706_100608222 211
259 3300025933 Ga0207706_10061263 Ga0207706_100612633 211
260 3300025934 Ga0207686_10247532 Ga0207686_102475322 211
261 3300025934 Ga0207686_10534999 Ga0207686_105349991 211
262 3300025935 Ga0207709_10011368 Ga0207709_100113682 211
263 3300025935 Ga0207709_10664862 Ga0207709_106648621 211
264 3300025937 Ga0207669_10497768 Ga0207669_104977682 211
265 3300025940 Ga0207691_10045494 Ga0207691_100454943 211
266 3300025940 Ga0207691_10060473 Ga0207691_100604732 211
267 3300025941 Ga0207711_10640946 Ga0207711_106409462 211
268 3300025942 Ga0207689_10034038 Ga0207689_100340382 211
269 3300025942 Ga0207689_10154754 Ga0207689_101547542 211
270 3300025944 Ga0207661_10023423 Ga0207661_100234234 211
271 3300025944 Ga0207661_10029103 Ga0207661_100291035 211
272 3300025944 Ga0207661_10049324 Ga0207661_100493242 211
273 3300025944 Ga0207661_10822703 Ga0207661_108227032 211
274 3300025945 Ga0207679_10247459 Ga0207679_102474592 211
275 3300025945 Ga0207679_10276545 Ga0207679_102765452 211
276 3300025945 Ga0207679_10625353 Ga0207679_106253531 211
277 3300025949 Ga0207667_10040231 Ga0207667_100402315 211
278 3300025960 Ga0207651_10401240 Ga0207651_104012402 211
279 3300025961 Ga0207712_10053891 Ga0207712_100538912 211
280 3300025981 Ga0207640_10068885 Ga0207640_100688852 211
281 3300025981 Ga0207640_10395191 Ga0207640_103951912 211
282 3300025986 Ga0207658_10071913 Ga0207658_100719132 211
283 3300026035 Ga0207703_10382441 Ga0207703_103824411 211
284 3300026041 Ga0207639_10042771 Ga0207639_100427712 211
285 3300026067 Ga0207678_10078022 Ga0207678_100780223 211
286 3300026075 Ga0207708_10029296 Ga0207708_100292962 211
287 3300026075 Ga0207708_10081901 Ga0207708_100819013 211
288 3300026078 Ga0207702_10110418 Ga0207702_101104182 211
289 3300026078 Ga0207702_10540710 Ga0207702_105407102 211
290 3300026089 Ga0207648_10175589 Ga0207648_101755892 211
291 3300026095 Ga0207676_10130276 Ga0207676_101302762 211
292 3300026118 Ga0207675_100007683 Ga0207675_1000076839 211
293 3300026118 Ga0207675_100052001 Ga0207675_1000520012 211
294 3300026121 Ga0207683_10063501 Ga0207683_100635013 211
295 3300026121 Ga0207683_10263121 Ga0207683_102631212 211
296 3300026142 Ga0207698_10615290 Ga0207698_106152902 211
297 3300028379 Ga0268266_10548620 Ga0268266_105486202 211
298 3300028380 Ga0268265_10237570 Ga0268265_102375702 211
299 3300034820 Ga0373959_0006484 Ga0373959_0006484_202_897 211
300 3300035113 Ga0373936_0038087 Ga0373936_0038087_803_1498 211
301 3300035115 Ga0373941_0043517 Ga0373941_0043517_148_843 211
302 3300035170 Ga0373943_0006250 Ga0373943_0006250_4342_5037 211
303 3300035241 Ga0373961_0009301 Ga0373961_0009301_1139_1834 211
304 3300035692 Ga0373935_0003142 Ga0373935_0003142_396_1091 211
305 3300035725 Ga0373947_0005913 Ga0373947_0005913_854_1549 211
306 3300037068 Ga0373925_0002557 Ga0373925_0002557_8449_9144 211
307 3300037312 Ga0395899_0162380 Ga0395899_0162380_628_1314 211
308 3300037466 Ga0395898_0068826 Ga0395898_0068826_2661_3347 211
309 3300038443 Ga0395901_0085143 Ga0395901_0085143_236_922 211
310 3300044694 Ga0466963_0021180 Ga0466963_0021180_511_1206 211
311 3300045976 Ga0466967_0226828 Ga0466967_0226828_141_836 211
312 3300046459 Ga0495629_0096666 Ga0495629_0096666_1258_1953 211
313 3300046461 Ga0495641_0006376 Ga0495641_0006376_5994_6689 211
314 3300046463 Ga0495653_0020261 Ga0495653_0020261_3090_3785 211
315 3300046472 Ga0495580_0006136 Ga0495580_0006136_1261_1956 211
316 3300046473 Ga0495582_0009374 Ga0495582_0009374_968_1663 211
317 3300046475 Ga0495639_0000501 Ga0495639_0000501_8407_9102 211
318 3300046476 Ga0495662_0001886 Ga0495662_0001886_4598_5293 211
319 3300046477 Ga0495664_0002065 Ga0495664_0002065_4834_5529 211
320 3300046477 Ga0495664_0323347 Ga0495664_0323347_181_864 211
321 3300046514 Ga0495618_0034614 Ga0495618_0034614_625_1320 211
322 3300046516 Ga0495628_0194673 Ga0495628_0194673_753_1436 211
323 3300046517 Ga0495630_0002033 Ga0495630_0002033_6359_7054 211
324 3300046529 Ga0495652_0053980 Ga0495652_0053980_1883_2578 211
325 3300046531 Ga0495665_0001055 Ga0495665_0001055_9340_10035 211
326 3300046533 Ga0495640_0013846 Ga0495640_0013846_216_911 211
327 3300046535 Ga0495586_0003415 Ga0495586_0003415_3227_3922 211
328 3300046559 Ga0495667_0135084 Ga0495667_0135084_872_1567 211
329 3300046642 Ga0495634_0008960 Ga0495634_0008960_4866_5561 211
330 3300046663 Ga0495635_0011230 Ga0495635_0011230_118_813 211
331 3300046681 Ga0495647_0000727 Ga0495647_0000727_3595_4290 211
332 3300046683 Ga0495658_0000785 Ga0495658_0000785_5580_6275 211
333 3300047315 Ga0495581_0005357 Ga0495581_0005357_2281_2976 211
334 3300047319 Ga0495674_0039406 Ga0495674_0039406_3423_4118 211
335 3300047321 Ga0495676_0007744 Ga0495676_0007744_3581_4276 211
336 3300047322 Ga0495680_0035134 Ga0495680_0035134_1404_2099 211
337 3300047471 Ga0495684_0072972 Ga0495684_0072972_1838_2533 211
338 3300047673 Ga0495593_0001801 Ga0495593_0001801_6603_7298 211
339 3300048089 Ga0495614_0001124 Ga0495614_0001124_6198_6893 211
340 3300048904 Ga0496101_0308477 Ga0496101_0308477_138_833 211
341 3300048905 Ga0496102_0276811 Ga0496102_0276811_670_1365 211
342 3300048907 Ga0496104_0118833 Ga0496104_0118833_195_893 211
343 3300048909 Ga0496106_0544241 Ga0496106_0544241_112_807 211
344 3300048910 Ga0496107_0394022 Ga0496107_0394022_84_776 211
345 3300048911 Ga0496108_0111143 Ga0496108_0111143_1275_1970 211
346 3300048912 Ga0496109_0540410 Ga0496109_0540410_97_792 211
347 3300048913 Ga0496110_0126452 Ga0496110_0126452_650_1345 211
348 3300048913 Ga0496110_0178148 Ga0496110_0178148_577_1215 211
349 3300048913 Ga0496110_0200048 Ga0496110_0200048_242_937 211
350 3300048913 Ga0496110_0648437 Ga0496110_0648437_73_765 211
351 3300048917 Ga0496114_0101522 Ga0496114_0101522_1325_2020 211
352 3300048917 Ga0496114_0255138 Ga0496114_0255138_647_1339 211
353 3300049568 Ga0501031_0004130 Ga0501031_0004130_3652_4353 211
354 3300049568 Ga0501031_0031234 Ga0501031_0031234_1776_2429 211
355 3300049569 Ga0501032_0025748 Ga0501032_0025748_198_899 211
356 3300049570 Ga0501033_0024673 Ga0501033_0024673_3584_4285 211
357 3300049571 Ga0501034_0180252 Ga0501034_0180252_56_757 211
358 3300049572 Ga0501036_0190515 Ga0501036_0190515_734_1435 211
359 3300049572 Ga0501036_0262728 Ga0501036_0262728_54_701 211
360 3300049574 Ga0501038_0027466 Ga0501038_0027466_271_972 211
361 3300049574 Ga0501038_0057562 Ga0501038_0057562_961_1659 211
362 3300049575 Ga0501039_0012132 Ga0501039_0012132_4640_5338 211
363 3300049575 Ga0501039_0015712 Ga0501039_0015712_3281_3982 211
364 3300049576 Ga0501040_0004395 Ga0501040_0004395_4018_4716 211
365 3300049576 Ga0501040_0015141 Ga0501040_0015141_645_1346 211
366 3300049576 Ga0501040_0605599 Ga0501040_0605599_102_755 211
367 3300049577 Ga0501041_0017314 Ga0501041_0017314_129_827 211
368 3300049578 Ga0501042_0078920 Ga0501042_0078920_1150_1848 211
369 3300049578 Ga0501042_0141559 Ga0501042_0141559_734_1435 211
370 3300049579 Ga0501043_0068441 Ga0501043_0068441_1486_2187 211
371 3300049580 Ga0501046_0103821 Ga0501046_0103821_285_986 211
372 3300049580 Ga0501046_0105497 Ga0501046_0105497_567_1265 211
373 3300049580 Ga0501046_0395322 Ga0501046_0395322_229_882 211
374 3300049582 Ga0501048_0110777 Ga0501048_0110777_1227_1925 211
375 3300049583 Ga0501067_0091179 Ga0501067_0091179_687_1382 211
376 3300049584 Ga0501068_0003825 Ga0501068_0003825_3756_4454 211
377 3300049584 Ga0501068_0022024 Ga0501068_0022024_2763_3464 211
378 3300049586 Ga0501070_0057731 Ga0501070_0057731_147_845 211
379 3300049587 Ga0501071_0000662 Ga0501071_0000662_11328_12026 211
380 3300049587 Ga0501071_0003764 Ga0501071_0003764_3885_4538 211
381 3300049589 Ga0501073_0017993 Ga0501073_0017993_2722_3423 211
382 3300049590 Ga0501074_0025399 Ga0501074_0025399_1193_1894 211
383 3300049591 Ga0501075_0006475 Ga0501075_0006475_4796_5497 211
384 3300049591 Ga0501075_0302866 Ga0501075_0302866_186_884 211
385 3300049592 Ga0501076_0002743 Ga0501076_0002743_118_816 211
386 3300049592 Ga0501076_0022464 Ga0501076_0022464_3286_3987 211
387 3300049593 Ga0501077_0059599 Ga0501077_0059599_1203_1904 211
388 3300049593 Ga0501077_0116353 Ga0501077_0116353_929_1627 211
389 3300049741 Ga0501079_0006655 Ga0501079_0006655_6725_7423 211
390 3300049742 Ga0501080_0003647 Ga0501080_0003647_10477_11175 211
391 3300049742 Ga0501080_0040480 Ga0501080_0040480_3654_4304 211
392 3300049742 Ga0501080_0051488 Ga0501080_0051488_2237_2890 211
393 3300049743 Ga0501081_0013919 Ga0501081_0013919_274_975 211
394 3300049743 Ga0501081_0048542 Ga0501081_0048542_193_891 211
395 3300049743 Ga0501081_0471520 Ga0501081_0471520_239_922 211
396 3300049744 Ga0501083_0016349 Ga0501083_0016349_3489_4187 211
397 3300049744 Ga0501083_0048521 Ga0501083_0048521_318_1019 211
398 3300049822 Ga0501035_0036848 Ga0501035_0036848_3584_4285 211
399 3300049822 Ga0501035_0586551 Ga0501035_0586551_154_852 211
400 3300050491 nmdc:mga00v17_151205_c1 nmdc:mga00v17_151205_c1_62_781 211
401 3300050492 nmdc:mga0yw44_13142_c1 nmdc:mga0yw44_13142_c1_1458_2177 211
402 3300050492 nmdc:mga0yw44_486881_c1 nmdc:mga0yw44_486881_c1_62_781 211
403 3300050511 nmdc:mga08y16_226420_c1 nmdc:mga08y16_226420_c1_538_1176 211
404 3300050511 nmdc:mga08y16_301178_c1 nmdc:mga08y16_301178_c1_826_1545 211
405 3300050515 nmdc:mga0a205_130345_c1 nmdc:mga0a205_130345_c1_1625_2317 211
406 3300053077 Ga0495601_0001759 Ga0495601_0001759_6338_7033 211
407 3300053078 Ga0495612_0001906 Ga0495612_0001906_4938_5633 211
408 3300054114 Ga0501084_0004616 Ga0501084_0004616_67_765 211
409 3300054114 Ga0501084_0153509 Ga0501084_0153509_1193_1894 211
410 3300060353 Ga0501082_0006621 Ga0501082_0006621_1856_2509 211
411 3300061734 Ga0530510_0259018 Ga0530510_0259018_285_983 211
412 3300005328 Ga0070676_10170312 Ga0070676_101703122 212
413 3300005329 Ga0070683_100030721 Ga0070683_1000307214 212
414 3300005329 Ga0070683_100093732 Ga0070683_1000937322 212
415 3300005329 Ga0070683_100673014 Ga0070683_1006730141 212
416 3300005330 Ga0070690_100058141 Ga0070690_1000581412 212
417 3300005330 Ga0070690_100675360 Ga0070690_1006753601 212
418 3300005334 Ga0068869_100134891 Ga0068869_1001348912 212
419 3300005336 Ga0070680_100046414 Ga0070680_1000464143 212
420 3300005337 Ga0070682_100080855 Ga0070682_1000808551 212
421 3300005338 Ga0068868_100021354 Ga0068868_1000213546 212
422 3300005338 Ga0068868_100339510 Ga0068868_1003395101 212
423 3300005339 Ga0070660_100197194 Ga0070660_1001971943 212
424 3300005341 Ga0070691_10063264 Ga0070691_100632641 212
425 3300005343 Ga0070687_100098299 Ga0070687_1000982992 212
426 3300005345 Ga0070692_10022668 Ga0070692_100226682 212
427 3300005347 Ga0070668_100052295 Ga0070668_1000522953 212
428 3300005356 Ga0070674_100032821 Ga0070674_1000328212 212
429 3300005366 Ga0070659_100297361 Ga0070659_1002973612 212
430 3300005434 Ga0070709_10102125 Ga0070709_101021253 212
431 3300005434 Ga0070709_10106861 Ga0070709_101068612 212
432 3300005434 Ga0070709_10384252 Ga0070709_103842521 212
433 3300005435 Ga0070714_100006361 Ga0070714_1000063615 212
434 3300005435 Ga0070714_100027611 Ga0070714_1000276115 212
435 3300005435 Ga0070714_100439123 Ga0070714_1004391232 212
436 3300005436 Ga0070713_100046229 Ga0070713_1000462295 212
437 3300005436 Ga0070713_100163717 Ga0070713_1001637172 212
438 3300005437 Ga0070710_10024620 Ga0070710_100246202 212
439 3300005437 Ga0070710_10055042 Ga0070710_100550422 212
440 3300005438 Ga0070701_10074375 Ga0070701_100743751 212
441 3300005438 Ga0070701_10374607 Ga0070701_103746071 212
442 3300005439 Ga0070711_100031456 Ga0070711_1000314564 212
443 3300005439 Ga0070711_100151483 Ga0070711_1001514833 212
444 3300005440 Ga0070705_100126314 Ga0070705_1001263142 212
445 3300005444 Ga0070694_100129494 Ga0070694_1001294942 212
446 3300005444 Ga0070694_100315843 Ga0070694_1003158432 212
447 3300005445 Ga0070708_100111799 Ga0070708_1001117995 212
448 3300005456 Ga0070678_100047065 Ga0070678_1000470653 212
449 3300005457 Ga0070662_100025843 Ga0070662_1000258434 212
450 3300005457 Ga0070662_100047877 Ga0070662_1000478773 212
451 3300005458 Ga0070681_10010646 Ga0070681_100106465 212
452 3300005458 Ga0070681_10072510 Ga0070681_100725102 212
453 3300005458 Ga0070681_10109385 Ga0070681_101093853 212
454 3300005458 Ga0070681_10111208 Ga0070681_101112083 212
455 3300005458 Ga0070681_10157304 Ga0070681_101573041 212
456 3300005459 Ga0068867_100600759 Ga0068867_1006007591 212
457 3300005467 Ga0070706_100417551 Ga0070706_1004175511 212
458 3300005468 Ga0070707_100045152 Ga0070707_1000451524 212
459 3300005471 Ga0070698_100003809 Ga0070698_10000380912 212
460 3300005471 Ga0070698_100093669 Ga0070698_1000936692 212
461 3300005471 Ga0070698_100165592 Ga0070698_1001655922 212
462 3300005518 Ga0070699_100129624 Ga0070699_1001296242 212
463 3300005530 Ga0070679_100019573 Ga0070679_1000195737 212
464 3300005530 Ga0070679_100079277 Ga0070679_1000792772 212
465 3300005535 Ga0070684_100032413 Ga0070684_1000324133 212
466 3300005535 Ga0070684_100064221 Ga0070684_1000642212 212
467 3300005535 Ga0070684_100108152 Ga0070684_1001081522 212
468 3300005535 Ga0070684_100146967 Ga0070684_1001469673 212
469 3300005536 Ga0070697_100449917 Ga0070697_1004499172 212
470 3300005539 Ga0068853_100238839 Ga0068853_1002388392 212
471 3300005544 Ga0070686_100036145 Ga0070686_1000361453 212
472 3300005544 Ga0070686_100270999 Ga0070686_1002709992 212
473 3300005545 Ga0070695_100037784 Ga0070695_1000377842 212
474 3300005546 Ga0070696_100102904 Ga0070696_1001029043 212
475 3300005546 Ga0070696_100104935 Ga0070696_1001049352 212
476 3300005546 Ga0070696_100281641 Ga0070696_1002816412 212
477 3300005546 Ga0070696_100298038 Ga0070696_1002980382 212
478 3300005547 Ga0070693_100042085 Ga0070693_1000420853 212
479 3300005549 Ga0070704_100054906 Ga0070704_1000549063 212
480 3300005563 Ga0068855_100042188 Ga0068855_1000421883 212
481 3300005563 Ga0068855_100060464 Ga0068855_1000604642 212
482 3300005563 Ga0068855_100180637 Ga0068855_1001806373 212
483 3300005563 Ga0068855_100218143 Ga0068855_1002181432 212
484 3300005564 Ga0070664_100015002 Ga0070664_1000150025 212
485 3300005564 Ga0070664_100186476 Ga0070664_1001864762 212
486 3300005577 Ga0068857_100080037 Ga0068857_1000800373 212
487 3300005577 Ga0068857_100237502 Ga0068857_1002375023 212
488 3300005614 Ga0068856_100013325 Ga0068856_1000133251 212
489 3300005614 Ga0068856_100094581 Ga0068856_1000945813 212
490 3300005614 Ga0068856_100228427 Ga0068856_1002284271 212
491 3300005614 Ga0068856_100265400 Ga0068856_1002654003 212
492 3300005615 Ga0070702_100162239 Ga0070702_1001622392 212
493 3300005616 Ga0068852_100057505 Ga0068852_1000575052 212
494 3300005618 Ga0068864_100151816 Ga0068864_1001518163 212
495 3300005719 Ga0068861_100024868 Ga0068861_1000248685 212
496 3300005841 Ga0068863_100426302 Ga0068863_1004263022 212
497 3300005841 Ga0068863_100431081 Ga0068863_1004310812 212
498 3300005843 Ga0068860_100243658 Ga0068860_1002436583 212
499 3300005937 Ga0081455_10046689 Ga0081455_100466893 212
500 3300005981 Ga0081538_10000076 Ga0081538_1000007669 212
501 3300005981 Ga0081538_10000300 Ga0081538_1000030058 212
502 3300005981 Ga0081538_10026055 Ga0081538_100260554 212
503 3300005981 Ga0081538_10048346 Ga0081538_100483462 212
504 3300005981 Ga0081538_10051989 Ga0081538_100519893 212
505 3300005983 Ga0081540_1003715 Ga0081540_100371513 212
506 3300005983 Ga0081540_1005515 Ga0081540_10055157 212
507 3300005983 Ga0081540_1063637 Ga0081540_10636372 212
508 3300006028 Ga0070717_10011361 Ga0070717_100113616 212
509 3300006028 Ga0070717_10094777 Ga0070717_100947772 212
510 3300006173 Ga0070716_100292805 Ga0070716_1002928052 212
511 3300006175 Ga0070712_100008629 Ga0070712_1000086294 212
512 3300006175 Ga0070712_100083956 Ga0070712_1000839564 212
513 3300006358 Ga0068871_100053405 Ga0068871_1000534054 212
514 3300006844 Ga0075428_100136001 Ga0075428_1001360013 212
515 3300006846 Ga0075430_100082750 Ga0075430_1000827504 212
516 3300006847 Ga0075431_100576961 Ga0075431_1005769612 212
517 3300006847 Ga0075431_100960151 Ga0075431_1009601511 212
518 3300006852 Ga0075433_10140395 Ga0075433_101403951 212
519 3300006852 Ga0075433_10142622 Ga0075433_101426221 212
520 3300006871 Ga0075434_100025155 Ga0075434_1000251554 212
521 3300006871 Ga0075434_100026803 Ga0075434_1000268033 212
522 3300006871 Ga0075434_100186900 Ga0075434_1001869001 212
523 3300006881 Ga0068865_100124461 Ga0068865_1001244612 212
524 3300006914 Ga0075436_100093264 Ga0075436_1000932641 212
525 3300007076 Ga0075435_100080322 Ga0075435_1000803222 212
526 3300009093 Ga0105240_10519878 Ga0105240_105198782 212
527 3300009094 Ga0111539_10056105 Ga0111539_100561053 212
528 3300009094 Ga0111539_10155021 Ga0111539_101550212 212
529 3300009094 Ga0111539_10158252 Ga0111539_101582523 212
530 3300009094 Ga0111539_10250665 Ga0111539_102506652 212
531 3300009098 Ga0105245_10073128 Ga0105245_100731285 212
532 3300009098 Ga0105245_10102412 Ga0105245_101024123 212
533 3300009098 Ga0105245_10108727 Ga0105245_101087274 212
534 3300009098 Ga0105245_10167952 Ga0105245_101679524 212
535 3300009147 Ga0114129_10024803 Ga0114129_100248035 212
536 3300009147 Ga0114129_10141735 Ga0114129_101417354 212
537 3300009147 Ga0114129_10157542 Ga0114129_101575424 212
538 3300009147 Ga0114129_11054611 Ga0114129_110546112 212
539 3300009147 Ga0114129_11254601 Ga0114129_112546011 212
540 3300009148 Ga0105243_10131101 Ga0105243_101311012 212
541 3300009174 Ga0105241_10074465 Ga0105241_100744653 212
542 3300009176 Ga0105242_10066830 Ga0105242_100668302 212
543 3300009176 Ga0105242_10519592 Ga0105242_105195923 212
544 3300009177 Ga0105248_10679717 Ga0105248_106797172 212
545 3300009545 Ga0105237_10772343 Ga0105237_107723432 212
546 3300009551 Ga0105238_10107501 Ga0105238_101075011 212
547 3300009553 Ga0105249_10005728 Ga0105249_100057289 212
548 3300010375 Ga0105239_10011273 Ga0105239_1001127310 212
549 3300010375 Ga0105239_10040782 Ga0105239_100407826 212
550 3300010375 Ga0105239_10142102 Ga0105239_101421021 212
551 3300012500 Ga0157314_1011093 Ga0157314_10110931 212
552 3300013100 Ga0157373_10076066 Ga0157373_100760663 212
553 3300013102 Ga0157371_10407839 Ga0157371_104078392 212
554 3300013104 Ga0157370_10147976 Ga0157370_101479762 212
555 3300013105 Ga0157369_10011625 Ga0157369_100116255 212
556 3300013105 Ga0157369_10057246 Ga0157369_100572462 212
557 3300013105 Ga0157369_10527492 Ga0157369_105274921 212
558 3300013306 Ga0163162_10186609 Ga0163162_101866093 212
559 3300013306 Ga0163162_10267808 Ga0163162_102678082 212
560 3300013307 Ga0157372_10132768 Ga0157372_101327682 212
561 3300013307 Ga0157372_10479918 Ga0157372_104799183 212
562 3300013308 Ga0157375_10033349 Ga0157375_100333492 212
563 3300013308 Ga0157375_10090847 Ga0157375_100908473 212
564 3300014497 Ga0182008_10123316 Ga0182008_101233162 212
565 3300014745 Ga0157377_10008029 Ga0157377_100080292 212
566 3300014969 Ga0157376_10214912 Ga0157376_102149122 212
567 3300017792 Ga0163161_10116736 Ga0163161_101167363 212
568 3300021441 Ga0213871_10010655 Ga0213871_100106552 212
569 3300025898 Ga0207692_10012888 Ga0207692_100128884 212
570 3300025905 Ga0207685_10091519 Ga0207685_100915191 212
571 3300025906 Ga0207699_10083295 Ga0207699_100832953 212
572 3300025906 Ga0207699_10435918 Ga0207699_104359182 212
573 3300025907 Ga0207645_10148234 Ga0207645_101482342 212
574 3300025910 Ga0207684_10115414 Ga0207684_101154142 212
575 3300025912 Ga0207707_10063261 Ga0207707_100632612 212
576 3300025913 Ga0207695_10550267 Ga0207695_105502672 212
577 3300025915 Ga0207693_10000576 Ga0207693_1000057626 212
578 3300025915 Ga0207693_10008025 Ga0207693_100080255 212
579 3300025915 Ga0207693_10053620 Ga0207693_100536202 212
580 3300025915 Ga0207693_10133673 Ga0207693_101336733 212
581 3300025916 Ga0207663_10003164 Ga0207663_100031642 212
582 3300025916 Ga0207663_10099633 Ga0207663_100996332 212
583 3300025917 Ga0207660_10116957 Ga0207660_101169572 212
584 3300025918 Ga0207662_10231916 Ga0207662_102319162 212
585 3300025919 Ga0207657_10004578 Ga0207657_100045784 212
586 3300025919 Ga0207657_10122606 Ga0207657_101226062 212
587 3300025921 Ga0207652_10016442 Ga0207652_100164426 212
588 3300025921 Ga0207652_10138059 Ga0207652_101380592 212
589 3300025921 Ga0207652_10176264 Ga0207652_101762641 212
590 3300025922 Ga0207646_10001540 Ga0207646_100015405 212
591 3300025922 Ga0207646_10012924 Ga0207646_100129245 212
592 3300025922 Ga0207646_10276679 Ga0207646_102766792 212
593 3300025923 Ga0207681_10411870 Ga0207681_104118702 212
594 3300025927 Ga0207687_10010823 Ga0207687_100108234 212
595 3300025927 Ga0207687_10034840 Ga0207687_100348402 212
596 3300025927 Ga0207687_10064593 Ga0207687_100645932 212
597 3300025927 Ga0207687_10105718 Ga0207687_101057182 212
598 3300025927 Ga0207687_10367497 Ga0207687_103674972 212
599 3300025928 Ga0207700_10126602 Ga0207700_101266023 212
600 3300025928 Ga0207700_10127263 Ga0207700_101272633 212
601 3300025928 Ga0207700_10177384 Ga0207700_101773843 212
602 3300025929 Ga0207664_10014478 Ga0207664_100144787 212
603 3300025929 Ga0207664_10030449 Ga0207664_100304495 212
604 3300025932 Ga0207690_10128471 Ga0207690_101284711 212
605 3300025933 Ga0207706_10013517 Ga0207706_100135176 212
606 3300025937 Ga0207669_10011806 Ga0207669_100118063 212
607 3300025937 Ga0207669_10241208 Ga0207669_102412081 212
608 3300025937 Ga0207669_10573348 Ga0207669_105733481 212
609 3300025939 Ga0207665_10009724 Ga0207665_100097243 212
610 3300025939 Ga0207665_10065530 Ga0207665_100655303 212
611 3300025939 Ga0207665_10398255 Ga0207665_103982551 212
612 3300025940 Ga0207691_10751816 Ga0207691_107518161 212
613 3300025941 Ga0207711_10774224 Ga0207711_107742242 212
614 3300025944 Ga0207661_10000830 Ga0207661_1000083018 212
615 3300025944 Ga0207661_10016847 Ga0207661_100168477 212
616 3300025944 Ga0207661_10082592 Ga0207661_100825922 212
617 3300025944 Ga0207661_10578391 Ga0207661_105783911 212
618 3300025945 Ga0207679_10096985 Ga0207679_100969852 212
619 3300025949 Ga0207667_10125515 Ga0207667_101255152 212
620 3300025972 Ga0207668_10101542 Ga0207668_101015423 212
621 3300025981 Ga0207640_10031394 Ga0207640_100313943 212
622 3300026023 Ga0207677_10167403 Ga0207677_101674032 212
623 3300026067 Ga0207678_10064647 Ga0207678_100646473 212
624 3300026067 Ga0207678_10112999 Ga0207678_101129993 212
625 3300026075 Ga0207708_10001284 Ga0207708_100012849 212
626 3300026075 Ga0207708_10098610 Ga0207708_100986103 212
627 3300026078 Ga0207702_10032325 Ga0207702_100323253 212
628 3300026078 Ga0207702_10056494 Ga0207702_100564943 212
629 3300026078 Ga0207702_10417827 Ga0207702_104178272 212
630 3300026088 Ga0207641_10117834 Ga0207641_101178342 212
631 3300026088 Ga0207641_10300625 Ga0207641_103006252 212
632 3300026089 Ga0207648_10008265 Ga0207648_100082658 212
633 3300026095 Ga0207676_10143690 Ga0207676_101436902 212
634 3300026095 Ga0207676_10666462 Ga0207676_106664622 212
635 3300026116 Ga0207674_10055272 Ga0207674_100552723 212
636 3300026116 Ga0207674_10247760 Ga0207674_102477602 212
637 3300026118 Ga0207675_100000792 Ga0207675_10000079226 212
638 3300026121 Ga0207683_10000898 Ga0207683_100008986 212
639 3300026121 Ga0207683_10349106 Ga0207683_103491063 212
640 3300026142 Ga0207698_10343875 Ga0207698_103438752 212
641 3300027907 Ga0207428_10013003 Ga0207428_100130037 212
642 3300027907 Ga0207428_10402711 Ga0207428_104027112 212
643 3300028800 Ga0265338_10004598 Ga0265338_1000459821 212
644 3300028800 Ga0265338_10006450 Ga0265338_1000645016 212
645 3300028800 Ga0265338_10011093 Ga0265338_1001109312 212
646 3300028800 Ga0265338_10029240 Ga0265338_100292402 212
647 3300031249 Ga0265339_10028524 Ga0265339_100285242 212
648 3300031251 Ga0265327_10044202 Ga0265327_100442023 212
649 3300031251 Ga0265327_10201583 Ga0265327_102015832 212
650 3300031711 Ga0265314_10020439 Ga0265314_100204393 212
651 3300031852 Ga0307410_10083699 Ga0307410_100836994 212
652 3300031911 Ga0307412_10243138 Ga0307412_102431382 212
653 3300034816 Ga0373930_0041076 Ga0373930_0041076_221_922 212
654 3300034817 Ga0373948_0017891 Ga0373948_0017891_473_1174 212
655 3300035089 Ga0373944_0028793 Ga0373944_0028793_77_718 212
656 3300035089 Ga0373944_0065560 Ga0373944_0065560_336_1001 212
657 3300035092 Ga0373952_0015088 Ga0373952_0015088_182_883 212
658 3300035112 Ga0373932_0008243 Ga0373932_0008243_1046_1717 212
659 3300035114 Ga0373939_0037580 Ga0373939_0037580_288_989 212
660 3300035116 Ga0373945_0015864 Ga0373945_0015864_341_982 212
661 3300035170 Ga0373943_0011455 Ga0373943_0011455_2079_2720 212
662 3300035170 Ga0373943_0021180 Ga0373943_0021180_555_1220 212
663 3300035171 Ga0373946_0019592 Ga0373946_0019592_479_1120 212
664 3300035171 Ga0373946_0180973 Ga0373946_0180973_157_822 212
665 3300035241 Ga0373961_0051566 Ga0373961_0051566_239_934 212
666 3300035242 Ga0373962_0056646 Ga0373962_0056646_347_1048 212
667 3300035691 Ga0373931_0419401 Ga0373931_0419401_108_809 212
668 3300035692 Ga0373935_0098036 Ga0373935_0098036_1178_1819 212
669 3300035692 Ga0373935_0143669 Ga0373935_0143669_602_1267 212
670 3300035695 Ga0373927_0044249 Ga0373927_0044249_2048_2689 212
671 3300035695 Ga0373927_0139482 Ga0373927_0139482_881_1546 212
672 3300035725 Ga0373947_0035992 Ga0373947_0035992_618_1259 212
673 3300035725 Ga0373947_0071012 Ga0373947_0071012_729_1370 212
674 3300035725 Ga0373947_0134731 Ga0373947_0134731_342_1049 212
675 3300035725 Ga0373947_0498335 Ga0373947_0498335_41_706 212
676 3300036401 Ga0373937_0064158 Ga0373937_0064158_2534_3232 212
677 3300036401 Ga0373937_0104136 Ga0373937_0104136_1621_2313 212
678 3300037068 Ga0373925_0103583 Ga0373925_0103583_49_687 212
679 3300037068 Ga0373925_0176254 Ga0373925_0176254_462_1142 212
680 3300037312 Ga0395899_0004636 Ga0395899_0004636_3587_4225 212
681 3300037312 Ga0395899_0005711 Ga0395899_0005711_4099_4788 212
682 3300037312 Ga0395899_0005949 Ga0395899_0005949_6325_6966 212
683 3300037312 Ga0395899_0062943 Ga0395899_0062943_1638_2321 212
684 3300037418 Ga0395900_0001538 Ga0395900_0001538_4378_5016 212
685 3300037418 Ga0395900_0017645 Ga0395900_0017645_319_969 212
686 3300037418 Ga0395900_0039455 Ga0395900_0039455_1943_2653 212
687 3300037418 Ga0395900_0074450 Ga0395900_0074450_977_1675 212
688 3300037418 Ga0395900_0106737 Ga0395900_0106737_1567_2250 212
689 3300037418 Ga0395900_0155628 Ga0395900_0155628_417_1100 212
690 3300037418 Ga0395900_0726084 Ga0395900_0726084_16_699 212
691 3300037466 Ga0395898_0001713 Ga0395898_0001713_22207_22845 212
692 3300037466 Ga0395898_0006214 Ga0395898_0006214_5846_6529 212
693 3300037466 Ga0395898_0013668 Ga0395898_0013668_4849_5538 212
694 3300037466 Ga0395898_0019994 Ga0395898_0019994_4048_4689 212
695 3300037466 Ga0395898_0022082 Ga0395898_0022082_911_1594 212
696 3300037466 Ga0395898_0123763 Ga0395898_0123763_1200_1910 212
697 3300037466 Ga0395898_0139205 Ga0395898_0139205_478_1137 212
698 3300037466 Ga0395898_0139418 Ga0395898_0139418_469_1167 212
699 3300037466 Ga0395898_0217029 Ga0395898_0217029_511_1152 212
700 3300037466 Ga0395898_0679637 Ga0395898_0679637_206_898 212
701 3300037471 Ga0395905_0003732 Ga0395905_0003732_15209_15847 212
702 3300037471 Ga0395905_0016012 Ga0395905_0016012_4743_5432 212
703 3300037471 Ga0395905_0018371 Ga0395905_0018371_1866_2549 212
704 3300037471 Ga0395905_0135514 Ga0395905_0135514_1582_2292 212
705 3300037471 Ga0395905_0194296 Ga0395905_0194296_378_1019 212
706 3300037471 Ga0395905_0500715 Ga0395905_0500715_249_968 212
707 3300038443 Ga0395901_0009430 Ga0395901_0009430_6802_7512 212
708 3300038443 Ga0395901_0017370 Ga0395901_0017370_5722_6405 212
709 3300038443 Ga0395901_0018641 Ga0395901_0018641_5980_6618 212
710 3300038443 Ga0395901_0020467 Ga0395901_0020467_1414_2097 212
711 3300038443 Ga0395901_0076085 Ga0395901_0076085_503_1144 212
712 3300038443 Ga0395901_0213821 Ga0395901_0213821_400_1119 212
713 3300038443 Ga0395901_0264320 Ga0395901_0264320_547_1245 212
714 3300038443 Ga0395901_0339255 Ga0395901_0339255_83_820 212
715 3300039438 Ga0436360_0031091 Ga0436360_0031091_1021_1689 212
716 3300039438 Ga0436360_1357140 Ga0436360_1357140_289_990 212
717 3300041512 Ga0451853_0568896 Ga0451853_0568896_619_1323 212
718 3300042005 Ga0439448_0024436 Ga0439448_0024436_17_658 212
719 3300042005 Ga0439448_0106799 Ga0439448_0106799_80_721 212
720 3300042530 Ga0450916_003096 Ga0450916_003096_951_1601 212
721 3300044683 Ga0466965_0050569 Ga0466965_0050569_1231_1929 212
722 3300044683 Ga0466965_0063514 Ga0466965_0063514_216_914 212
723 3300044693 Ga0466961_0105175 Ga0466961_0105175_502_1200 212
724 3300044694 Ga0466963_0000078 Ga0466963_0000078_20042_20740 212
725 3300044694 Ga0466963_0011463 Ga0466963_0011463_2295_2993 212
726 3300044694 Ga0466963_0016740 Ga0466963_0016740_2807_3505 212
727 3300044694 Ga0466963_0028613 Ga0466963_0028613_2076_2774 212
728 3300044694 Ga0466963_0041189 Ga0466963_0041189_1153_1851 212
729 3300044694 Ga0466963_0041747 Ga0466963_0041747_1516_2214 212
730 3300044706 Ga0466964_0002212 Ga0466964_0002212_2462_3160 212
731 3300044706 Ga0466964_0006461 Ga0466964_0006461_2989_3723 212
732 3300044706 Ga0466964_0014756 Ga0466964_0014756_1097_1795 212
733 3300044706 Ga0466964_0025021 Ga0466964_0025021_619_1317 212
734 3300044719 Ga0466971_0031655 Ga0466971_0031655_821_1519 212
735 3300044735 Ga0466968_0001161 Ga0466968_0001161_1153_1851 212
736 3300044735 Ga0466968_0019006 Ga0466968_0019006_1104_1802 212
737 3300044735 Ga0466968_0038202 Ga0466968_0038202_1102_1800 212
738 3300044765 Ga0466970_0005539 Ga0466970_0005539_2383_3081 212
739 3300044842 Ga0466957_0017365 Ga0466957_0017365_2358_3056 212
740 3300044842 Ga0466957_0018612 Ga0466957_0018612_923_1621 212
741 3300044842 Ga0466957_0024965 Ga0466957_0024965_800_1498 212
742 3300045049 Ga0466959_0003883 Ga0466959_0003883_2708_3406 212
743 3300045051 Ga0451576_0042487 Ga0451576_0042487_1687_2328 212
744 3300045836 Ga0466958_0005370 Ga0466958_0005370_3541_4239 212
745 3300045836 Ga0466958_0021049 Ga0466958_0021049_1325_2023 212
746 3300045836 Ga0466958_0035475 Ga0466958_0035475_1103_1837 212
747 3300045836 Ga0466958_0047614 Ga0466958_0047614_1807_2505 212
748 3300045976 Ga0466967_0001286 Ga0466967_0001286_3201_3899 212
749 3300045976 Ga0466967_0015711 Ga0466967_0015711_709_1407 212
750 3300045976 Ga0466967_0017616 Ga0466967_0017616_809_1507 212
751 3300045976 Ga0466967_0058874 Ga0466967_0058874_60_794 212
752 3300045976 Ga0466967_0085623 Ga0466967_0085623_929_1627 212
753 3300045976 Ga0466967_0172295 Ga0466967_0172295_1024_1722 212
754 3300045976 Ga0466967_0357259 Ga0466967_0357259_139_837 212
755 3300045976 Ga0466967_0454653 Ga0466967_0454653_41_778 212
756 3300045976 Ga0466967_0494239 Ga0466967_0494239_142_840 212
757 3300045976 Ga0466967_0589405 Ga0466967_0589405_29_727 212
758 3300046452 Ga0495617_082333 Ga0495617_082333_258_956 212
759 3300046454 Ga0495592_0001100 Ga0495592_0001100_444_1148 212
760 3300046454 Ga0495592_0150679 Ga0495592_0150679_678_1367 212
761 3300046455 Ga0495603_0001085 Ga0495603_0001085_3734_4375 212
762 3300046455 Ga0495603_0021259 Ga0495603_0021259_2950_3606 212
763 3300046459 Ga0495629_0031019 Ga0495629_0031019_233_934 212
764 3300046459 Ga0495629_0117051 Ga0495629_0117051_1090_1788 212
765 3300046461 Ga0495641_0007577 Ga0495641_0007577_2371_3012 212
766 3300046461 Ga0495641_0015690 Ga0495641_0015690_2894_3592 212
767 3300046461 Ga0495641_0065788 Ga0495641_0065788_267_932 212
768 3300046461 Ga0495641_0171947 Ga0495641_0171947_51_758 212
769 3300046461 Ga0495641_0251006 Ga0495641_0251006_16_714 212
770 3300046462 Ga0495651_0000008 Ga0495651_0000008_19833_20537 212
771 3300046462 Ga0495651_0367769 Ga0495651_0367769_168_866 212
772 3300046463 Ga0495653_0000897 Ga0495653_0000897_10601_11305 212
773 3300046473 Ga0495582_0024199 Ga0495582_0024199_664_1362 212
774 3300046473 Ga0495582_0057706 Ga0495582_0057706_1068_1775 212
775 3300046473 Ga0495582_0112155 Ga0495582_0112155_548_1189 212
776 3300046473 Ga0495582_0122001 Ga0495582_0122001_546_1211 212
777 3300046474 Ga0495605_0067662 Ga0495605_0067662_232_870 212
778 3300046474 Ga0495605_0080990 Ga0495605_0080990_540_1238 212
779 3300046474 Ga0495605_0088248 Ga0495605_0088248_510_1166 212
780 3300046474 Ga0495605_0098368 Ga0495605_0098368_441_1079 212
781 3300046475 Ga0495639_0221951 Ga0495639_0221951_225_863 212
782 3300046477 Ga0495664_0128889 Ga0495664_0128889_22_720 212
783 3300046477 Ga0495664_0190698 Ga0495664_0190698_339_1037 212
784 3300046491 Ga0495584_0066994 Ga0495584_0066994_347_985 212
785 3300046491 Ga0495584_0214495 Ga0495584_0214495_44_682 212
786 3300046499 Ga0495594_0062163 Ga0495594_0062163_1162_1803 212
787 3300046511 Ga0495608_0002739 Ga0495608_0002739_7629_8333 212
788 3300046511 Ga0495608_0034644 Ga0495608_0034644_2082_2780 212
789 3300046514 Ga0495618_0005615 Ga0495618_0005615_1366_2070 212
790 3300046514 Ga0495618_0131883 Ga0495618_0131883_764_1462 212
791 3300046514 Ga0495618_0178829 Ga0495618_0178829_625_1323 212
792 3300046516 Ga0495628_0000016 Ga0495628_0000016_124681_125385 212
793 3300046516 Ga0495628_0059003 Ga0495628_0059003_2004_2702 212
794 3300046516 Ga0495628_0134071 Ga0495628_0134071_961_1626 212
795 3300046516 Ga0495628_0138982 Ga0495628_0138982_425_1123 212
796 3300046517 Ga0495630_0024442 Ga0495630_0024442_102_800 212
797 3300046517 Ga0495630_0300069 Ga0495630_0300069_75_773 212
798 3300046523 Ga0495644_0008508 Ga0495644_0008508_2885_3583 212
799 3300046525 Ga0495663_0015359 Ga0495663_0015359_1294_1992 212
800 3300046525 Ga0495663_0151074 Ga0495663_0151074_45_701 212
801 3300046528 Ga0495642_0067778 Ga0495642_0067778_195_851 212
802 3300046529 Ga0495652_0000045 Ga0495652_0000045_25659_26363 212
803 3300046529 Ga0495652_0042153 Ga0495652_0042153_1896_2594 212
804 3300046529 Ga0495652_0094719 Ga0495652_0094719_479_1144 212
805 3300046529 Ga0495652_0103526 Ga0495652_0103526_1523_2221 212
806 3300046529 Ga0495652_0117373 Ga0495652_0117373_985_1689 212
807 3300046531 Ga0495665_0041667 Ga0495665_0041667_1600_2307 212
808 3300046531 Ga0495665_0092438 Ga0495665_0092438_380_1018 212
809 3300046535 Ga0495586_0167880 Ga0495586_0167880_69_767 212
810 3300046536 Ga0495587_0000275 Ga0495587_0000275_13692_14396 212
811 3300046538 Ga0495609_0047591 Ga0495609_0047591_755_1411 212
812 3300046543 Ga0495645_0000068 Ga0495645_0000068_26815_27519 212
813 3300046543 Ga0495645_0039361 Ga0495645_0039361_1273_1971 212
814 3300046558 Ga0495633_0167924 Ga0495633_0167924_149_787 212
815 3300046559 Ga0495667_0290741 Ga0495667_0290741_222_914 212
816 3300046615 Ga0495656_0013736 Ga0495656_0013736_1662_2360 212
817 3300046642 Ga0495634_0025336 Ga0495634_0025336_2456_3148 212
818 3300046642 Ga0495634_0084281 Ga0495634_0084281_314_1012 212
819 3300046663 Ga0495635_0072700 Ga0495635_0072700_743_1435 212
820 3300046663 Ga0495635_0321520 Ga0495635_0321520_77_775 212
821 3300046674 Ga0495588_0023673 Ga0495588_0023673_103_744 212
822 3300046675 Ga0495657_0034070 Ga0495657_0034070_2569_3261 212
823 3300046675 Ga0495657_0065711 Ga0495657_0065711_91_789 212
824 3300046675 Ga0495657_0160855 Ga0495657_0160855_622_1326 212
825 3300046678 Ga0495599_0187364 Ga0495599_0187364_533_1231 212
826 3300046679 Ga0495623_0000418 Ga0495623_0000418_7796_8500 212
827 3300046679 Ga0495623_0026350 Ga0495623_0026350_1313_2011 212
828 3300046680 Ga0495646_0042520 Ga0495646_0042520_637_1335 212
829 3300046681 Ga0495647_0030306 Ga0495647_0030306_59_766 212
830 3300046683 Ga0495658_0046801 Ga0495658_0046801_1445_2152 212
831 3300046683 Ga0495658_0183985 Ga0495658_0183985_80_721 212
832 3300046689 Ga0495613_0026907 Ga0495613_0026907_424_1122 212
833 3300046689 Ga0495613_0087313 Ga0495613_0087313_1504_2211 212
834 3300046689 Ga0495613_0111817 Ga0495613_0111817_1158_1859 212
835 3300046689 Ga0495613_0116148 Ga0495613_0116148_597_1289 212
836 3300046690 Ga0495624_0008642 Ga0495624_0008642_2647_3345 212
837 3300046690 Ga0495624_0027399 Ga0495624_0027399_1870_2568 212
838 3300046690 Ga0495624_0364988 Ga0495624_0364988_122_823 212
839 3300046809 Ga0495600_0076415 Ga0495600_0076415_572_1270 212
840 3300046810 Ga0495660_0048675 Ga0495660_0048675_820_1476 212
841 3300047315 Ga0495581_0042870 Ga0495581_0042870_264_971 212
842 3300047317 Ga0495604_0000111 Ga0495604_0000111_61935_62639 212
843 3300047317 Ga0495604_0195457 Ga0495604_0195457_71_769 212
844 3300047318 Ga0495636_0193453 Ga0495636_0193453_183_881 212
845 3300047319 Ga0495674_0039026 Ga0495674_0039026_2993_3691 212
846 3300047319 Ga0495674_0077523 Ga0495674_0077523_1791_2492 212
847 3300047321 Ga0495676_0023091 Ga0495676_0023091_4538_5245 212
848 3300047321 Ga0495676_0041233 Ga0495676_0041233_1034_1675 212
849 3300047322 Ga0495680_0019156 Ga0495680_0019156_1621_2313 212
850 3300047322 Ga0495680_0035061 Ga0495680_0035061_2134_2835 212
851 3300047322 Ga0495680_0101234 Ga0495680_0101234_1079_1777 212
852 3300047444 Ga0495675_0000269 Ga0495675_0000269_16065_16769 212
853 3300047447 Ga0495685_051438 Ga0495685_051438_278_976 212
854 3300047447 Ga0495685_156318 Ga0495685_156318_59_715 212
855 3300047471 Ga0495684_0007069 Ga0495684_0007069_1469_2161 212
856 3300047471 Ga0495684_0019190 Ga0495684_0019190_1367_2065 212
857 3300047471 Ga0495684_0028360 Ga0495684_0028360_1038_1739 212
858 3300048088 Ga0495602_0006456 Ga0495602_0006456_5195_5899 212
859 3300048088 Ga0495602_0058330 Ga0495602_0058330_1647_2345 212
860 3300048088 Ga0495602_0276630 Ga0495602_0276630_485_1189 212
861 3300048089 Ga0495614_0086288 Ga0495614_0086288_645_1343 212
862 3300048903 Ga0496100_0081197 Ga0496100_0081197_172_870 212
863 3300048903 Ga0496100_0155982 Ga0496100_0155982_187_906 212
864 3300048904 Ga0496101_0054399 Ga0496101_0054399_1594_2232 212
865 3300048904 Ga0496101_0063607 Ga0496101_0063607_468_1106 212
866 3300048904 Ga0496101_0291893 Ga0496101_0291893_62_760 212
867 3300048905 Ga0496102_0042738 Ga0496102_0042738_1964_2665 212
868 3300048905 Ga0496102_0113738 Ga0496102_0113738_960_1598 212
869 3300048906 Ga0496103_0025317 Ga0496103_0025317_1434_2135 212
870 3300048907 Ga0496104_0006439 Ga0496104_0006439_9207_9845 212
871 3300048907 Ga0496104_0028580 Ga0496104_0028580_255_893 212
872 3300048907 Ga0496104_0036322 Ga0496104_0036322_155_853 212
873 3300048907 Ga0496104_0388266 Ga0496104_0388266_522_1220 212
874 3300048908 Ga0496105_0001401 Ga0496105_0001401_6085_6723 212
875 3300048908 Ga0496105_0011337 Ga0496105_0011337_884_1582 212
876 3300048908 Ga0496105_0043302 Ga0496105_0043302_1843_2541 212
877 3300048908 Ga0496105_0048667 Ga0496105_0048667_1538_2176 212
878 3300048909 Ga0496106_0019249 Ga0496106_0019249_1012_1710 212
879 3300048909 Ga0496106_0148408 Ga0496106_0148408_266_967 212
880 3300048910 Ga0496107_0105074 Ga0496107_0105074_596_1234 212
881 3300048910 Ga0496107_0121564 Ga0496107_0121564_673_1371 212
882 3300048910 Ga0496107_0414886 Ga0496107_0414886_251_964 212
883 3300048910 Ga0496107_0438241 Ga0496107_0438241_73_771 212
884 3300048910 Ga0496107_0527720 Ga0496107_0527720_62_760 212
885 3300048911 Ga0496108_0015080 Ga0496108_0015080_5596_6294 212
886 3300048911 Ga0496108_0062022 Ga0496108_0062022_756_1475 212
887 3300048911 Ga0496108_0098698 Ga0496108_0098698_1742_2380 212
888 3300048911 Ga0496108_0380606 Ga0496108_0380606_93_800 212
889 3300048911 Ga0496108_0750480 Ga0496108_0750480_124_822 212
890 3300048912 Ga0496109_0007539 Ga0496109_0007539_2569_3276 212
891 3300048912 Ga0496109_0024995 Ga0496109_0024995_2035_2754 212
892 3300048912 Ga0496109_0025340 Ga0496109_0025340_1381_2079 212
893 3300048912 Ga0496109_0034439 Ga0496109_0034439_2658_3356 212
894 3300048912 Ga0496109_0037616 Ga0496109_0037616_2981_3679 212
895 3300048912 Ga0496109_0056106 Ga0496109_0056106_663_1301 212
896 3300048913 Ga0496110_0001330 Ga0496110_0001330_13573_14211 212
897 3300048913 Ga0496110_0004457 Ga0496110_0004457_2675_3313 212
898 3300048913 Ga0496110_0014989 Ga0496110_0014989_1893_2612 212
899 3300048913 Ga0496110_0339570 Ga0496110_0339570_608_1306 212
900 3300048914 Ga0496111_0000032 Ga0496111_0000032_13844_14482 212
901 3300048914 Ga0496111_0068765 Ga0496111_0068765_1042_1680 212
902 3300048914 Ga0496111_0175602 Ga0496111_0175602_820_1518 212
903 3300048915 Ga0496112_0062538 Ga0496112_0062538_2048_2746 212
904 3300048915 Ga0496112_0080458 Ga0496112_0080458_2406_3113 212
905 3300048915 Ga0496112_0127978 Ga0496112_0127978_403_1041 212
906 3300048915 Ga0496112_0266672 Ga0496112_0266672_310_1011 212
907 3300048916 Ga0496113_0002660 Ga0496113_0002660_7329_7967 212
908 3300048916 Ga0496113_0066603 Ga0496113_0066603_1177_1875 212
909 3300048916 Ga0496113_0135654 Ga0496113_0135654_138_839 212
910 3300048916 Ga0496113_0572661 Ga0496113_0572661_126_824 212
911 3300048917 Ga0496114_0020590 Ga0496114_0020590_2233_2934 212
912 3300048917 Ga0496114_0030412 Ga0496114_0030412_3402_4040 212
913 3300048917 Ga0496114_0145592 Ga0496114_0145592_124_822 212
914 3300048917 Ga0496114_0223164 Ga0496114_0223164_53_754 212
915 3300048918 Ga0496115_0033089 Ga0496115_0033089_1225_1926 212
916 3300048918 Ga0496115_0046857 Ga0496115_0046857_1242_1943 212
917 3300048918 Ga0496115_0067297 Ga0496115_0067297_450_1088 212
918 3300048918 Ga0496115_0136910 Ga0496115_0136910_1120_1779 212
919 3300049568 Ga0501031_0145221 Ga0501031_0145221_181_825 212
920 3300049568 Ga0501031_0190213 Ga0501031_0190213_525_1169 212
921 3300049572 Ga0501036_0008004 Ga0501036_0008004_7773_8417 212
922 3300049572 Ga0501036_0016593 Ga0501036_0016593_1353_1997 212
923 3300049573 Ga0501037_0198657 Ga0501037_0198657_515_1156 212
924 3300049574 Ga0501038_0022966 Ga0501038_0022966_3515_4159 212
925 3300049574 Ga0501038_0215717 Ga0501038_0215717_568_1212 212
926 3300049575 Ga0501039_0143576 Ga0501039_0143576_506_1150 212
927 3300049575 Ga0501039_0192535 Ga0501039_0192535_340_984 212
928 3300049576 Ga0501040_0010534 Ga0501040_0010534_4448_5092 212
929 3300049576 Ga0501040_0013989 Ga0501040_0013989_606_1250 212
930 3300049577 Ga0501041_0009218 Ga0501041_0009218_983_1627 212
931 3300049577 Ga0501041_0087337 Ga0501041_0087337_724_1368 212
932 3300049578 Ga0501042_0027464 Ga0501042_0027464_2578_3222 212
933 3300049578 Ga0501042_0120088 Ga0501042_0120088_509_1153 212
934 3300049580 Ga0501046_0095509 Ga0501046_0095509_966_1610 212
935 3300049580 Ga0501046_0179797 Ga0501046_0179797_484_1128 212
936 3300049582 Ga0501048_0117411 Ga0501048_0117411_729_1373 212
937 3300049583 Ga0501067_0004259 Ga0501067_0004259_6705_7343 212
938 3300049584 Ga0501068_0234268 Ga0501068_0234268_389_1033 212
939 3300049585 Ga0501069_0006559 Ga0501069_0006559_2147_2785 212
940 3300049586 Ga0501070_0112778 Ga0501070_0112778_1203_1841 212
941 3300049586 Ga0501070_0553486 Ga0501070_0553486_233_877 212
942 3300049587 Ga0501071_0017605 Ga0501071_0017605_3744_4388 212
943 3300049587 Ga0501071_0124740 Ga0501071_0124740_318_962 212
944 3300049588 Ga0501072_0009405 Ga0501072_0009405_6169_6813 212
945 3300049588 Ga0501072_0014926 Ga0501072_0014926_621_1265 212
946 3300049589 Ga0501073_0121910 Ga0501073_0121910_783_1427 212
947 3300049590 Ga0501074_0202049 Ga0501074_0202049_558_1202 212
948 3300049591 Ga0501075_0021498 Ga0501075_0021498_2792_3436 212
949 3300049591 Ga0501075_0141940 Ga0501075_0141940_579_1223 212
950 3300049592 Ga0501076_0008503 Ga0501076_0008503_3955_4599 212
951 3300049592 Ga0501076_0131669 Ga0501076_0131669_780_1424 212
952 3300049593 Ga0501077_0011297 Ga0501077_0011297_4261_4905 212
953 3300049741 Ga0501079_0001035 Ga0501079_0001035_11192_11836 212
954 3300049741 Ga0501079_0019804 Ga0501079_0019804_494_1138 212
955 3300049742 Ga0501080_0029574 Ga0501080_0029574_657_1301 212
956 3300049743 Ga0501081_0063891 Ga0501081_0063891_676_1320 212
957 3300049743 Ga0501081_0125495 Ga0501081_0125495_797_1441 212
958 3300049743 Ga0501081_0130527 Ga0501081_0130527_170_862 212
959 3300049744 Ga0501083_0104507 Ga0501083_0104507_533_1177 212
960 3300049823 Ga0501044_0659558 Ga0501044_0659558_140_784 212
961 3300049824 Ga0501045_0045550 Ga0501045_0045550_1572_2216 212
962 3300049824 Ga0501045_0100698 Ga0501045_0100698_771_1415 212
963 3300049824 Ga0501045_0375467 Ga0501045_0375467_328_1035 212
964 3300050507 nmdc:mga05p37_33357_c1 nmdc:mga05p37_33357_c1_3564_4244 212
965 3300050507 nmdc:mga05p37_468043_c1 nmdc:mga05p37_468043_c1_511_1149 212
966 3300050509 nmdc:mga0qj67_81380_c1 nmdc:mga0qj67_81380_c1_652_1347 212
967 3300050510 nmdc:mga06r32_623040_c1 nmdc:mga06r32_623040_c1_284_1003 212
968 3300050510 nmdc:mga06r32_664645_c1 nmdc:mga06r32_664645_c1_332_970 212
969 3300050511 nmdc:mga08y16_220279_c1 nmdc:mga08y16_220279_c1_1230_1910 212
970 3300050511 nmdc:mga08y16_71033_c1 nmdc:mga08y16_71033_c1_2280_2921 212
971 3300050512 nmdc:mga0n895_1025339_c1 nmdc:mga0n895_1025339_c1_120_758 212
972 3300050512 nmdc:mga0n895_180440_c1 nmdc:mga0n895_180440_c1_1317_1988 212
973 3300050512 nmdc:mga0n895_18289_c1 nmdc:mga0n895_18289_c1_3911_4552 212
974 3300050512 nmdc:mga0n895_25870_c1 nmdc:mga0n895_25870_c1_2793_3491 212
975 3300050513 nmdc:mga0rr50_13713_c1 nmdc:mga0rr50_13713_c1_4383_5084 212
976 3300050513 nmdc:mga0rr50_37076_c1 nmdc:mga0rr50_37076_c1_2537_3226 212
977 3300050513 nmdc:mga0rr50_3765_c2 nmdc:mga0rr50_3765_c2_1511_2152 212
978 3300050513 nmdc:mga0rr50_41479_c1 nmdc:mga0rr50_41479_c1_2203_2904 212
979 3300050513 nmdc:mga0rr50_635422_c1 nmdc:mga0rr50_635422_c1_156_827 212
980 3300050514 nmdc:mga08x19_661623_c1 nmdc:mga08x19_661623_c1_38_709 212
981 3300050514 nmdc:mga08x19_9687_c1 nmdc:mga08x19_9687_c1_3080_3751 212
982 3300050515 nmdc:mga0a205_35285_c1 nmdc:mga0a205_35285_c1_2104_2745 212
983 3300050515 nmdc:mga0a205_615979_c1 nmdc:mga0a205_615979_c1_81_719 212
984 3300050515 nmdc:mga0a205_85268_c1 nmdc:mga0a205_85268_c1_103_774 212
985 3300053077 Ga0495601_0000390 Ga0495601_0000390_1663_2367 212
986 3300053077 Ga0495601_0030181 Ga0495601_0030181_2390_3088 212
987 3300053077 Ga0495601_0162919 Ga0495601_0162919_721_1419 212
988 3300053077 Ga0495601_0247728 Ga0495601_0247728_451_1149 212
989 3300053078 Ga0495612_0016196 Ga0495612_0016196_89_787 212
990 3300053084 Ga0495595_0011388 Ga0495595_0011388_2277_2969 212
991 3300053084 Ga0495595_0024017 Ga0495595_0024017_1054_1752 212
992 3300053084 Ga0495595_0028065 Ga0495595_0028065_1211_1912 212
993 3300053084 Ga0495595_0127114 Ga0495595_0127114_278_976 212
994 3300053084 Ga0495595_0335714 Ga0495595_0335714_41_739 212
995 3300053085 Ga0495619_0004098 Ga0495619_0004098_1007_1711 212
996 3300053085 Ga0495619_0038421 Ga0495619_0038421_747_1448 212
997 3300053085 Ga0495619_0111793 Ga0495619_0111793_137_835 212
998 3300054114 Ga0501084_0027772 Ga0501084_0027772_137_781 212
999 3300054114 Ga0501084_0095950 Ga0501084_0095950_203_847 212
1000 3300054114 Ga0501084_0736170 Ga0501084_0736170_87_794 212
1001 3300060353 Ga0501082_0016686 Ga0501082_0016686_4147_4791 212
1002 3300060353 Ga0501082_0086289 Ga0501082_0086289_458_1102 212
1003 3300061734 Ga0530510_0017996 Ga0530510_0017996_595_1239 212
1004 3300061734 Ga0530510_0118013 Ga0530510_0118013_599_1243 212
1005 3300061734 Ga0530510_0578857 Ga0530510_0578857_155_811 212
1006 iso_pu_bacteria 2870782633 2870789797 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21906

NrtR_WHD

NrtR DNA-binding winged helix domain

145

207

0.95

PF19368

AraR_C

AraR C-terminal winged HTH domain

141

221

0.88

PF00293

NUDIX

NUDIX domain

7

131

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gz8-assembly2.cif.gz_D cocrystal structure of nudix domain of shewanella oneidensis nrtr complexed with adp ribose 0.8806 2 122
5bs6-assembly2.cif.gz_D apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi 0.8557 2 194
5bs6-assembly1.cif.gz_B apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi 0.8546 2 194
3gz6-assembly1.cif.gz_B crystal structure of shewanella oneidensis nrtr complexed with a 27mer dna 0.8125 2 212
5deq-assembly1.cif.gz_A crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose 0.8026 2 194
ID Description Score Start End Superfamily
af_O06597_8_150_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9778 2 128 3.90.79.10
af_O06597_151_228_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9206 130 206 1.10.10.10
af_O06597_151_228_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8986 130 206 1.10.10.10
3gz8B01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8799 2 122 3.90.79.10
af_O06597_8_150_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.864 2 128 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A538HUN0-F1-model_v4 NUDIX hydrolase 0.985 2 180 GO:0016787
AF-V7L1B1-F1-model_v4 deleted 0.9801 8 154
AF-A0A7V8XN31-F1-model_v4 NUDIX hydrolase 0.9791 2 174 GO:0016787
AF-A0A4V3HYK6-F1-model_v4 Bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase 0.9704 8 212 GO:0016779
AF-A0A0B8NF13-F1-model_v4 Nudix hydrolase 0.97 8 212 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map