F487907

General Info

Members Datasets Scaffolds Average Seq Length
1002 450 781 310

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10002759|Ga0182007_100027594
Length 341
Sequence MQESQVAFRRAGSVKTHYGGTVKALQGVEGQVVWADEPSPACDVGQVRIRVAAAGLNRADLLQKAGLYPPPPGASQVLGLECSGVISEVGPGSSWQVGDRVCALLAGGGMAEEVVVDGRHVLPVPEGLSLAEAAALPEVYGTAWLNLFQLAALKPGEKVLLHAGASGVGSAAIQLCKAFGNPCWVSVGSTDRLSYCEALGAQGGVVRTDGLESLNDLGPFDVILDPVGANYAQLNVKLLSVDGRWVLIGLMGGRSTELDLAQVLGKRIQLLGSTLRSRDEQFKANLISELGQQVWPLFADKRLSPQLAKTFAIKDAEAAFAELATNKVSGKVVLVIDELLS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231010 Pseudomonas sp. GM25 Isolate Nodule
11 2511231011 Pseudomonas sp. GM30 Isolate Nodule
12 2511231012 Pseudomonas sp. GM33 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231023 Pseudomonas sp. GM80 Isolate Nodule
22 2511231031 Pseudomonas sp. GM16 Isolate Nodule
23 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
24 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
25 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
26 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
27 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
28 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
29 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
30 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
31 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
32 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
33 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
34 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
35 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
36 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
37 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
38 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
39 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
40 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
41 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
42 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
43 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
44 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
45 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
46 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
47 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
48 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
49 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
50 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
51 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
52 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
53 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
54 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
55 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
56 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
57 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
58 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
59 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
60 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
61 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
62 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
63 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
64 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
65 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
66 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
67 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
68 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
69 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
70 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
71 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
72 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
73 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
74 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
75 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
76 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
77 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
78 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
79 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
80 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
81 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
82 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
83 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
84 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
85 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
86 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
87 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
88 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
89 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
90 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
91 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
92 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
93 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
94 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
95 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
96 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
97 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
98 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
99 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
100 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
101 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
102 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
103 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
104 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
105 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
106 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
107 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
108 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
109 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
110 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
111 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
112 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
113 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
114 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
115 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
116 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
117 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
118 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
119 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
120 2773857670 Pseudomonas sp. 478 Isolate Unclassified
121 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
122 2773857673 Pseudomonas sp. 443 Isolate Unclassified
123 2784132072 Pseudomonas sp. 460 Isolate Unclassified
124 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
125 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
126 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
127 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
128 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
129 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
130 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
131 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
132 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
133 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
134 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
135 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
136 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
137 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
138 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
139 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
140 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
141 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
142 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
143 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
144 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
145 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
146 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
147 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
148 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
149 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
150 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
151 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
152 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
153 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
154 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
155 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
156 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
157 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
158 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
159 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
160 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
161 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
162 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
163 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
164 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
165 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
166 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
167 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
168 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
169 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
170 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
171 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
172 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
173 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
174 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
175 2928963466 Dyella japonica 1073 Isolate Unclassified
176 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
177 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
178 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
179 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
180 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
181 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
182 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
183 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
184 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
185 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
186 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
187 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
188 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
189 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
190 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
191 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
192 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
193 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
194 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
195 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
196 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
197 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
198 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
199 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
200 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
201 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
202 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
203 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
204 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
205 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
206 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
207 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
208 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
209 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
210 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
211 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
212 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
213 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
214 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
215 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
216 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
217 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
218 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
219 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
220 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
221 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
222 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
223 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
224 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
225 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
226 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
227 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
228 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
229 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
230 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
231 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
232 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
233 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
234 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
235 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
236 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
237 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
238 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
239 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
240 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
241 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
242 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
243 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
244 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
245 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
246 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
247 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
248 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
249 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
250 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
251 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
252 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
253 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
254 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
255 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
256 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
257 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
258 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
259 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
264 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
265 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
267 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
268 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
270 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
271 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
273 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
293 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
295 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
296 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
297 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
298 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
299 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
300 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
301 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
302 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
303 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
304 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
305 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
306 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
307 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
308 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
309 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
310 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
311 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
312 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
313 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
314 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
315 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
316 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
317 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
318 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
319 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
320 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
321 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
322 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
323 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
324 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
325 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
326 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
327 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
328 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
329 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
330 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
331 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
332 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
333 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
334 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
335 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
336 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
337 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
338 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
339 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
340 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
341 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
342 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
343 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
344 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
345 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
346 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
347 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
348 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
349 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
350 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
351 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
352 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
353 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
354 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
355 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
356 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
357 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
358 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
359 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
360 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
361 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
362 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
363 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
364 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
365 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
366 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
369 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
370 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
371 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
374 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
375 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
378 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
379 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
380 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
381 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
382 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
387 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
388 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
391 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
392 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
393 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
394 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
395 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
396 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
397 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
398 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
399 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
400 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
401 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
402 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
405 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
406 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
407 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
408 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
409 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
410 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
411 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
412 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
413 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
414 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
415 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
416 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
417 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
418 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
419 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
420 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
423 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
424 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
425 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
426 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
427 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
428 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
429 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
430 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
431 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
432 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
433 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
434 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
435 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
436 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
437 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
438 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
439 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
440 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
441 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
442 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
443 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
444 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
445 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
446 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
447 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
448 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
449 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
450 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.94
Metatranscriptomes 0
Isolates 22.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 7.39
Nodule 2.2
Rhizoplane 7.19
Rhizosphere 70.66
Stem 0
Stem Tuber 0
Unclassified 12.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_9054 2124908027 Bacteria 2380
2 SwRhRL2b_contig_249379 2162886007 Bacteria 2007
3 SwRhRL2b_contig_3818765 2162886007 Bacteria 2929
4 JGI24735J21928_10001792 3300002067 Bacteria 7537
5 JGI25162J39368_1000018 3300002737 Bacteria 277875
6 JGI25157J39369_1000011 3300002741 Bacteria 206831
7 JGI25163J39215_1000612 3300002771 Bacteria 9846
8 JGI25163J39215_1001671 3300002771 Bacteria 3224
9 JGI25163J39215_1001757 3300002771 Bacteria 3006
10 JGI25164J39214_1000007 3300002772 Bacteria 312507
11 JGI25164J39214_1000194 3300002772 Bacteria 52332
12 JGI25164J39214_1000513 3300002772 Bacteria 18583
13 JGI25165J46597_1000029 3300003214 Bacteria 312507
14 JGI25165J46597_1000348 3300003214 Bacteria 52332
15 JGI25165J46597_1000430 3300003214 Bacteria 42934
16 Ga0055535_1000025 3300003761 Bacteria 213549
17 Ga0055535_1000103 3300003761 Bacteria 91199
18 Ga0055542_1000010 3300003762 Bacteria 414813
19 Ga0055542_1000024 3300003762 Bacteria 277875
20 Ga0055529_1000029 3300003763 Bacteria 277978
21 Ga0055536_1000111 3300003781 Bacteria 71634
22 Ga0055530_10000146 3300003791 Bacteria 63397
23 Ga0055530_10001124 3300003791 Bacteria 20902
24 Ga0055540_1000822 3300003792 Bacteria 20902
25 Ga0055540_1001173 3300003792 Bacteria 16221
26 Ga0055540_1001379 3300003792 Bacteria 14505
27 Ga0055531_10005378 3300003794 Bacteria 7503
28 Ga0065714_10003020 3300005288 Bacteria 10111
29 Ga0065714_10008503 3300005288 Bacteria 3283
30 Ga0065714_10010964 3300005288 Bacteria 2862
31 Ga0065704_10000811 3300005289 Bacteria 15100
32 Ga0065704_10128936 3300005289 Bacteria 1626
33 Ga0065712_10001766 3300005290 Bacteria 11896
34 Ga0065712_10067928 3300005290 Bacteria 20363
35 Ga0065712_10095511 3300005290 Bacteria 2216
36 Ga0070670_100001032 3300005331 Bacteria 22056
37 Ga0070670_100039965 3300005331 Bacteria 4034
38 Ga0070661_100000410 3300005344 Bacteria 33146
39 Ga0070709_10380710 3300005434 Bacteria 1049
40 Ga0070662_100000575 3300005457 Bacteria 22374
41 Ga0070662_100231300 3300005457 Bacteria 1479
42 Ga0070699_100484596 3300005518 Bacteria 1123
43 Ga0068853_100017790 3300005539 Bacteria 5869
44 Ga0070664_100000377 3300005564 Bacteria 33163
45 Ga0070664_100508048 3300005564 Bacteria 1111
46 Ga0068854_100020669 3300005578 Bacteria 4459
47 Ga0068851_10000251 3300005834 Bacteria 25318
48 Ga0081455_10008620 3300005937 Bacteria 10577
49 Ga0075364_10111970 3300006051 Bacteria 1822
50 Ga0075432_10001356 3300006058 Bacteria 7950
51 Ga0075432_10004567 3300006058 Bacteria 4712
52 Ga0075432_10033448 3300006058 Bacteria 1783
53 Ga0075432_10071867 3300006058 Bacteria 1244
54 Ga0075362_10031647 3300006177 Bacteria 2291
55 Ga0075362_10052897 3300006177 Bacteria 1821
56 Ga0075362_10092813 3300006177 Bacteria 1403
57 Ga0075369_10005588 3300006186 Bacteria 4707
58 Ga0079104_1000364 3300006946 Bacteria 54402
59 Ga0105251_10000275 3300009011 Bacteria 51691
60 Ga0105251_10000284 3300009011 Bacteria 50987
61 Ga0105251_10003067 3300009011 Bacteria 12418
62 Ga0105251_10003252 3300009011 Bacteria 11939
63 Ga0105251_10004649 3300009011 Bacteria 9252
64 Ga0105251_10005474 3300009011 Bacteria 8282
65 Ga0105251_10007774 3300009011 Bacteria 6534
66 Ga0105251_10017472 3300009011 Bacteria 3843
67 Ga0105251_10019528 3300009011 Bacteria 3577
68 Ga0105251_10021821 3300009011 Bacteria 3336
69 Ga0105251_10028781 3300009011 Bacteria 2804
70 Ga0105251_10050514 3300009011 Bacteria 1986
71 Ga0105251_10068203 3300009011 Bacteria 1660
72 Ga0105251_10122040 3300009011 Bacteria 1183
73 Ga0105244_10000248 3300009036 Bacteria 55384
74 Ga0105244_10001261 3300009036 Bacteria 20750
75 Ga0105244_10009784 3300009036 Bacteria 5857
76 Ga0105244_10012090 3300009036 Bacteria 5127
77 Ga0105244_10020378 3300009036 Bacteria 3686
78 Ga0105244_10026295 3300009036 Bacteria 3151
79 Ga0105244_10043759 3300009036 Bacteria 2308
80 Ga0105244_10079305 3300009036 Bacteria 1627
81 Ga0105250_10000232 3300009092 Bacteria 46504
82 Ga0105250_10001490 3300009092 Bacteria 12642
83 Ga0105250_10001860 3300009092 Bacteria 10989
84 Ga0105250_10016458 3300009092 Bacteria 3012
85 Ga0105250_10023495 3300009092 Bacteria 2484
86 Ga0105250_10050018 3300009092 Bacteria 1677
87 Ga0105243_10001441 3300009148 Bacteria 20939
88 Ga0105243_10002007 3300009148 Bacteria 17310
89 Ga0105243_10053799 3300009148 Bacteria 3194
90 Ga0105243_10200929 3300009148 Bacteria 1748
91 Ga0105242_10002563 3300009176 Bacteria 14245
92 Ga0105237_10002926 3300009545 Bacteria 20681
93 Ga0105249_10098399 3300009553 Bacteria 2747
94 Ga0099796_10102136 3300010159 Bacteria 1080
95 Ga0105246_10001555 3300011119 Bacteria 13637
96 Ga0105246_10015749 3300011119 Bacteria 4780
97 Ga0105246_10023510 3300011119 Bacteria 3989
98 Ga0105246_10055583 3300011119 Bacteria 2732
99 Ga0157345_1000292 3300012498 Bacteria 6601
100 Ga0157373_10002707 3300013100 Bacteria 13428
101 Ga0157373_10013017 3300013100 Bacteria 6105
102 Ga0157373_10014185 3300013100 Bacteria 5844
103 Ga0157373_10111685 3300013100 Bacteria 1921
104 Ga0157373_10140465 3300013100 Bacteria 1698
105 Ga0157371_10003281 3300013102 Bacteria 14813
106 Ga0157371_10004368 3300013102 Bacteria 12370
107 Ga0157371_10014445 3300013102 Bacteria 5958
108 Ga0157371_10137678 3300013102 Bacteria 1739
109 Ga0157370_10000162 3300013104 Bacteria 81640
110 Ga0157370_10031069 3300013104 Bacteria 5228
111 Ga0157370_10043496 3300013104 Bacteria 4322
112 Ga0157370_10085672 3300013104 Bacteria 2960
113 Ga0157370_10109001 3300013104 Bacteria 2589
114 Ga0157370_10183943 3300013104 Bacteria 1941
115 Ga0157370_10192611 3300013104 Bacteria 1892
116 Ga0157369_10024884 3300013105 Bacteria 6652
117 Ga0157369_10030369 3300013105 Bacteria 5960
118 Ga0157369_10032322 3300013105 Bacteria 5756
119 Ga0157369_10086755 3300013105 Bacteria 3342
120 Ga0163162_10009884 3300013306 Bacteria 9280
121 Ga0163162_10286440 3300013306 Bacteria 1779
122 Ga0157372_10086657 3300013307 Bacteria 3553
123 Ga0157375_10097473 3300013308 Bacteria 3015
124 Ga0157375_10766014 3300013308 Bacteria 1116
125 Ga0182008_10005686 3300014497 Bacteria 7062
126 Ga0182008_10011957 3300014497 Bacteria 4600
127 Ga0182008_10021333 3300014497 Bacteria 3326
128 Ga0182008_10021424 3300014497 Bacteria 3318
129 Ga0182008_10041281 3300014497 Bacteria 2301
130 Ga0182006_1001230 3300015261 Bacteria 15900
131 Ga0182006_1002590 3300015261 Bacteria 9781
132 Ga0182006_1008846 3300015261 Bacteria 4547
133 Ga0182006_1021402 3300015261 Bacteria 2697
134 Ga0182006_1023158 3300015261 Bacteria 2573
135 Ga0182006_1026917 3300015261 Bacteria 2351
136 Ga0182006_1056635 3300015261 Bacteria 1493
137 Ga0182006_1070478 3300015261 Bacteria 1297
138 Ga0182007_10001571 3300015262 Bacteria 12179
139 Ga0182007_10002759 3300015262 Bacteria 8577
140 Ga0182007_10021435 3300015262 Bacteria 2295
141 Ga0182005_1004406 3300015265 Bacteria 4558
142 Ga0182005_1005003 3300015265 Bacteria 4191
143 Ga0182005_1017950 3300015265 Bacteria 1957
144 Ga0182005_1022377 3300015265 Bacteria 1732
145 Ga0182005_1022935 3300015265 Bacteria 1708
146 Ga0182005_1023813 3300015265 Bacteria 1672
147 Ga0163161_10012776 3300017792 Bacteria 5832
148 Ga0209760_100011 3300025207 Bacteria 197221
149 Ga0209760_100064 3300025207 Bacteria 91180
150 Ga0209784_100026 3300025224 Bacteria 371540
151 Ga0209566_102356 3300025225 Bacteria 3594
152 Ga0209672_102246 3300025228 Bacteria 4977
153 Ga0209563_100694 3300025230 Bacteria 10611
154 Ga0207427_100008 3300025231 Bacteria 740731
155 Ga0207427_100023 3300025231 Bacteria 439725
156 Ga0207427_100082 3300025231 Bacteria 142809
157 Ga0209437_100006 3300025233 Bacteria 1042724
158 Ga0209437_100014 3300025233 Bacteria 740714
159 Ga0209437_100069 3300025233 Bacteria 307733
160 Ga0209437_100245 3300025233 Bacteria 88331
161 Ga0209258_100059 3300025242 Bacteria 324934
162 Ga0209258_101045 3300025242 Bacteria 12271
163 Ga0209258_101292 3300025242 Bacteria 9314
164 Ga0209646_1001047 3300025246 Bacteria 8338
165 Ga0209026_1000036 3300025250 Bacteria 296607
166 Ga0209148_1000005 3300025254 Bacteria 1806504
167 Ga0209148_1000010 3300025254 Bacteria 1265567
168 Ga0209759_1000023 3300025256 Bacteria 321695
169 Ga0209759_1002192 3300025256 Bacteria 8942
170 Ga0209759_1021902 3300025256 Bacteria 1442
171 Ga0209233_1000008 3300025261 Bacteria 1356712
172 Ga0209233_1000009 3300025261 Bacteria 1265567
173 Ga0209233_1000105 3300025261 Bacteria 272035
174 Ga0209455_1000020 3300025272 Bacteria 702259
175 Ga0209130_1022753 3300025284 Bacteria 1392
176 Ga0209676_1000006 3300025292 Bacteria 1039588
177 Ga0209676_1000369 3300025292 Bacteria 83704
178 Ga0209676_1001140 3300025292 Bacteria 29053
179 Ga0209676_1003514 3300025292 Bacteria 9576
180 Ga0209676_1004051 3300025292 Bacteria 8429
181 Ga0209050_1000070 3300025298 Bacteria 296366
182 Ga0209050_1000235 3300025298 Bacteria 121420
183 Ga0209050_1000380 3300025298 Bacteria 83704
184 Ga0209050_1001241 3300025298 Bacteria 29500
185 Ga0209051_1000086 3300025303 Bacteria 183550
186 Ga0209051_1000123 3300025303 Bacteria 144298
187 Ga0209051_1001064 3300025303 Bacteria 25530
188 Ga0209051_1036421 3300025303 Bacteria 1817
189 Ga0209051_1051857 3300025303 Bacteria 1361
190 Ga0209257_1000421 3300025304 Bacteria 81748
191 Ga0209257_1010774 3300025304 Bacteria 4545
192 Ga0207656_10000094 3300025321 Bacteria 33269
193 Ga0207696_1000025 3300025711 Bacteria 418650
194 Ga0207696_1000161 3300025711 Bacteria 109070
195 Ga0207696_1000399 3300025711 Bacteria 40570
196 Ga0207696_1002704 3300025711 Bacteria 8488
197 Ga0207696_1004662 3300025711 Bacteria 5860
198 Ga0207696_1010679 3300025711 Bacteria 3352
199 Ga0207655_1000113 3300025728 Bacteria 167376
200 Ga0207655_1000269 3300025728 Bacteria 81483
201 Ga0207655_1000976 3300025728 Bacteria 29345
202 Ga0207655_1002157 3300025728 Bacteria 16397
203 Ga0207655_1003563 3300025728 Bacteria 11530
204 Ga0207655_1004512 3300025728 Bacteria 9847
205 Ga0207655_1011189 3300025728 Bacteria 5363
206 Ga0207655_1016647 3300025728 Bacteria 4010
207 Ga0207655_1065760 3300025728 Bacteria 1374
208 Ga0207713_1000102 3300025735 Bacteria 139512
209 Ga0207713_1000344 3300025735 Bacteria 50995
210 Ga0207713_1001819 3300025735 Bacteria 16288
211 Ga0207713_1002656 3300025735 Bacteria 12830
212 Ga0207713_1003166 3300025735 Bacteria 11392
213 Ga0207713_1005358 3300025735 Bacteria 8054
214 Ga0207713_1006303 3300025735 Bacteria 7248
215 Ga0207713_1006787 3300025735 Bacteria 6908
216 Ga0207713_1021584 3300025735 Bacteria 3082
217 Ga0207713_1035118 3300025735 Bacteria 2167
218 Ga0207684_10407806 3300025910 Bacteria 1168
219 Ga0207671_10001551 3300025914 Bacteria 26296
220 Ga0207649_10000061 3300025920 Bacteria 98067
221 Ga0207681_10013490 3300025923 Bacteria 5058
222 Ga0207650_10000419 3300025925 Bacteria 37719
223 Ga0207650_10001683 3300025925 Bacteria 15718
224 Ga0207706_10000668 3300025933 Bacteria 36073
225 Ga0207686_10002078 3300025934 Bacteria 11029
226 Ga0207709_10000223 3300025935 Bacteria 71537
227 Ga0207709_10000835 3300025935 Bacteria 23621
228 Ga0207709_10030251 3300025935 Bacteria 3148
229 Ga0207709_10049445 3300025935 Bacteria 2567
230 Ga0207679_10000018 3300025945 Bacteria 238375
231 Ga0207640_10018613 3300025981 Bacteria 4085
232 Ga0207639_10016158 3300026041 Bacteria 5273
233 Ga0209281_1000010 3300027111 Bacteria 726106
234 Ga0209281_1000331 3300027111 Bacteria 81645
235 Ga0209281_1002825 3300027111 Bacteria 6375
236 Ga0209371_1000365 3300027312 Bacteria 48737
237 Ga0207428_10021464 3300027907 Bacteria 5468
238 Ga0207428_10026590 3300027907 Bacteria 4829
239 Ga0207428_10105296 3300027907 Bacteria 2176
240 Ga0207428_10133142 3300027907 Bacteria 1902
241 Ga0207428_10242544 3300027907 Bacteria 1346
242 Ga0268256_1000236 3300030500 Bacteria 57974
243 Ga0314311_1137078 3300030733 Bacteria 2096
244 Ga0316178_1174406 3300030735 Bacteria 18287
245 Ga0307408_100000025 3300031548 Bacteria 267563
246 Ga0307408_100036272 3300031548 Bacteria 3465
247 Ga0307408_100144895 3300031548 Bacteria 1868
248 Ga0307516_10194648 3300031730 Bacteria 1751
249 Ga0307405_10040867 3300031731 Bacteria 2811
250 Ga0307412_10115724 3300031911 Bacteria 1922
251 Ga0307412_10325564 3300031911 Bacteria 1224
252 Ga0307409_100026395 3300031995 Bacteria 4095
253 Ga0307414_10062721 3300032004 Bacteria 2639
254 Ga0307414_10096469 3300032004 Bacteria 2212
255 Ga0373927_0179601 3300035695 Bacteria 1388
256 Ga0395899_0022460 3300037312 Bacteria 4784
257 Ga0395900_0054481 3300037418 Bacteria 4118
258 Ga0395898_0026985 3300037466 Bacteria 5770
259 Ga0237819_00881 3300038705 Bacteria 9379
260 Ga0400483_011826 3300039062 Bacteria 13740
261 Ga0400483_279756 3300039062 Bacteria 11311
262 Ga0436363_0138769 3300039450 Bacteria 1887
263 Ga0439436_0016475 3300041404 Bacteria 2216
264 Ga0439438_002391 3300041405 Bacteria 7994
265 Ga0439438_005853 3300041405 Bacteria 4454
266 Ga0439438_010670 3300041405 Bacteria 2893
267 Ga0439438_025483 3300041405 Bacteria 1611
268 Ga0439447_001809 3300041407 Bacteria 7835
269 Ga0439447_006010 3300041407 Bacteria 3982
270 Ga0439447_010708 3300041407 Bacteria 2709
271 Ga0439447_029585 3300041407 Bacteria 1385
272 Ga0439447_033238 3300041407 Bacteria 1286
273 Ga0439466_0004608 3300041411 Bacteria 5298
274 Ga0439466_0009682 3300041411 Bacteria 3597
275 Ga0439466_0014226 3300041411 Bacteria 2900
276 Ga0439466_0017268 3300041411 Bacteria 2601
277 Ga0439466_0024300 3300041411 Bacteria 2125
278 Ga0439431_0004367 3300041997 Bacteria 3106
279 Ga0439437_000520 3300042000 Bacteria 3822
280 Ga0439443_002718 3300042003 Bacteria 2149
281 Ga0439432_002368 3300042006 Bacteria 7116
282 Ga0439432_007415 3300042006 Bacteria 3888
283 Ga0439432_018956 3300042006 Bacteria 2295
284 Ga0439432_021257 3300042006 Bacteria 2153
285 Ga0439432_031308 3300042006 Bacteria 1721
286 Ga0439452_000667 3300042010 Bacteria 16915
287 Ga0439452_011937 3300042010 Bacteria 2484
288 Ga0439452_016034 3300042010 Bacteria 2041
289 Ga0439452_018731 3300042010 Bacteria 1840
290 Ga0439452_034005 3300042010 Bacteria 1234
291 Ga0439456_000315 3300042013 Bacteria 11172
292 Ga0439456_012132 3300042013 Bacteria 1786
293 Ga0439456_014249 3300042013 Bacteria 1657
294 Ga0439463_001299 3300042016 Bacteria 6640
295 Ga0439463_003312 3300042016 Bacteria 4083
296 Ga0450911_000017 3300042115 Bacteria 104823
297 Ga0450911_002369 3300042115 Bacteria 3754
298 Ga0450911_008410 3300042115 Bacteria 1471
299 Ga0450913_001977 3300042117 Bacteria 1209
300 Ga0450902_008097 3300042137 Bacteria 1636
301 Ga0450903_005766 3300042138 Bacteria 2067
302 Ga0450904_000166 3300042139 Bacteria 14541
303 Ga0450904_002326 3300042139 Bacteria 2297
304 Ga0450904_005246 3300042139 Bacteria 1319
305 Ga0450906_004046 3300042145 Bacteria 3101
306 Ga0450907_000439 3300042146 Bacteria 12184
307 Ga0450910_000985 3300042147 Bacteria 3450
308 Ga0439446_0000026 3300042156 Bacteria 25155
309 Ga0439446_0059653 3300042156 Bacteria 1151
310 Ga0439434_0009636 3300042435 Bacteria 2842
311 Ga0439434_0044252 3300042435 Bacteria 1371
312 Ga0439459_0000879 3300042438 Bacteria 4200
313 Ga0439464_0006527 3300042439 Bacteria 3041
314 Ga0439464_0018885 3300042439 Bacteria 1878
315 Ga0439460_0001955 3300042461 Bacteria 4930
316 Ga0450916_000791 3300042530 Bacteria 2949
317 Ga0450893_0001272 3300042532 Bacteria 3813
318 Ga0451577_0033401 3300042876 Bacteria 4638
319 Ga0439440_0002330 3300042993 Bacteria 3572
320 Ga0439440_0043154 3300042993 Bacteria 1105
321 Ga0495617_009670 3300046452 Bacteria 3307
322 Ga0495617_009807 3300046452 Bacteria 3284
323 Ga0495627_000040 3300046453 Bacteria 195248
324 Ga0495627_001207 3300046453 Bacteria 16248
325 Ga0495627_002117 3300046453 Bacteria 10035
326 Ga0495627_009066 3300046453 Bacteria 3676
327 Ga0495627_014002 3300046453 Bacteria 2811
328 Ga0495627_028094 3300046453 Bacteria 1799
329 Ga0495603_0017243 3300046455 Bacteria 4371
330 Ga0495590_0005676 3300046457 Bacteria 4909
331 Ga0495590_0009911 3300046457 Bacteria 3602
332 Ga0495590_0025595 3300046457 Bacteria 2074
333 Ga0495590_0037316 3300046457 Bacteria 1694
334 Ga0495591_000023 3300046458 Bacteria 191598
335 Ga0495591_001720 3300046458 Bacteria 13044
336 Ga0495591_002767 3300046458 Bacteria 9469
337 Ga0495591_007086 3300046458 Bacteria 4828
338 Ga0495591_008921 3300046458 Bacteria 4043
339 Ga0495591_016013 3300046458 Bacteria 2627
340 Ga0495638_0023429 3300046460 Bacteria 4038
341 Ga0495638_0026283 3300046460 Bacteria 3773
342 Ga0495638_0044887 3300046460 Bacteria 2782
343 Ga0495638_0095137 3300046460 Bacteria 1789
344 Ga0495638_0101843 3300046460 Bacteria 1716
345 Ga0495638_0117272 3300046460 Bacteria 1576
346 Ga0495638_0222737 3300046460 Bacteria 1053
347 Ga0495653_0001688 3300046463 Bacteria 17382
348 Ga0495653_0075011 3300046463 Bacteria 2518
349 Ga0495653_0109414 3300046463 Bacteria 1988
350 Ga0495653_0153470 3300046463 Bacteria 1606
351 Ga0495650_0001179 3300046471 Bacteria 27791
352 Ga0495650_0021310 3300046471 Bacteria 3136
353 Ga0495650_0023543 3300046471 Bacteria 2929
354 Ga0495650_0024731 3300046471 Bacteria 2831
355 Ga0495650_0036242 3300046471 Bacteria 2160
356 Ga0495650_0040558 3300046471 Bacteria 1997
357 Ga0495650_0096008 3300046471 Bacteria 1119
358 Ga0495605_0000048 3300046474 Bacteria 170182
359 Ga0495605_0000094 3300046474 Bacteria 112717
360 Ga0495605_0001067 3300046474 Bacteria 18295
361 Ga0495605_0002988 3300046474 Bacteria 10219
362 Ga0495605_0005577 3300046474 Bacteria 7318
363 Ga0495605_0019091 3300046474 Bacteria 3668
364 Ga0495605_0027745 3300046474 Bacteria 2930
365 Ga0495605_0030595 3300046474 Bacteria 2758
366 Ga0495605_0047399 3300046474 Bacteria 2108
367 Ga0495605_0082438 3300046474 Bacteria 1502
368 Ga0495639_0014215 3300046475 Bacteria 3444
369 Ga0495584_0019852 3300046491 Bacteria 3414
370 Ga0495584_0038569 3300046491 Bacteria 2414
371 Ga0495584_0058589 3300046491 Bacteria 1937
372 Ga0495584_0150297 3300046491 Bacteria 1183
373 Ga0495585_0028644 3300046492 Bacteria 3175
374 Ga0495585_0033388 3300046492 Bacteria 2912
375 Ga0495585_0038594 3300046492 Bacteria 2687
376 Ga0495585_0053125 3300046492 Bacteria 2242
377 Ga0495585_0105470 3300046492 Bacteria 1503
378 Ga0495596_0001228 3300046500 Bacteria 14950
379 Ga0495596_0002112 3300046500 Bacteria 10892
380 Ga0495596_0063070 3300046500 Bacteria 1441
381 Ga0495607_0000893 3300046501 Bacteria 27775
382 Ga0495607_0000972 3300046501 Bacteria 26545
383 Ga0495607_0001113 3300046501 Bacteria 24369
384 Ga0495607_0001564 3300046501 Bacteria 20007
385 Ga0495607_0007321 3300046501 Bacteria 7651
386 Ga0495607_0009646 3300046501 Bacteria 6523
387 Ga0495607_0011176 3300046501 Bacteria 5993
388 Ga0495607_0016917 3300046501 Bacteria 4694
389 Ga0495607_0019252 3300046501 Bacteria 4338
390 Ga0495607_0021308 3300046501 Bacteria 4080
391 Ga0495607_0039860 3300046501 Bacteria 2802
392 Ga0495607_0042425 3300046501 Bacteria 2696
393 Ga0495607_0064024 3300046501 Bacteria 2078
394 Ga0495607_0084220 3300046501 Bacteria 1740
395 Ga0495607_0087591 3300046501 Bacteria 1694
396 Ga0495607_0096301 3300046501 Bacteria 1593
397 Ga0495607_0172485 3300046501 Bacteria 1091
398 Ga0495607_0191470 3300046501 Bacteria 1018
399 Ga0495583_0000096 3300046506 Bacteria 151090
400 Ga0495583_0002375 3300046506 Bacteria 16249
401 Ga0495583_0004233 3300046506 Bacteria 10418
402 Ga0495583_0004686 3300046506 Bacteria 9632
403 Ga0495583_0004830 3300046506 Bacteria 9432
404 Ga0495583_0008065 3300046506 Bacteria 6494
405 Ga0495583_0023222 3300046506 Bacteria 3142
406 Ga0495583_0031157 3300046506 Bacteria 2588
407 Ga0495606_0000076 3300046507 Bacteria 166969
408 Ga0495606_0000167 3300046507 Bacteria 115739
409 Ga0495606_0000608 3300046507 Bacteria 56665
410 Ga0495606_0003110 3300046507 Bacteria 18033
411 Ga0495606_0003580 3300046507 Bacteria 16376
412 Ga0495606_0003873 3300046507 Bacteria 15447
413 Ga0495606_0020781 3300046507 Bacteria 4826
414 Ga0495606_0029098 3300046507 Bacteria 3885
415 Ga0495606_0031245 3300046507 Bacteria 3705
416 Ga0495606_0035413 3300046507 Bacteria 3411
417 Ga0495606_0044791 3300046507 Bacteria 2939
418 Ga0495606_0060369 3300046507 Bacteria 2428
419 Ga0495606_0071520 3300046507 Bacteria 2183
420 Ga0495606_0105579 3300046507 Bacteria 1707
421 Ga0495610_0003673 3300046512 Bacteria 11795
422 Ga0495610_0029882 3300046512 Bacteria 2862
423 Ga0495610_0034875 3300046512 Bacteria 2587
424 Ga0495610_0042094 3300046512 Bacteria 2287
425 Ga0495610_0042670 3300046512 Bacteria 2266
426 Ga0495610_0045081 3300046512 Bacteria 2183
427 Ga0495616_0001347 3300046513 Bacteria 17142
428 Ga0495616_0010197 3300046513 Bacteria 5451
429 Ga0495616_0014233 3300046513 Bacteria 4461
430 Ga0495616_0026394 3300046513 Bacteria 3092
431 Ga0495616_0043632 3300046513 Bacteria 2277
432 Ga0495616_0044749 3300046513 Bacteria 2244
433 Ga0495616_0055653 3300046513 Bacteria 1957
434 Ga0495616_0056399 3300046513 Bacteria 1940
435 Ga0495616_0106807 3300046513 Bacteria 1305
436 Ga0495620_0000001 3300046515 Bacteria 386508
437 Ga0495620_0000003 3300046515 Bacteria 345923
438 Ga0495620_0000736 3300046515 Bacteria 20171
439 Ga0495620_0001383 3300046515 Bacteria 14599
440 Ga0495620_0010185 3300046515 Bacteria 4966
441 Ga0495620_0020358 3300046515 Bacteria 3241
442 Ga0495620_0022320 3300046515 Bacteria 3050
443 Ga0495620_0068247 3300046515 Bacteria 1460
444 Ga0495620_0071961 3300046515 Bacteria 1412
445 Ga0495620_0077028 3300046515 Bacteria 1354
446 Ga0495631_0000361 3300046518 Bacteria 31358
447 Ga0495631_0011216 3300046518 Bacteria 4413
448 Ga0495631_0013811 3300046518 Bacteria 3911
449 Ga0495631_0037631 3300046518 Bacteria 2154
450 Ga0495631_0041744 3300046518 Bacteria 2029
451 Ga0495632_0001293 3300046519 Bacteria 21160
452 Ga0495632_0009098 3300046519 Bacteria 6011
453 Ga0495632_0018573 3300046519 Bacteria 3812
454 Ga0495632_0026907 3300046519 Bacteria 3019
455 Ga0495632_0027921 3300046519 Bacteria 2949
456 Ga0495632_0032968 3300046519 Bacteria 2663
457 Ga0495632_0048392 3300046519 Bacteria 2105
458 Ga0495632_0055072 3300046519 Bacteria 1948
459 Ga0495632_0060055 3300046519 Bacteria 1848
460 Ga0495632_0068125 3300046519 Bacteria 1715
461 Ga0495632_0071228 3300046519 Bacteria 1670
462 Ga0495632_0106812 3300046519 Bacteria 1316
463 Ga0495632_0117266 3300046519 Bacteria 1246
464 Ga0495637_0000583 3300046520 Bacteria 25971
465 Ga0495637_0006191 3300046520 Bacteria 6021
466 Ga0495637_0008837 3300046520 Bacteria 4932
467 Ga0495637_0009658 3300046520 Bacteria 4700
468 Ga0495637_0010701 3300046520 Bacteria 4427
469 Ga0495637_0019602 3300046520 Bacteria 3125
470 Ga0495637_0023730 3300046520 Bacteria 2781
471 Ga0495637_0027828 3300046520 Bacteria 2525
472 Ga0495637_0034806 3300046520 Bacteria 2203
473 Ga0495637_0042478 3300046520 Bacteria 1944
474 Ga0495637_0051564 3300046520 Bacteria 1721
475 Ga0495637_0064442 3300046520 Bacteria 1494
476 Ga0495637_0117289 3300046520 Bacteria 1027
477 Ga0495643_0000673 3300046522 Bacteria 40197
478 Ga0495643_0000785 3300046522 Bacteria 35224
479 Ga0495643_0011714 3300046522 Bacteria 5324
480 Ga0495643_0034692 3300046522 Bacteria 2783
481 Ga0495643_0070369 3300046522 Bacteria 1837
482 Ga0495643_0140461 3300046522 Bacteria 1205
483 Ga0495643_0169472 3300046522 Bacteria 1068
484 Ga0495644_0005422 3300046523 Bacteria 4981
485 Ga0495644_0016173 3300046523 Bacteria 2857
486 Ga0495644_0020076 3300046523 Bacteria 2549
487 Ga0495644_0027817 3300046523 Bacteria 2141
488 Ga0495648_0008068 3300046524 Bacteria 8328
489 Ga0495648_0008743 3300046524 Bacteria 7930
490 Ga0495648_0019177 3300046524 Bacteria 4819
491 Ga0495648_0029004 3300046524 Bacteria 3678
492 Ga0495648_0030511 3300046524 Bacteria 3563
493 Ga0495648_0041982 3300046524 Bacteria 2882
494 Ga0495648_0067821 3300046524 Bacteria 2084
495 Ga0495648_0078373 3300046524 Bacteria 1889
496 Ga0495648_0078685 3300046524 Bacteria 1884
497 Ga0495648_0083334 3300046524 Bacteria 1812
498 Ga0495648_0126020 3300046524 Bacteria 1368
499 Ga0495648_0198136 3300046524 Bacteria 1007
500 Ga0495666_0019899 3300046526 Bacteria 3329
501 Ga0495666_0119399 3300046526 Bacteria 1235
502 Ga0495642_0001507 3300046528 Bacteria 10362
503 Ga0495642_0009207 3300046528 Bacteria 3780
504 Ga0495654_0001014 3300046530 Bacteria 20561
505 Ga0495654_0001425 3300046530 Bacteria 16486
506 Ga0495654_0003292 3300046530 Bacteria 9954
507 Ga0495654_0004160 3300046530 Bacteria 8670
508 Ga0495654_0015896 3300046530 Bacteria 3988
509 Ga0495654_0018333 3300046530 Bacteria 3669
510 Ga0495654_0032304 3300046530 Bacteria 2653
511 Ga0495654_0037006 3300046530 Bacteria 2450
512 Ga0495654_0041036 3300046530 Bacteria 2303
513 Ga0495654_0050130 3300046530 Bacteria 2041
514 Ga0495654_0073257 3300046530 Bacteria 1620
515 Ga0495654_0074100 3300046530 Bacteria 1608
516 Ga0495654_0083276 3300046530 Bacteria 1495
517 Ga0495654_0085444 3300046530 Bacteria 1472
518 Ga0495587_0097056 3300046536 Bacteria 1699
519 Ga0495587_0250428 3300046536 Bacteria 996
520 Ga0495609_0000012 3300046538 Bacteria 333994
521 Ga0495609_0000079 3300046538 Bacteria 118997
522 Ga0495609_0000799 3300046538 Bacteria 23561
523 Ga0495609_0020773 3300046538 Bacteria 3030
524 Ga0495609_0024870 3300046538 Bacteria 2745
525 Ga0495609_0109095 3300046538 Bacteria 1195
526 Ga0495597_0000016 3300046542 Bacteria 167456
527 Ga0495597_0009148 3300046542 Bacteria 4915
528 Ga0495597_0015221 3300046542 Bacteria 3644
529 Ga0495597_0018427 3300046542 Bacteria 3276
530 Ga0495597_0072903 3300046542 Bacteria 1476
531 Ga0495597_0085496 3300046542 Bacteria 1344
532 Ga0495622_0015164 3300046557 Bacteria 3582
533 Ga0495622_0016356 3300046557 Bacteria 3453
534 Ga0495633_0000034 3300046558 Bacteria 185552
535 Ga0495633_0017328 3300046558 Bacteria 3686
536 Ga0495633_0024822 3300046558 Bacteria 2957
537 Ga0495633_0096518 3300046558 Bacteria 1373
538 Ga0495668_0002256 3300046616 Bacteria 16217
539 Ga0495668_0023584 3300046616 Bacteria 3506
540 Ga0495668_0026859 3300046616 Bacteria 3264
541 Ga0495668_0027121 3300046616 Bacteria 3245
542 Ga0495668_0027373 3300046616 Bacteria 3230
543 Ga0495668_0225564 3300046616 Bacteria 1026
544 Ga0495634_0043592 3300046642 Bacteria 3040
545 Ga0495611_0002095 3300046648 Bacteria 9371
546 Ga0495611_0003561 3300046648 Bacteria 6845
547 Ga0495611_0004112 3300046648 Bacteria 6337
548 Ga0495611_0040427 3300046648 Bacteria 2079
549 Ga0495625_0000185 3300046660 Bacteria 97863
550 Ga0495625_0074759 3300046660 Bacteria 2372
551 Ga0495625_0096238 3300046660 Bacteria 2039
552 Ga0495625_0099653 3300046660 Bacteria 1997
553 Ga0495625_0104960 3300046660 Bacteria 1936
554 Ga0495625_0112061 3300046660 Bacteria 1864
555 Ga0495625_0115766 3300046660 Bacteria 1829
556 Ga0495635_0038697 3300046663 Bacteria 3301
557 Ga0495659_0006501 3300046664 Bacteria 3691
558 Ga0495659_0010963 3300046664 Bacteria 2919
559 Ga0495661_0000004 3300046665 Bacteria 555340
560 Ga0495661_0000028 3300046665 Bacteria 182191
561 Ga0495661_0000088 3300046665 Bacteria 111782
562 Ga0495661_0000146 3300046665 Bacteria 82292
563 Ga0495661_0006678 3300046665 Bacteria 8098
564 Ga0495661_0007167 3300046665 Bacteria 7780
565 Ga0495661_0007616 3300046665 Bacteria 7545
566 Ga0495661_0033661 3300046665 Bacteria 3230
567 Ga0495661_0051739 3300046665 Bacteria 2478
568 Ga0495661_0064528 3300046665 Bacteria 2160
569 Ga0495661_0113925 3300046665 Bacteria 1503
570 Ga0495623_0042430 3300046679 Bacteria 2897
571 Ga0495669_0016942 3300046684 Bacteria 3125
572 Ga0495613_0145210 3300046689 Bacteria 1693
573 Ga0495624_0087188 3300046690 Bacteria 1927
574 Ga0495670_0009810 3300046691 Bacteria 4707
575 Ga0495670_0011441 3300046691 Bacteria 4364
576 Ga0495670_0093401 3300046691 Bacteria 1542
577 Ga0495670_0183475 3300046691 Bacteria 1105
578 Ga0495671_0007977 3300046692 Bacteria 5984
579 Ga0495671_0022459 3300046692 Bacteria 3306
580 Ga0495671_0026438 3300046692 Bacteria 3008
581 Ga0495671_0026874 3300046692 Bacteria 2978
582 Ga0495671_0033954 3300046692 Bacteria 2596
583 Ga0495671_0058828 3300046692 Bacteria 1900
584 Ga0495671_0059785 3300046692 Bacteria 1882
585 Ga0495671_0070706 3300046692 Bacteria 1714
586 Ga0495671_0072743 3300046692 Bacteria 1688
587 Ga0495649_0000445 3300046694 Bacteria 35787
588 Ga0495649_0000699 3300046694 Bacteria 27370
589 Ga0495649_0001861 3300046694 Bacteria 15440
590 Ga0495649_0018962 3300046694 Bacteria 3864
591 Ga0495649_0034226 3300046694 Bacteria 2795
592 Ga0495649_0041788 3300046694 Bacteria 2505
593 Ga0495649_0047307 3300046694 Bacteria 2339
594 Ga0495649_0049862 3300046694 Bacteria 2273
595 Ga0495649_0055490 3300046694 Bacteria 2140
596 Ga0495649_0083759 3300046694 Bacteria 1703
597 Ga0495649_0085329 3300046694 Bacteria 1685
598 Ga0495649_0089962 3300046694 Bacteria 1637
599 Ga0495649_0103200 3300046694 Bacteria 1514
600 Ga0495589_0002693 3300046794 Bacteria 9819
601 Ga0495589_0022642 3300046794 Bacteria 3205
602 Ga0495589_0032567 3300046794 Bacteria 2620
603 Ga0495589_0050517 3300046794 Bacteria 2056
604 Ga0495600_0074118 3300046809 Bacteria 2222
605 Ga0495600_0104308 3300046809 Bacteria 1847
606 Ga0495660_0003327 3300046810 Bacteria 9969
607 Ga0495660_0006173 3300046810 Bacteria 7113
608 Ga0495660_0020264 3300046810 Bacteria 3811
609 Ga0495660_0032533 3300046810 Bacteria 2928
610 Ga0495660_0039041 3300046810 Bacteria 2637
611 Ga0495660_0071840 3300046810 Bacteria 1834
612 Ga0495660_0079596 3300046810 Bacteria 1720
613 Ga0495660_0091256 3300046810 Bacteria 1582
614 Ga0495660_0098328 3300046810 Bacteria 1509
615 Ga0495660_0159451 3300046810 Bacteria 1107
616 Ga0495604_0074539 3300047317 Bacteria 2557
617 Ga0495604_0163243 3300047317 Bacteria 1572
618 Ga0495672_0001231 3300047320 Bacteria 25711
619 Ga0495672_0023814 3300047320 Bacteria 3955
620 Ga0495672_0026378 3300047320 Bacteria 3708
621 Ga0495672_0028199 3300047320 Bacteria 3555
622 Ga0495672_0033814 3300047320 Bacteria 3165
623 Ga0495672_0035798 3300047320 Bacteria 3054
624 Ga0495672_0045498 3300047320 Bacteria 2625
625 Ga0495672_0054056 3300047320 Bacteria 2349
626 Ga0495672_0060894 3300047320 Bacteria 2177
627 Ga0495672_0065070 3300047320 Bacteria 2085
628 Ga0495672_0084549 3300047320 Bacteria 1759
629 Ga0495676_0000160 3300047321 Bacteria 51908
630 Ga0495676_0064969 3300047321 Bacteria 2834
631 Ga0495676_0295111 3300047321 Bacteria 1094
632 Ga0495680_0059649 3300047322 Bacteria 2944
633 Ga0495680_0139795 3300047322 Bacteria 1772
634 Ga0495680_0302553 3300047322 Bacteria 1122
635 Ga0495683_0000034 3300047323 Bacteria 148959
636 Ga0495683_0000216 3300047323 Bacteria 54311
637 Ga0495683_0010981 3300047323 Bacteria 4776
638 Ga0495683_0022020 3300047323 Bacteria 3279
639 Ga0495683_0051853 3300047323 Bacteria 2049
640 Ga0495683_0089758 3300047323 Bacteria 1490
641 Ga0495683_0129158 3300047323 Bacteria 1193
642 Ga0495687_019903 3300047443 Bacteria 3281
643 Ga0495677_0030674 3300047445 Bacteria 1956
644 Ga0495679_000377 3300047446 Bacteria 34132
645 Ga0495679_014863 3300047446 Bacteria 2866
646 Ga0495679_015263 3300047446 Bacteria 2815
647 Ga0495679_015573 3300047446 Bacteria 2777
648 Ga0495679_021050 3300047446 Bacteria 2261
649 Ga0495679_024414 3300047446 Bacteria 2037
650 Ga0495679_031583 3300047446 Bacteria 1707
651 Ga0495685_031430 3300047447 Bacteria 1825
652 Ga0495673_0002712 3300047469 Bacteria 12168
653 Ga0495673_0006452 3300047469 Bacteria 6889
654 Ga0495673_0010072 3300047469 Bacteria 5170
655 Ga0495673_0015923 3300047469 Bacteria 3858
656 Ga0495673_0016934 3300047469 Bacteria 3713
657 Ga0495673_0033689 3300047469 Bacteria 2374
658 Ga0495673_0036706 3300047469 Bacteria 2244
659 Ga0495673_0037163 3300047469 Bacteria 2226
660 Ga0495673_0040815 3300047469 Bacteria 2092
661 Ga0495673_0042642 3300047469 Bacteria 2035
662 Ga0495673_0048050 3300047469 Bacteria 1883
663 Ga0495673_0055315 3300047469 Bacteria 1721
664 Ga0495673_0069862 3300047469 Bacteria 1480
665 Ga0495673_0087283 3300047469 Bacteria 1280
666 Ga0495681_0009159 3300047470 Bacteria 6125
667 Ga0495681_0013039 3300047470 Bacteria 4850
668 Ga0495681_0021377 3300047470 Bacteria 3489
669 Ga0495681_0025854 3300047470 Bacteria 3066
670 Ga0495681_0030486 3300047470 Bacteria 2745
671 Ga0495681_0042194 3300047470 Bacteria 2209
672 Ga0495681_0044007 3300047470 Bacteria 2149
673 Ga0495681_0075821 3300047470 Bacteria 1513
674 Ga0495681_0079196 3300047470 Bacteria 1470
675 Ga0495684_0146740 3300047471 Bacteria 1766
676 Ga0495686_0011832 3300047472 Bacteria 6137
677 Ga0495686_0029647 3300047472 Bacteria 3558
678 Ga0495686_0099960 3300047472 Bacteria 1750
679 Ga0495686_0167550 3300047472 Bacteria 1279
680 Ga0495593_0035166 3300047673 Bacteria 2721
681 Ga0495593_0060514 3300047673 Bacteria 1982
682 Ga0495602_0163305 3300048088 Bacteria 1736
683 Ga0495626_0000125 3300048091 Bacteria 99451
684 Ga0495626_0001796 3300048091 Bacteria 16211
685 Ga0495626_0004821 3300048091 Bacteria 8133
686 Ga0495626_0019437 3300048091 Bacteria 3398
687 Ga0495626_0019580 3300048091 Bacteria 3384
688 Ga0495626_0026534 3300048091 Bacteria 2822
689 Ga0495626_0037187 3300048091 Bacteria 2314
690 Ga0495626_0047813 3300048091 Bacteria 1987
691 Ga0495626_0063581 3300048091 Bacteria 1673
692 Ga0495626_0077874 3300048091 Bacteria 1477
693 Ga0496102_0065015 3300048905 Bacteria 3342
694 Ga0496102_0208392 3300048905 Bacteria 1843
695 Ga0496110_0049992 3300048913 Bacteria 3670
696 Ga0496110_0175404 3300048913 Bacteria 1945
697 Ga0496115_0000372 3300048918 Bacteria 37081
698 Ga0496116_0001043 3300048919 Bacteria 33784
699 Ga0496116_0004638 3300048919 Bacteria 13019
700 Ga0496116_0018663 3300048919 Bacteria 5335
701 Ga0496116_0069705 3300048919 Bacteria 2234
702 Ga0496116_0100650 3300048919 Bacteria 1727
703 Ga0496116_0142693 3300048919 Bacteria 1344
704 Ga0496117_0047000 3300048920 Bacteria 3100
705 Ga0496117_0050821 3300048920 Bacteria 2937
706 Ga0496117_0053566 3300048920 Bacteria 2833
707 Ga0496117_0067336 3300048920 Bacteria 2423
708 Ga0496117_0086027 3300048920 Bacteria 2044
709 Ga0496117_0091099 3300048920 Bacteria 1962
710 Ga0496117_0094012 3300048920 Bacteria 1920
711 Ga0496118_0044010 3300048921 Bacteria 3500
712 Ga0496118_0071816 3300048921 Bacteria 2489
713 Ga0496118_0086981 3300048921 Bacteria 2169
714 Ga0496118_0144446 3300048921 Bacteria 1501
715 Ga0496118_0181456 3300048921 Bacteria 1271
716 Ga0496120_0122213 3300048923 Bacteria 1344
717 Ga0496120_0142244 3300048923 Bacteria 1216
718 Ga0496121_0002337 3300048924 Bacteria 29283
719 Ga0496121_0004179 3300048924 Bacteria 19722
720 Ga0496121_0038182 3300048924 Bacteria 4257
721 Ga0496121_0097272 3300048924 Bacteria 2281
722 Ga0496122_0021670 3300048925 Bacteria 5743
723 Ga0496122_0026521 3300048925 Bacteria 4991
724 Ga0496122_0046468 3300048925 Bacteria 3361
725 Ga0496122_0072157 3300048925 Bacteria 2456
726 Ga0496122_0077118 3300048925 Bacteria 2342
727 Ga0496122_0164504 3300048925 Bacteria 1347
728 Ga0496123_0001511 3300048926 Bacteria 32223
729 Ga0496123_0041688 3300048926 Bacteria 3177
730 Ga0496123_0059724 3300048926 Bacteria 2462
731 Ga0496123_0104605 3300048926 Bacteria 1636
732 Ga0496123_0105572 3300048926 Bacteria 1625
733 Ga0496123_0109509 3300048926 Bacteria 1582
734 Ga0496123_0118448 3300048926 Bacteria 1495
735 Ga0496124_0001524 3300048927 Bacteria 33727
736 Ga0496124_0001773 3300048927 Bacteria 30021
737 Ga0496124_0033048 3300048927 Bacteria 4556
738 Ga0496124_0054267 3300048927 Bacteria 3393
739 Ga0496124_0062509 3300048927 Bacteria 3115
740 Ga0496124_0063450 3300048927 Bacteria 3086
741 Ga0496124_0075351 3300048927 Bacteria 2787
742 Ga0496124_0239997 3300048927 Bacteria 1348
743 Ga0496125_0091942 3300048928 Bacteria 2270
744 Ga0496125_0115071 3300048928 Bacteria 1935
745 Ga0496125_0165927 3300048928 Bacteria 1492
746 Ga0496125_0231127 3300048928 Bacteria 1182
747 Ga0496126_0032090 3300048929 Bacteria 4953
748 Ga0496126_0092027 3300048929 Bacteria 2665
749 Ga0496126_0125710 3300048929 Bacteria 2219
750 Ga0495678_000049 3300049459 Bacteria 163929
751 Ga0495678_000918 3300049459 Bacteria 25900
752 Ga0495678_001783 3300049459 Bacteria 15918
753 Ga0495678_016655 3300049459 Bacteria 3353
754 Ga0495678_016849 3300049459 Bacteria 3327
755 Ga0495678_017909 3300049459 Bacteria 3197
756 Ga0495678_019253 3300049459 Bacteria 3049
757 Ga0495678_032576 3300049459 Bacteria 2158
758 Ga0495678_042946 3300049459 Bacteria 1798
759 Ga0495678_062025 3300049459 Bacteria 1400
760 Ga0495678_074266 3300049459 Bacteria 1237
761 Ga0495678_080216 3300049459 Bacteria 1173
762 Ga0495682_0000153 3300049460 Bacteria 59021
763 Ga0495682_0004151 3300049460 Bacteria 6281
764 Ga0495682_0020304 3300049460 Bacteria 2494
765 Ga0495682_0021639 3300049460 Bacteria 2408
766 Ga0495682_0042657 3300049460 Bacteria 1662
767 Ga0495682_0065185 3300049460 Bacteria 1313
768 Ga0495682_0086038 3300049460 Bacteria 1129
769 Ga0501031_0111953 3300049568 Bacteria 1783
770 Ga0501037_0302412 3300049573 Bacteria 1111
771 Ga0501222_004172 3300049662 Bacteria 1963
772 Ga0501241_004405 3300049758 Bacteria 2641
773 Ga0501226_000017 3300049853 Bacteria 150879
774 nmdc:mga03683_112256_c1 3300050489 Bacteria 1206
775 nmdc:mga03683_2291_c1 3300050489 Bacteria 4706
776 nmdc:mga00v17_117429_c1 3300050491 Bacteria 1692
777 nmdc:mga0sz30_19496_c1 3300050516 Bacteria 2728
778 Ga0500572_004688 3300053111 Bacteria 3100
779 Ga0500618_025028 3300053125 Bacteria 1433
780 Ga0500573_0040451 3300053140 Bacteria 2692
781 Ga0500552_001318 3300053733 Bacteria 2362

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042156 Ga0439446_0000026 Ga0439446_0000026_12997_13977 259
2 3300041411 Ga0439466_0004608 Ga0439466_0004608_2495_3478 264
3 3300015261 Ga0182006_1021402 Ga0182006_10214021 268
4 3300042016 Ga0439463_001299 Ga0439463_001299_290_1195 272
5 iso_pu_bacteria 2919697872 2919699279 277
6 3300046474 Ga0495605_0047399 Ga0495605_0047399_278_1123 281
7 3300046507 Ga0495606_0003873 Ga0495606_0003873_27_872 281
8 3300005434 Ga0070709_10380710 Ga0070709_103807101 284
9 3300005518 Ga0070699_100484596 Ga0070699_1004845961 284
10 3300006177 Ga0075362_10031647 Ga0075362_100316473 284
11 3300006177 Ga0075362_10092813 Ga0075362_100928131 284
12 3300006186 Ga0075369_10005588 Ga0075369_100055882 284
13 3300010159 Ga0099796_10102136 Ga0099796_101021361 284
14 3300025910 Ga0207684_10407806 Ga0207684_104078061 284
15 3300035695 Ga0373927_0179601 Ga0373927_0179601_221_1225 284
16 3300037312 Ga0395899_0022460 Ga0395899_0022460_29_1018 284
17 3300037418 Ga0395900_0054481 Ga0395900_0054481_3078_4067 284
18 3300037466 Ga0395898_0026985 Ga0395898_0026985_4451_5440 284
19 3300046453 Ga0495627_002117 Ga0495627_002117_8264_9151 284
20 3300046471 Ga0495650_0040558 Ga0495650_0040558_616_1503 284
21 3300046518 Ga0495631_0000361 Ga0495631_0000361_29815_30702 284
22 3300046519 Ga0495632_0055072 Ga0495632_0055072_668_1555 284
23 3300046530 Ga0495654_0001014 Ga0495654_0001014_14555_15442 284
24 3300046692 Ga0495671_0022459 Ga0495671_0022459_938_1825 284
25 3300047320 Ga0495672_0054056 Ga0495672_0054056_1127_2014 284
26 3300050489 nmdc:mga03683_112256_c1 nmdc:mga03683_112256_c1_249_1166 284
27 3300050489 nmdc:mga03683_2291_c1 nmdc:mga03683_2291_c1_1445_2437 284
28 3300050516 nmdc:mga0sz30_19496_c1 nmdc:mga0sz30_19496_c1_1295_2287 284
29 3300053733 Ga0500552_001318 Ga0500552_001318_35_1027 284
30 3300005937 Ga0081455_10008620 Ga0081455_100086203 285
31 3300002737 JGI25162J39368_1000018 JGI25162J39368_1000018180 286
32 3300002741 JGI25157J39369_1000011 JGI25157J39369_10000119 286
33 3300002771 JGI25163J39215_1000612 JGI25163J39215_10006129 286
34 3300002772 JGI25164J39214_1000007 JGI25164J39214_1000007180 286
35 3300003214 JGI25165J46597_1000029 JGI25165J46597_1000029107 286
36 3300003761 Ga0055535_1000025 Ga0055535_100002513 286
37 3300003761 Ga0055535_1000103 Ga0055535_100010314 286
38 3300003762 Ga0055542_1000010 Ga0055542_1000010334 286
39 3300003762 Ga0055542_1000024 Ga0055542_1000024180 286
40 3300003763 Ga0055529_1000029 Ga0055529_1000029180 286
41 3300025224 Ga0209784_100026 Ga0209784_100026168 286
42 3300025225 Ga0209566_102356 Ga0209566_1023565 286
43 3300025228 Ga0209672_102246 Ga0209672_1022466 286
44 3300025231 Ga0207427_100023 Ga0207427_100023168 286
45 3300025233 Ga0209437_100069 Ga0209437_10006994 286
46 3300025233 Ga0209437_100245 Ga0209437_1002457 286
47 3300025242 Ga0209258_100059 Ga0209258_100059168 286
48 3300025242 Ga0209258_101292 Ga0209258_1012926 286
49 3300025246 Ga0209646_1001047 Ga0209646_10010474 286
50 3300025250 Ga0209026_1000036 Ga0209026_100003685 286
51 3300025254 Ga0209148_1000005 Ga0209148_100000517 286
52 3300025254 Ga0209148_1000010 Ga0209148_1000010167 286
53 3300025256 Ga0209759_1000023 Ga0209759_10000236 286
54 3300025256 Ga0209759_1002192 Ga0209759_10021924 286
55 3300025261 Ga0209233_1000009 Ga0209233_10000091004 286
56 3300025272 Ga0209455_1000020 Ga0209455_1000020436 286
57 3300041404 Ga0439436_0016475 Ga0439436_0016475_95_1060 286
58 3300041405 Ga0439438_002391 Ga0439438_002391_1116_2081 286
59 3300041407 Ga0439447_001809 Ga0439447_001809_1030_1995 286
60 3300041411 Ga0439466_0009682 Ga0439466_0009682_1706_2566 286
61 3300041411 Ga0439466_0017268 Ga0439466_0017268_1371_2336 286
62 3300042006 Ga0439432_002368 Ga0439432_002368_1104_2069 286
63 3300046507 Ga0495606_0003110 Ga0495606_0003110_16681_17658 286
64 3300046694 Ga0495649_0000699 Ga0495649_0000699_16065_17042 286
65 3300048918 Ga0496115_0000372 Ga0496115_0000372_19736_20713 286
66 3300048929 Ga0496126_0032090 Ga0496126_0032090_2836_3813 286
67 3300049460 Ga0495682_0021639 Ga0495682_0021639_1065_2042 286
68 iso_pu_bacteria 2928963466 2928963945 286
69 3300002067 JGI24735J21928_10001792 JGI24735J21928_100017924 287
70 3300025242 Ga0209258_101045 Ga0209258_1010459 287
71 3300039062 Ga0400483_011826 Ga0400483_011826_1565_2533 287
72 3300039062 Ga0400483_279756 Ga0400483_279756_1699_2667 287
73 iso_pu_bacteria 2912963787 2912967695 287
74 iso_pu_bacteria 2923153595 2923158101 287
75 2124908027 MRS2a_Contig_9054 MRS2a_00417880 291
76 2162886007 SwRhRL2b_contig_249379 SwRhRL2b_0881.00007150 291
77 2162886007 SwRhRL2b_contig_3818765 SwRhRL2b_0405.00001640 291
78 3300002771 JGI25163J39215_1001671 JGI25163J39215_10016711 291
79 3300002771 JGI25163J39215_1001757 JGI25163J39215_10017574 291
80 3300002772 JGI25164J39214_1000194 JGI25164J39214_100019411 291
81 3300002772 JGI25164J39214_1000513 JGI25164J39214_10005135 291
82 3300003214 JGI25165J46597_1000348 JGI25165J46597_100034811 291
83 3300003214 JGI25165J46597_1000430 JGI25165J46597_10004305 291
84 3300003781 Ga0055536_1000111 Ga0055536_100011159 291
85 3300003791 Ga0055530_10000146 Ga0055530_1000014616 291
86 3300003791 Ga0055530_10001124 Ga0055530_1000112418 291
87 3300003792 Ga0055540_1000822 Ga0055540_100082218 291
88 3300003792 Ga0055540_1001173 Ga0055540_10011737 291
89 3300003792 Ga0055540_1001379 Ga0055540_10013798 291
90 3300003794 Ga0055531_10005378 Ga0055531_100053783 291
91 3300005288 Ga0065714_10003020 Ga0065714_100030207 291
92 3300005288 Ga0065714_10008503 Ga0065714_100085034 291
93 3300005288 Ga0065714_10010964 Ga0065714_100109642 291
94 3300005289 Ga0065704_10000811 Ga0065704_1000081116 291
95 3300005289 Ga0065704_10128936 Ga0065704_101289361 291
96 3300005290 Ga0065712_10001766 Ga0065712_100017661 291
97 3300005290 Ga0065712_10067928 Ga0065712_100679281 291
98 3300005290 Ga0065712_10095511 Ga0065712_100955111 291
99 3300005331 Ga0070670_100001032 Ga0070670_10000103220 291
100 3300005331 Ga0070670_100039965 Ga0070670_1000399652 291
101 3300005344 Ga0070661_100000410 Ga0070661_10000041017 291
102 3300005457 Ga0070662_100000575 Ga0070662_1000005754 291
103 3300005457 Ga0070662_100231300 Ga0070662_1002313002 291
104 3300005539 Ga0068853_100017790 Ga0068853_1000177902 291
105 3300005564 Ga0070664_100000377 Ga0070664_10000037717 291
106 3300005564 Ga0070664_100508048 Ga0070664_1005080481 291
107 3300005578 Ga0068854_100020669 Ga0068854_1000206693 291
108 3300005834 Ga0068851_10000251 Ga0068851_100002516 291
109 3300006051 Ga0075364_10111970 Ga0075364_101119702 291
110 3300006058 Ga0075432_10001356 Ga0075432_100013564 291
111 3300006058 Ga0075432_10004567 Ga0075432_100045672 291
112 3300006058 Ga0075432_10033448 Ga0075432_100334481 291
113 3300006058 Ga0075432_10071867 Ga0075432_100718672 291
114 3300006177 Ga0075362_10052897 Ga0075362_100528972 291
115 3300006946 Ga0079104_1000364 Ga0079104_100036439 291
116 3300009011 Ga0105251_10000275 Ga0105251_1000027532 291
117 3300009011 Ga0105251_10000284 Ga0105251_100002845 291
118 3300009011 Ga0105251_10003067 Ga0105251_100030674 291
119 3300009011 Ga0105251_10003252 Ga0105251_100032522 291
120 3300009011 Ga0105251_10004649 Ga0105251_100046497 291
121 3300009011 Ga0105251_10005474 Ga0105251_100054748 291
122 3300009011 Ga0105251_10007774 Ga0105251_100077745 291
123 3300009011 Ga0105251_10017472 Ga0105251_100174722 291
124 3300009011 Ga0105251_10019528 Ga0105251_100195284 291
125 3300009011 Ga0105251_10021821 Ga0105251_100218211 291
126 3300009011 Ga0105251_10028781 Ga0105251_100287811 291
127 3300009011 Ga0105251_10050514 Ga0105251_100505141 291
128 3300009011 Ga0105251_10068203 Ga0105251_100682032 291
129 3300009011 Ga0105251_10122040 Ga0105251_101220402 291
130 3300009036 Ga0105244_10000248 Ga0105244_1000024841 291
131 3300009036 Ga0105244_10001261 Ga0105244_1000126118 291
132 3300009036 Ga0105244_10009784 Ga0105244_100097846 291
133 3300009036 Ga0105244_10012090 Ga0105244_100120901 291
134 3300009036 Ga0105244_10020378 Ga0105244_100203783 291
135 3300009036 Ga0105244_10026295 Ga0105244_100262954 291
136 3300009036 Ga0105244_10043759 Ga0105244_100437592 291
137 3300009036 Ga0105244_10079305 Ga0105244_100793052 291
138 3300009092 Ga0105250_10000232 Ga0105250_1000023228 291
139 3300009092 Ga0105250_10001490 Ga0105250_1000149012 291
140 3300009092 Ga0105250_10001860 Ga0105250_100018602 291
141 3300009092 Ga0105250_10016458 Ga0105250_100164581 291
142 3300009092 Ga0105250_10023495 Ga0105250_100234951 291
143 3300009092 Ga0105250_10050018 Ga0105250_100500181 291
144 3300009148 Ga0105243_10001441 Ga0105243_1000144115 291
145 3300009148 Ga0105243_10002007 Ga0105243_1000200715 291
146 3300009148 Ga0105243_10053799 Ga0105243_100537992 291
147 3300009148 Ga0105243_10200929 Ga0105243_102009292 291
148 3300009176 Ga0105242_10002563 Ga0105242_1000256310 291
149 3300009545 Ga0105237_10002926 Ga0105237_100029267 291
150 3300009553 Ga0105249_10098399 Ga0105249_100983993 291
151 3300011119 Ga0105246_10001555 Ga0105246_100015557 291
152 3300011119 Ga0105246_10015749 Ga0105246_100157492 291
153 3300011119 Ga0105246_10023510 Ga0105246_100235102 291
154 3300011119 Ga0105246_10055583 Ga0105246_100555831 291
155 3300012498 Ga0157345_1000292 Ga0157345_10002927 291
156 3300013100 Ga0157373_10002707 Ga0157373_100027077 291
157 3300013100 Ga0157373_10013017 Ga0157373_100130173 291
158 3300013100 Ga0157373_10014185 Ga0157373_100141857 291
159 3300013100 Ga0157373_10111685 Ga0157373_101116851 291
160 3300013100 Ga0157373_10140465 Ga0157373_101404652 291
161 3300013102 Ga0157371_10003281 Ga0157371_100032818 291
162 3300013102 Ga0157371_10004368 Ga0157371_100043682 291
163 3300013102 Ga0157371_10014445 Ga0157371_100144457 291
164 3300013102 Ga0157371_10137678 Ga0157371_101376782 291
165 3300013104 Ga0157370_10000162 Ga0157370_1000016228 291
166 3300013104 Ga0157370_10031069 Ga0157370_100310692 291
167 3300013104 Ga0157370_10043496 Ga0157370_100434962 291
168 3300013104 Ga0157370_10085672 Ga0157370_100856722 291
169 3300013104 Ga0157370_10109001 Ga0157370_101090012 291
170 3300013104 Ga0157370_10183943 Ga0157370_101839431 291
171 3300013104 Ga0157370_10192611 Ga0157370_101926112 291
172 3300013105 Ga0157369_10024884 Ga0157369_100248847 291
173 3300013105 Ga0157369_10030369 Ga0157369_100303697 291
174 3300013105 Ga0157369_10032322 Ga0157369_100323221 291
175 3300013105 Ga0157369_10086755 Ga0157369_100867551 291
176 3300013306 Ga0163162_10009884 Ga0163162_100098847 291
177 3300013306 Ga0163162_10286440 Ga0163162_102864402 291
178 3300013307 Ga0157372_10086657 Ga0157372_100866574 291
179 3300013308 Ga0157375_10097473 Ga0157375_100974734 291
180 3300013308 Ga0157375_10766014 Ga0157375_107660141 291
181 3300014497 Ga0182008_10005686 Ga0182008_100056868 291
182 3300014497 Ga0182008_10011957 Ga0182008_100119574 291
183 3300014497 Ga0182008_10021333 Ga0182008_100213334 291
184 3300014497 Ga0182008_10021424 Ga0182008_100214242 291
185 3300014497 Ga0182008_10041281 Ga0182008_100412812 291
186 3300015261 Ga0182006_1001230 Ga0182006_10012301 291
187 3300015261 Ga0182006_1002590 Ga0182006_10025905 291
188 3300015261 Ga0182006_1008846 Ga0182006_10088463 291
189 3300015261 Ga0182006_1023158 Ga0182006_10231581 291
190 3300015261 Ga0182006_1026917 Ga0182006_10269172 291
191 3300015261 Ga0182006_1056635 Ga0182006_10566352 291
192 3300015261 Ga0182006_1070478 Ga0182006_10704781 291
193 3300015262 Ga0182007_10001571 Ga0182007_100015712 291
194 3300015262 Ga0182007_10002759 Ga0182007_100027594 291
195 3300015262 Ga0182007_10021435 Ga0182007_100214353 291
196 3300015265 Ga0182005_1004406 Ga0182005_10044063 291
197 3300015265 Ga0182005_1005003 Ga0182005_10050034 291
198 3300015265 Ga0182005_1017950 Ga0182005_10179501 291
199 3300015265 Ga0182005_1022377 Ga0182005_10223771 291
200 3300015265 Ga0182005_1022935 Ga0182005_10229351 291
201 3300015265 Ga0182005_1023813 Ga0182005_10238132 291
202 3300017792 Ga0163161_10012776 Ga0163161_100127761 291
203 3300025207 Ga0209760_100011 Ga0209760_1000112 291
204 3300025207 Ga0209760_100064 Ga0209760_10006411 291
205 3300025230 Ga0209563_100694 Ga0209563_1006945 291
206 3300025231 Ga0207427_100008 Ga0207427_100008183 291
207 3300025231 Ga0207427_100082 Ga0207427_100082123 291
208 3300025233 Ga0209437_100006 Ga0209437_100006254 291
209 3300025233 Ga0209437_100014 Ga0209437_100014528 291
210 3300025256 Ga0209759_1021902 Ga0209759_10219021 291
211 3300025261 Ga0209233_1000008 Ga0209233_1000008528 291
212 3300025261 Ga0209233_1000105 Ga0209233_1000105235 291
213 3300025284 Ga0209130_1022753 Ga0209130_10227532 291
214 3300025292 Ga0209676_1000006 Ga0209676_1000006235 291
215 3300025292 Ga0209676_1000369 Ga0209676_100036980 291
216 3300025292 Ga0209676_1001140 Ga0209676_10011405 291
217 3300025292 Ga0209676_1003514 Ga0209676_10035143 291
218 3300025292 Ga0209676_1004051 Ga0209676_10040513 291
219 3300025298 Ga0209050_1000070 Ga0209050_1000070284 291
220 3300025298 Ga0209050_1000235 Ga0209050_1000235111 291
221 3300025298 Ga0209050_1000380 Ga0209050_100038080 291
222 3300025298 Ga0209050_1001241 Ga0209050_10012413 291
223 3300025303 Ga0209051_1000086 Ga0209051_1000086117 291
224 3300025303 Ga0209051_1000123 Ga0209051_10001235 291
225 3300025303 Ga0209051_1001064 Ga0209051_100106418 291
226 3300025303 Ga0209051_1036421 Ga0209051_10364212 291
227 3300025303 Ga0209051_1051857 Ga0209051_10518571 291
228 3300025304 Ga0209257_1000421 Ga0209257_100042180 291
229 3300025304 Ga0209257_1010774 Ga0209257_10107742 291
230 3300025321 Ga0207656_10000094 Ga0207656_100000943 291
231 3300025711 Ga0207696_1000025 Ga0207696_1000025295 291
232 3300025711 Ga0207696_1000161 Ga0207696_100016136 291
233 3300025711 Ga0207696_1000399 Ga0207696_100039928 291
234 3300025711 Ga0207696_1002704 Ga0207696_10027045 291
235 3300025711 Ga0207696_1004662 Ga0207696_10046627 291
236 3300025711 Ga0207696_1010679 Ga0207696_10106792 291
237 3300025728 Ga0207655_1000113 Ga0207655_100011357 291
238 3300025728 Ga0207655_1000269 Ga0207655_100026931 291
239 3300025728 Ga0207655_1000976 Ga0207655_10009767 291
240 3300025728 Ga0207655_1002157 Ga0207655_10021572 291
241 3300025728 Ga0207655_1003563 Ga0207655_10035638 291
242 3300025728 Ga0207655_1004512 Ga0207655_10045126 291
243 3300025728 Ga0207655_1011189 Ga0207655_10111892 291
244 3300025728 Ga0207655_1016647 Ga0207655_10166472 291
245 3300025728 Ga0207655_1065760 Ga0207655_10657601 291
246 3300025735 Ga0207713_1000102 Ga0207713_100010224 291
247 3300025735 Ga0207713_1000344 Ga0207713_10003445 291
248 3300025735 Ga0207713_1001819 Ga0207713_100181915 291
249 3300025735 Ga0207713_1002656 Ga0207713_10026566 291
250 3300025735 Ga0207713_1003166 Ga0207713_10031662 291
251 3300025735 Ga0207713_1005358 Ga0207713_10053588 291
252 3300025735 Ga0207713_1006303 Ga0207713_10063034 291
253 3300025735 Ga0207713_1006787 Ga0207713_10067873 291
254 3300025735 Ga0207713_1021584 Ga0207713_10215843 291
255 3300025735 Ga0207713_1035118 Ga0207713_10351181 291
256 3300025914 Ga0207671_10001551 Ga0207671_1000155117 291
257 3300025920 Ga0207649_10000061 Ga0207649_1000006183 291
258 3300025923 Ga0207681_10013490 Ga0207681_100134902 291
259 3300025925 Ga0207650_10000419 Ga0207650_1000041912 291
260 3300025925 Ga0207650_10001683 Ga0207650_1000168310 291
261 3300025933 Ga0207706_10000668 Ga0207706_1000066825 291
262 3300025934 Ga0207686_10002078 Ga0207686_100020789 291
263 3300025935 Ga0207709_10000223 Ga0207709_100002237 291
264 3300025935 Ga0207709_10000835 Ga0207709_1000083514 291
265 3300025935 Ga0207709_10030251 Ga0207709_100302513 291
266 3300025935 Ga0207709_10049445 Ga0207709_100494452 291
267 3300025945 Ga0207679_10000018 Ga0207679_10000018208 291
268 3300025981 Ga0207640_10018613 Ga0207640_100186132 291
269 3300026041 Ga0207639_10016158 Ga0207639_100161582 291
270 3300027111 Ga0209281_1000010 Ga0209281_1000010561 291
271 3300027111 Ga0209281_1000331 Ga0209281_100033167 291
272 3300027111 Ga0209281_1002825 Ga0209281_10028254 291
273 3300027312 Ga0209371_1000365 Ga0209371_100036511 291
274 3300027907 Ga0207428_10021464 Ga0207428_100214646 291
275 3300027907 Ga0207428_10026590 Ga0207428_100265903 291
276 3300027907 Ga0207428_10105296 Ga0207428_101052963 291
277 3300027907 Ga0207428_10133142 Ga0207428_101331422 291
278 3300027907 Ga0207428_10242544 Ga0207428_102425441 291
279 3300030500 Ga0268256_1000236 Ga0268256_100023620 291
280 3300030733 Ga0314311_1137078 Ga0314311_11370782 291
281 3300030735 Ga0316178_1174406 Ga0316178_117440612 291
282 3300031548 Ga0307408_100000025 Ga0307408_10000002546 291
283 3300031548 Ga0307408_100036272 Ga0307408_1000362724 291
284 3300031548 Ga0307408_100144895 Ga0307408_1001448951 291
285 3300031730 Ga0307516_10194648 Ga0307516_101946482 291
286 3300031731 Ga0307405_10040867 Ga0307405_100408672 291
287 3300031911 Ga0307412_10115724 Ga0307412_101157243 291
288 3300031911 Ga0307412_10325564 Ga0307412_103255641 291
289 3300031995 Ga0307409_100026395 Ga0307409_1000263955 291
290 3300032004 Ga0307414_10062721 Ga0307414_100627212 291
291 3300032004 Ga0307414_10096469 Ga0307414_100964692 291
292 3300038705 Ga0237819_00881 Ga0237819_00881_591_1466 291
293 3300039450 Ga0436363_0138769 Ga0436363_0138769_716_1678 291
294 3300041405 Ga0439438_005853 Ga0439438_005853_3420_4295 291
295 3300041405 Ga0439438_010670 Ga0439438_010670_1965_2840 291
296 3300041405 Ga0439438_025483 Ga0439438_025483_130_1005 291
297 3300041407 Ga0439447_006010 Ga0439447_006010_2979_3854 291
298 3300041407 Ga0439447_010708 Ga0439447_010708_1479_2354 291
299 3300041407 Ga0439447_029585 Ga0439447_029585_55_930 291
300 3300041407 Ga0439447_033238 Ga0439447_033238_140_1015 291
301 3300041411 Ga0439466_0014226 Ga0439466_0014226_1464_2339 291
302 3300041411 Ga0439466_0024300 Ga0439466_0024300_558_1433 291
303 3300041997 Ga0439431_0004367 Ga0439431_0004367_142_1017 291
304 3300042000 Ga0439437_000520 Ga0439437_000520_1167_2129 291
305 3300042003 Ga0439443_002718 Ga0439443_002718_93_1055 291
306 3300042006 Ga0439432_007415 Ga0439432_007415_158_1033 291
307 3300042006 Ga0439432_018956 Ga0439432_018956_1262_2137 291
308 3300042006 Ga0439432_021257 Ga0439432_021257_1095_2057 291
309 3300042006 Ga0439432_031308 Ga0439432_031308_119_994 291
310 3300042010 Ga0439452_000667 Ga0439452_000667_15751_16626 291
311 3300042010 Ga0439452_011937 Ga0439452_011937_1091_1966 291
312 3300042010 Ga0439452_016034 Ga0439452_016034_544_1419 291
313 3300042010 Ga0439452_018731 Ga0439452_018731_561_1523 291
314 3300042010 Ga0439452_034005 Ga0439452_034005_132_1007 291
315 3300042013 Ga0439456_000315 Ga0439456_000315_1131_2006 291
316 3300042013 Ga0439456_012132 Ga0439456_012132_290_1177 291
317 3300042013 Ga0439456_014249 Ga0439456_014249_715_1590 291
318 3300042016 Ga0439463_003312 Ga0439463_003312_1386_2273 291
319 3300042115 Ga0450911_000017 Ga0450911_000017_81342_82304 291
320 3300042115 Ga0450911_002369 Ga0450911_002369_2597_3472 291
321 3300042115 Ga0450911_008410 Ga0450911_008410_207_1094 291
322 3300042117 Ga0450913_001977 Ga0450913_001977_97_1059 291
323 3300042137 Ga0450902_008097 Ga0450902_008097_26_901 291
324 3300042138 Ga0450903_005766 Ga0450903_005766_522_1397 291
325 3300042139 Ga0450904_000166 Ga0450904_000166_10984_11946 291
326 3300042139 Ga0450904_002326 Ga0450904_002326_397_1284 291
327 3300042139 Ga0450904_005246 Ga0450904_005246_49_924 291
328 3300042145 Ga0450906_004046 Ga0450906_004046_178_1140 291
329 3300042146 Ga0450907_000439 Ga0450907_000439_1255_2130 291
330 3300042147 Ga0450910_000985 Ga0450910_000985_2420_3295 291
331 3300042156 Ga0439446_0059653 Ga0439446_0059653_43_918 291
332 3300042435 Ga0439434_0009636 Ga0439434_0009636_1038_1913 291
333 3300042435 Ga0439434_0044252 Ga0439434_0044252_409_1284 291
334 3300042438 Ga0439459_0000879 Ga0439459_0000879_1365_2327 291
335 3300042439 Ga0439464_0006527 Ga0439464_0006527_697_1683 291
336 3300042439 Ga0439464_0018885 Ga0439464_0018885_790_1776 291
337 3300042461 Ga0439460_0001955 Ga0439460_0001955_3143_4018 291
338 3300042530 Ga0450916_000791 Ga0450916_000791_1697_2659 291
339 3300042532 Ga0450893_0001272 Ga0450893_0001272_1086_2048 291
340 3300042876 Ga0451577_0033401 Ga0451577_0033401_254_1216 291
341 3300042993 Ga0439440_0002330 Ga0439440_0002330_1477_2352 291
342 3300042993 Ga0439440_0043154 Ga0439440_0043154_219_1094 291
343 3300046452 Ga0495617_009670 Ga0495617_009670_717_1592 291
344 3300046452 Ga0495617_009807 Ga0495617_009807_1854_2729 291
345 3300046453 Ga0495627_000040 Ga0495627_000040_87895_88857 291
346 3300046453 Ga0495627_001207 Ga0495627_001207_1278_2153 291
347 3300046453 Ga0495627_009066 Ga0495627_009066_747_1709 291
348 3300046453 Ga0495627_014002 Ga0495627_014002_1843_2718 291
349 3300046453 Ga0495627_028094 Ga0495627_028094_390_1265 291
350 3300046455 Ga0495603_0017243 Ga0495603_0017243_1281_2156 291
351 3300046457 Ga0495590_0005676 Ga0495590_0005676_39_914 291
352 3300046457 Ga0495590_0009911 Ga0495590_0009911_903_1778 291
353 3300046457 Ga0495590_0025595 Ga0495590_0025595_1184_2059 291
354 3300046457 Ga0495590_0037316 Ga0495590_0037316_563_1438 291
355 3300046458 Ga0495591_000023 Ga0495591_000023_90548_91510 291
356 3300046458 Ga0495591_001720 Ga0495591_001720_7175_8137 291
357 3300046458 Ga0495591_002767 Ga0495591_002767_8428_9429 291
358 3300046458 Ga0495591_007086 Ga0495591_007086_3649_4524 291
359 3300046458 Ga0495591_008921 Ga0495591_008921_1027_1989 291
360 3300046458 Ga0495591_016013 Ga0495591_016013_1490_2365 291
361 3300046460 Ga0495638_0023429 Ga0495638_0023429_2898_3860 291
362 3300046460 Ga0495638_0026283 Ga0495638_0026283_2641_3516 291
363 3300046460 Ga0495638_0044887 Ga0495638_0044887_1441_2316 291
364 3300046460 Ga0495638_0095137 Ga0495638_0095137_748_1623 291
365 3300046460 Ga0495638_0101843 Ga0495638_0101843_318_1280 291
366 3300046460 Ga0495638_0117272 Ga0495638_0117272_342_1304 291
367 3300046460 Ga0495638_0222737 Ga0495638_0222737_98_973 291
368 3300046463 Ga0495653_0001688 Ga0495653_0001688_395_1282 291
369 3300046463 Ga0495653_0075011 Ga0495653_0075011_1398_2273 291
370 3300046463 Ga0495653_0109414 Ga0495653_0109414_354_1241 291
371 3300046463 Ga0495653_0153470 Ga0495653_0153470_174_1049 291
372 3300046471 Ga0495650_0001179 Ga0495650_0001179_10901_11863 291
373 3300046471 Ga0495650_0021310 Ga0495650_0021310_373_1248 291
374 3300046471 Ga0495650_0023543 Ga0495650_0023543_383_1345 291
375 3300046471 Ga0495650_0024731 Ga0495650_0024731_348_1223 291
376 3300046471 Ga0495650_0036242 Ga0495650_0036242_584_1546 291
377 3300046471 Ga0495650_0096008 Ga0495650_0096008_86_961 291
378 3300046474 Ga0495605_0000048 Ga0495605_0000048_80505_81467 291
379 3300046474 Ga0495605_0000094 Ga0495605_0000094_62830_63792 291
380 3300046474 Ga0495605_0001067 Ga0495605_0001067_1367_2329 291
381 3300046474 Ga0495605_0002988 Ga0495605_0002988_810_1772 291
382 3300046474 Ga0495605_0005577 Ga0495605_0005577_474_1499 291
383 3300046474 Ga0495605_0019091 Ga0495605_0019091_1889_2764 291
384 3300046474 Ga0495605_0027745 Ga0495605_0027745_264_1139 291
385 3300046474 Ga0495605_0030595 Ga0495605_0030595_1215_2177 291
386 3300046474 Ga0495605_0082438 Ga0495605_0082438_177_1052 291
387 3300046475 Ga0495639_0014215 Ga0495639_0014215_609_1484 291
388 3300046491 Ga0495584_0019852 Ga0495584_0019852_148_1023 291
389 3300046491 Ga0495584_0038569 Ga0495584_0038569_828_1703 291
390 3300046491 Ga0495584_0058589 Ga0495584_0058589_407_1282 291
391 3300046491 Ga0495584_0150297 Ga0495584_0150297_150_1025 291
392 3300046492 Ga0495585_0028644 Ga0495585_0028644_1624_2520 291
393 3300046492 Ga0495585_0033388 Ga0495585_0033388_191_1066 291
394 3300046492 Ga0495585_0038594 Ga0495585_0038594_195_1070 291
395 3300046492 Ga0495585_0053125 Ga0495585_0053125_40_915 291
396 3300046492 Ga0495585_0105470 Ga0495585_0105470_195_1070 291
397 3300046500 Ga0495596_0001228 Ga0495596_0001228_12352_13227 291
398 3300046500 Ga0495596_0002112 Ga0495596_0002112_467_1429 291
399 3300046500 Ga0495596_0063070 Ga0495596_0063070_62_937 291
400 3300046501 Ga0495607_0000893 Ga0495607_0000893_6524_7486 291
401 3300046501 Ga0495607_0000972 Ga0495607_0000972_8557_9519 291
402 3300046501 Ga0495607_0001113 Ga0495607_0001113_16246_17208 291
403 3300046501 Ga0495607_0001564 Ga0495607_0001564_1307_2269 291
404 3300046501 Ga0495607_0007321 Ga0495607_0007321_20_982 291
405 3300046501 Ga0495607_0009646 Ga0495607_0009646_931_1893 291
406 3300046501 Ga0495607_0011176 Ga0495607_0011176_453_1328 291
407 3300046501 Ga0495607_0016917 Ga0495607_0016917_2525_3400 291
408 3300046501 Ga0495607_0019252 Ga0495607_0019252_2809_3684 291
409 3300046501 Ga0495607_0021308 Ga0495607_0021308_2841_3803 291
410 3300046501 Ga0495607_0039860 Ga0495607_0039860_1821_2783 291
411 3300046501 Ga0495607_0042425 Ga0495607_0042425_505_1380 291
412 3300046501 Ga0495607_0064024 Ga0495607_0064024_384_1280 291
413 3300046501 Ga0495607_0084220 Ga0495607_0084220_729_1691 291
414 3300046501 Ga0495607_0087591 Ga0495607_0087591_235_1110 291
415 3300046501 Ga0495607_0096301 Ga0495607_0096301_82_957 291
416 3300046501 Ga0495607_0172485 Ga0495607_0172485_28_903 291
417 3300046501 Ga0495607_0191470 Ga0495607_0191470_69_956 291
418 3300046506 Ga0495583_0000096 Ga0495583_0000096_66657_67619 291
419 3300046506 Ga0495583_0002375 Ga0495583_0002375_8404_9366 291
420 3300046506 Ga0495583_0004233 Ga0495583_0004233_8092_9054 291
421 3300046506 Ga0495583_0004686 Ga0495583_0004686_1400_2275 291
422 3300046506 Ga0495583_0004830 Ga0495583_0004830_1568_2530 291
423 3300046506 Ga0495583_0008065 Ga0495583_0008065_189_1151 291
424 3300046506 Ga0495583_0023222 Ga0495583_0023222_2170_3132 291
425 3300046506 Ga0495583_0031157 Ga0495583_0031157_210_1085 291
426 3300046507 Ga0495606_0000076 Ga0495606_0000076_107658_108620 291
427 3300046507 Ga0495606_0000167 Ga0495606_0000167_15168_16193 291
428 3300046507 Ga0495606_0000608 Ga0495606_0000608_46211_47212 291
429 3300046507 Ga0495606_0003580 Ga0495606_0003580_855_1742 291
430 3300046507 Ga0495606_0020781 Ga0495606_0020781_3909_4784 291
431 3300046507 Ga0495606_0029098 Ga0495606_0029098_2035_2997 291
432 3300046507 Ga0495606_0031245 Ga0495606_0031245_123_998 291
433 3300046507 Ga0495606_0035413 Ga0495606_0035413_1589_2464 291
434 3300046507 Ga0495606_0044791 Ga0495606_0044791_95_970 291
435 3300046507 Ga0495606_0060369 Ga0495606_0060369_605_1480 291
436 3300046507 Ga0495606_0071520 Ga0495606_0071520_42_1004 291
437 3300046507 Ga0495606_0105579 Ga0495606_0105579_47_922 291
438 3300046512 Ga0495610_0003673 Ga0495610_0003673_2682_3644 291
439 3300046512 Ga0495610_0029882 Ga0495610_0029882_81_956 291
440 3300046512 Ga0495610_0034875 Ga0495610_0034875_192_1067 291
441 3300046512 Ga0495610_0042094 Ga0495610_0042094_400_1275 291
442 3300046512 Ga0495610_0042670 Ga0495610_0042670_744_1706 291
443 3300046512 Ga0495610_0045081 Ga0495610_0045081_192_1067 291
444 3300046513 Ga0495616_0001347 Ga0495616_0001347_16148_17110 291
445 3300046513 Ga0495616_0010197 Ga0495616_0010197_4457_5419 291
446 3300046513 Ga0495616_0014233 Ga0495616_0014233_299_1174 291
447 3300046513 Ga0495616_0026394 Ga0495616_0026394_611_1486 291
448 3300046513 Ga0495616_0043632 Ga0495616_0043632_1275_2150 291
449 3300046513 Ga0495616_0044749 Ga0495616_0044749_83_958 291
450 3300046513 Ga0495616_0055653 Ga0495616_0055653_889_1764 291
451 3300046513 Ga0495616_0056399 Ga0495616_0056399_516_1391 291
452 3300046513 Ga0495616_0106807 Ga0495616_0106807_252_1214 291
453 3300046515 Ga0495620_0000001 Ga0495620_0000001_31706_32668 291
454 3300046515 Ga0495620_0000003 Ga0495620_0000003_288353_289315 291
455 3300046515 Ga0495620_0000736 Ga0495620_0000736_1466_2428 291
456 3300046515 Ga0495620_0001383 Ga0495620_0001383_5046_6008 291
457 3300046515 Ga0495620_0010185 Ga0495620_0010185_3184_4146 291
458 3300046515 Ga0495620_0020358 Ga0495620_0020358_512_1387 291
459 3300046515 Ga0495620_0022320 Ga0495620_0022320_416_1378 291
460 3300046515 Ga0495620_0068247 Ga0495620_0068247_327_1202 291
461 3300046515 Ga0495620_0071961 Ga0495620_0071961_66_1028 291
462 3300046515 Ga0495620_0077028 Ga0495620_0077028_419_1294 291
463 3300046518 Ga0495631_0011216 Ga0495631_0011216_1770_2645 291
464 3300046518 Ga0495631_0013811 Ga0495631_0013811_1342_2304 291
465 3300046518 Ga0495631_0037631 Ga0495631_0037631_468_1343 291
466 3300046518 Ga0495631_0041744 Ga0495631_0041744_1025_1987 291
467 3300046519 Ga0495632_0001293 Ga0495632_0001293_1044_2006 291
468 3300046519 Ga0495632_0009098 Ga0495632_0009098_357_1232 291
469 3300046519 Ga0495632_0018573 Ga0495632_0018573_972_1934 291
470 3300046519 Ga0495632_0026907 Ga0495632_0026907_1940_2902 291
471 3300046519 Ga0495632_0027921 Ga0495632_0027921_33_995 291
472 3300046519 Ga0495632_0032968 Ga0495632_0032968_1535_2497 291
473 3300046519 Ga0495632_0048392 Ga0495632_0048392_119_994 291
474 3300046519 Ga0495632_0060055 Ga0495632_0060055_899_1774 291
475 3300046519 Ga0495632_0068125 Ga0495632_0068125_729_1604 291
476 3300046519 Ga0495632_0071228 Ga0495632_0071228_671_1546 291
477 3300046519 Ga0495632_0106812 Ga0495632_0106812_268_1143 291
478 3300046519 Ga0495632_0117266 Ga0495632_0117266_258_1133 291
479 3300046520 Ga0495637_0000583 Ga0495637_0000583_23370_24332 291
480 3300046520 Ga0495637_0006191 Ga0495637_0006191_357_1232 291
481 3300046520 Ga0495637_0008837 Ga0495637_0008837_55_930 291
482 3300046520 Ga0495637_0009658 Ga0495637_0009658_2218_3219 291
483 3300046520 Ga0495637_0010701 Ga0495637_0010701_785_1747 291
484 3300046520 Ga0495637_0019602 Ga0495637_0019602_283_1245 291
485 3300046520 Ga0495637_0023730 Ga0495637_0023730_1176_2138 291
486 3300046520 Ga0495637_0027828 Ga0495637_0027828_548_1423 291
487 3300046520 Ga0495637_0034806 Ga0495637_0034806_874_1836 291
488 3300046520 Ga0495637_0042478 Ga0495637_0042478_116_991 291
489 3300046520 Ga0495637_0051564 Ga0495637_0051564_393_1268 291
490 3300046520 Ga0495637_0064442 Ga0495637_0064442_128_1003 291
491 3300046520 Ga0495637_0117289 Ga0495637_0117289_79_954 291
492 3300046522 Ga0495643_0000673 Ga0495643_0000673_16902_17864 291
493 3300046522 Ga0495643_0000785 Ga0495643_0000785_8674_9636 291
494 3300046522 Ga0495643_0011714 Ga0495643_0011714_3642_4604 291
495 3300046522 Ga0495643_0034692 Ga0495643_0034692_1803_2678 291
496 3300046522 Ga0495643_0070369 Ga0495643_0070369_407_1282 291
497 3300046522 Ga0495643_0140461 Ga0495643_0140461_200_1075 291
498 3300046522 Ga0495643_0169472 Ga0495643_0169472_20_982 291
499 3300046523 Ga0495644_0005422 Ga0495644_0005422_1163_2164 291
500 3300046523 Ga0495644_0016173 Ga0495644_0016173_258_1133 291
501 3300046523 Ga0495644_0020076 Ga0495644_0020076_899_1774 291
502 3300046523 Ga0495644_0027817 Ga0495644_0027817_747_1709 291
503 3300046524 Ga0495648_0008068 Ga0495648_0008068_6751_7713 291
504 3300046524 Ga0495648_0008743 Ga0495648_0008743_2490_3452 291
505 3300046524 Ga0495648_0019177 Ga0495648_0019177_1603_2565 291
506 3300046524 Ga0495648_0029004 Ga0495648_0029004_2697_3659 291
507 3300046524 Ga0495648_0030511 Ga0495648_0030511_941_1816 291
508 3300046524 Ga0495648_0041982 Ga0495648_0041982_1922_2854 291
509 3300046524 Ga0495648_0067821 Ga0495648_0067821_721_1596 291
510 3300046524 Ga0495648_0078373 Ga0495648_0078373_109_984 291
511 3300046524 Ga0495648_0078685 Ga0495648_0078685_734_1609 291
512 3300046524 Ga0495648_0083334 Ga0495648_0083334_43_918 291
513 3300046524 Ga0495648_0126020 Ga0495648_0126020_267_1229 291
514 3300046524 Ga0495648_0198136 Ga0495648_0198136_56_931 291
515 3300046526 Ga0495666_0019899 Ga0495666_0019899_69_1031 291
516 3300046526 Ga0495666_0119399 Ga0495666_0119399_203_1078 291
517 3300046528 Ga0495642_0001507 Ga0495642_0001507_1287_2162 291
518 3300046528 Ga0495642_0009207 Ga0495642_0009207_948_1823 291
519 3300046530 Ga0495654_0001425 Ga0495654_0001425_15505_16467 291
520 3300046530 Ga0495654_0003292 Ga0495654_0003292_8738_9700 291
521 3300046530 Ga0495654_0004160 Ga0495654_0004160_2868_3830 291
522 3300046530 Ga0495654_0015896 Ga0495654_0015896_255_1130 291
523 3300046530 Ga0495654_0018333 Ga0495654_0018333_12_944 291
524 3300046530 Ga0495654_0032304 Ga0495654_0032304_211_1086 291
525 3300046530 Ga0495654_0037006 Ga0495654_0037006_427_1302 291
526 3300046530 Ga0495654_0041036 Ga0495654_0041036_195_1070 291
527 3300046530 Ga0495654_0050130 Ga0495654_0050130_738_1613 291
528 3300046530 Ga0495654_0073257 Ga0495654_0073257_219_1181 291
529 3300046530 Ga0495654_0074100 Ga0495654_0074100_142_1104 291
530 3300046530 Ga0495654_0083276 Ga0495654_0083276_540_1472 291
531 3300046530 Ga0495654_0085444 Ga0495654_0085444_67_942 291
532 3300046536 Ga0495587_0097056 Ga0495587_0097056_524_1486 291
533 3300046536 Ga0495587_0250428 Ga0495587_0250428_90_965 291
534 3300046538 Ga0495609_0000012 Ga0495609_0000012_69347_70309 291
535 3300046538 Ga0495609_0000079 Ga0495609_0000079_109281_110243 291
536 3300046538 Ga0495609_0000799 Ga0495609_0000799_21218_22180 291
537 3300046538 Ga0495609_0020773 Ga0495609_0020773_2069_2944 291
538 3300046538 Ga0495609_0024870 Ga0495609_0024870_1808_2683 291
539 3300046538 Ga0495609_0109095 Ga0495609_0109095_170_1045 291
540 3300046542 Ga0495597_0000016 Ga0495597_0000016_84702_85664 291
541 3300046542 Ga0495597_0009148 Ga0495597_0009148_39_914 291
542 3300046542 Ga0495597_0015221 Ga0495597_0015221_1355_2317 291
543 3300046542 Ga0495597_0018427 Ga0495597_0018427_473_1348 291
544 3300046542 Ga0495597_0072903 Ga0495597_0072903_480_1442 291
545 3300046542 Ga0495597_0085496 Ga0495597_0085496_133_1095 291
546 3300046557 Ga0495622_0015164 Ga0495622_0015164_606_1481 291
547 3300046557 Ga0495622_0016356 Ga0495622_0016356_1949_2824 291
548 3300046558 Ga0495633_0000034 Ga0495633_0000034_117960_118922 291
549 3300046558 Ga0495633_0017328 Ga0495633_0017328_1762_2637 291
550 3300046558 Ga0495633_0024822 Ga0495633_0024822_308_1183 291
551 3300046558 Ga0495633_0096518 Ga0495633_0096518_21_908 291
552 3300046616 Ga0495668_0002256 Ga0495668_0002256_14746_15747 291
553 3300046616 Ga0495668_0023584 Ga0495668_0023584_1368_2243 291
554 3300046616 Ga0495668_0026859 Ga0495668_0026859_49_1011 291
555 3300046616 Ga0495668_0027121 Ga0495668_0027121_425_1387 291
556 3300046616 Ga0495668_0027373 Ga0495668_0027373_1249_2211 291
557 3300046616 Ga0495668_0225564 Ga0495668_0225564_47_922 291
558 3300046642 Ga0495634_0043592 Ga0495634_0043592_371_1333 291
559 3300046648 Ga0495611_0002095 Ga0495611_0002095_1373_2335 291
560 3300046648 Ga0495611_0003561 Ga0495611_0003561_147_1109 291
561 3300046648 Ga0495611_0004112 Ga0495611_0004112_670_1545 291
562 3300046648 Ga0495611_0040427 Ga0495611_0040427_263_1138 291
563 3300046660 Ga0495625_0000185 Ga0495625_0000185_88384_89346 291
564 3300046660 Ga0495625_0074759 Ga0495625_0074759_94_1056 291
565 3300046660 Ga0495625_0096238 Ga0495625_0096238_426_1301 291
566 3300046660 Ga0495625_0099653 Ga0495625_0099653_385_1260 291
567 3300046660 Ga0495625_0104960 Ga0495625_0104960_435_1397 291
568 3300046660 Ga0495625_0112061 Ga0495625_0112061_540_1502 291
569 3300046660 Ga0495625_0115766 Ga0495625_0115766_117_1079 291
570 3300046663 Ga0495635_0038697 Ga0495635_0038697_440_1402 291
571 3300046664 Ga0495659_0006501 Ga0495659_0006501_1967_2842 291
572 3300046664 Ga0495659_0010963 Ga0495659_0010963_258_1133 291
573 3300046665 Ga0495661_0000004 Ga0495661_0000004_487694_488656 291
574 3300046665 Ga0495661_0000028 Ga0495661_0000028_16012_16908 291
575 3300046665 Ga0495661_0000088 Ga0495661_0000088_80815_81816 291
576 3300046665 Ga0495661_0000146 Ga0495661_0000146_72308_73270 291
577 3300046665 Ga0495661_0006678 Ga0495661_0006678_214_1176 291
578 3300046665 Ga0495661_0007167 Ga0495661_0007167_6757_7719 291
579 3300046665 Ga0495661_0007616 Ga0495661_0007616_6473_7348 291
580 3300046665 Ga0495661_0033661 Ga0495661_0033661_1001_1876 291
581 3300046665 Ga0495661_0051739 Ga0495661_0051739_1090_2052 291
582 3300046665 Ga0495661_0064528 Ga0495661_0064528_441_1403 291
583 3300046665 Ga0495661_0113925 Ga0495661_0113925_486_1448 291
584 3300046679 Ga0495623_0042430 Ga0495623_0042430_562_1437 291
585 3300046684 Ga0495669_0016942 Ga0495669_0016942_1264_2139 291
586 3300046689 Ga0495613_0145210 Ga0495613_0145210_546_1433 291
587 3300046690 Ga0495624_0087188 Ga0495624_0087188_670_1557 291
588 3300046691 Ga0495670_0009810 Ga0495670_0009810_302_1177 291
589 3300046691 Ga0495670_0011441 Ga0495670_0011441_2977_3939 291
590 3300046691 Ga0495670_0093401 Ga0495670_0093401_43_918 291
591 3300046691 Ga0495670_0183475 Ga0495670_0183475_131_1093 291
592 3300046692 Ga0495671_0007977 Ga0495671_0007977_4872_5747 291
593 3300046692 Ga0495671_0026438 Ga0495671_0026438_165_1040 291
594 3300046692 Ga0495671_0026874 Ga0495671_0026874_629_1591 291
595 3300046692 Ga0495671_0033954 Ga0495671_0033954_1487_2362 291
596 3300046692 Ga0495671_0058828 Ga0495671_0058828_767_1642 291
597 3300046692 Ga0495671_0059785 Ga0495671_0059785_399_1274 291
598 3300046692 Ga0495671_0070706 Ga0495671_0070706_208_1170 291
599 3300046692 Ga0495671_0072743 Ga0495671_0072743_66_1028 291
600 3300046694 Ga0495649_0000445 Ga0495649_0000445_489_1451 291
601 3300046694 Ga0495649_0001861 Ga0495649_0001861_14165_15127 291
602 3300046694 Ga0495649_0018962 Ga0495649_0018962_520_1482 291
603 3300046694 Ga0495649_0034226 Ga0495649_0034226_951_1913 291
604 3300046694 Ga0495649_0041788 Ga0495649_0041788_419_1294 291
605 3300046694 Ga0495649_0047307 Ga0495649_0047307_1011_1886 291
606 3300046694 Ga0495649_0049862 Ga0495649_0049862_1286_2161 291
607 3300046694 Ga0495649_0055490 Ga0495649_0055490_387_1262 291
608 3300046694 Ga0495649_0083759 Ga0495649_0083759_255_1217 291
609 3300046694 Ga0495649_0085329 Ga0495649_0085329_518_1393 291
610 3300046694 Ga0495649_0089962 Ga0495649_0089962_592_1467 291
611 3300046694 Ga0495649_0103200 Ga0495649_0103200_509_1471 291
612 3300046794 Ga0495589_0002693 Ga0495589_0002693_2459_3421 291
613 3300046794 Ga0495589_0022642 Ga0495589_0022642_1841_2716 291
614 3300046794 Ga0495589_0032567 Ga0495589_0032567_1010_1885 291
615 3300046794 Ga0495589_0050517 Ga0495589_0050517_980_1855 291
616 3300046809 Ga0495600_0074118 Ga0495600_0074118_1111_1986 291
617 3300046809 Ga0495600_0104308 Ga0495600_0104308_273_1160 291
618 3300046810 Ga0495660_0003327 Ga0495660_0003327_165_1127 291
619 3300046810 Ga0495660_0006173 Ga0495660_0006173_4739_5701 291
620 3300046810 Ga0495660_0020264 Ga0495660_0020264_1170_2132 291
621 3300046810 Ga0495660_0032533 Ga0495660_0032533_1402_2364 291
622 3300046810 Ga0495660_0039041 Ga0495660_0039041_192_1067 291
623 3300046810 Ga0495660_0071840 Ga0495660_0071840_65_940 291
624 3300046810 Ga0495660_0079596 Ga0495660_0079596_654_1529 291
625 3300046810 Ga0495660_0091256 Ga0495660_0091256_94_969 291
626 3300046810 Ga0495660_0098328 Ga0495660_0098328_343_1218 291
627 3300046810 Ga0495660_0159451 Ga0495660_0159451_110_985 291
628 3300047317 Ga0495604_0074539 Ga0495604_0074539_986_1948 291
629 3300047317 Ga0495604_0163243 Ga0495604_0163243_429_1316 291
630 3300047320 Ga0495672_0001231 Ga0495672_0001231_18985_19860 291
631 3300047320 Ga0495672_0023814 Ga0495672_0023814_1447_2409 291
632 3300047320 Ga0495672_0026378 Ga0495672_0026378_702_1577 291
633 3300047320 Ga0495672_0028199 Ga0495672_0028199_1772_2647 291
634 3300047320 Ga0495672_0033814 Ga0495672_0033814_167_1129 291
635 3300047320 Ga0495672_0035798 Ga0495672_0035798_192_1067 291
636 3300047320 Ga0495672_0045498 Ga0495672_0045498_374_1336 291
637 3300047320 Ga0495672_0060894 Ga0495672_0060894_604_1479 291
638 3300047320 Ga0495672_0065070 Ga0495672_0065070_1144_2031 291
639 3300047320 Ga0495672_0084549 Ga0495672_0084549_180_1067 291
640 3300047321 Ga0495676_0000160 Ga0495676_0000160_43876_44877 291
641 3300047321 Ga0495676_0064969 Ga0495676_0064969_1659_2534 291
642 3300047321 Ga0495676_0295111 Ga0495676_0295111_71_958 291
643 3300047322 Ga0495680_0059649 Ga0495680_0059649_512_1474 291
644 3300047322 Ga0495680_0139795 Ga0495680_0139795_301_1188 291
645 3300047322 Ga0495680_0302553 Ga0495680_0302553_43_939 291
646 3300047323 Ga0495683_0000034 Ga0495683_0000034_81531_82493 291
647 3300047323 Ga0495683_0000216 Ga0495683_0000216_16018_16980 291
648 3300047323 Ga0495683_0010981 Ga0495683_0010981_3282_4157 291
649 3300047323 Ga0495683_0022020 Ga0495683_0022020_736_1611 291
650 3300047323 Ga0495683_0051853 Ga0495683_0051853_965_1927 291
651 3300047323 Ga0495683_0089758 Ga0495683_0089758_134_1009 291
652 3300047323 Ga0495683_0129158 Ga0495683_0129158_246_1121 291
653 3300047443 Ga0495687_019903 Ga0495687_019903_533_1408 291
654 3300047445 Ga0495677_0030674 Ga0495677_0030674_1018_1893 291
655 3300047446 Ga0495679_000377 Ga0495679_000377_1502_2464 291
656 3300047446 Ga0495679_014863 Ga0495679_014863_92_1054 291
657 3300047446 Ga0495679_015263 Ga0495679_015263_296_1171 291
658 3300047446 Ga0495679_015573 Ga0495679_015573_96_971 291
659 3300047446 Ga0495679_021050 Ga0495679_021050_92_967 291
660 3300047446 Ga0495679_024414 Ga0495679_024414_762_1637 291
661 3300047446 Ga0495679_031583 Ga0495679_031583_151_1113 291
662 3300047447 Ga0495685_031430 Ga0495685_031430_202_1077 291
663 3300047469 Ga0495673_0002712 Ga0495673_0002712_10841_11716 291
664 3300047469 Ga0495673_0006452 Ga0495673_0006452_541_1566 291
665 3300047469 Ga0495673_0010072 Ga0495673_0010072_1309_2271 291
666 3300047469 Ga0495673_0015923 Ga0495673_0015923_2603_3478 291
667 3300047469 Ga0495673_0016934 Ga0495673_0016934_1042_1917 291
668 3300047469 Ga0495673_0033689 Ga0495673_0033689_1331_2206 291
669 3300047469 Ga0495673_0036706 Ga0495673_0036706_1289_2221 291
670 3300047469 Ga0495673_0037163 Ga0495673_0037163_66_1028 291
671 3300047469 Ga0495673_0040815 Ga0495673_0040815_682_1557 291
672 3300047469 Ga0495673_0042642 Ga0495673_0042642_686_1711 291
673 3300047469 Ga0495673_0048050 Ga0495673_0048050_766_1641 291
674 3300047469 Ga0495673_0055315 Ga0495673_0055315_443_1405 291
675 3300047469 Ga0495673_0069862 Ga0495673_0069862_105_1067 291
676 3300047469 Ga0495673_0087283 Ga0495673_0087283_241_1116 291
677 3300047470 Ga0495681_0009159 Ga0495681_0009159_4894_5769 291
678 3300047470 Ga0495681_0013039 Ga0495681_0013039_3489_4490 291
679 3300047470 Ga0495681_0021377 Ga0495681_0021377_2162_3037 291
680 3300047470 Ga0495681_0025854 Ga0495681_0025854_165_1127 291
681 3300047470 Ga0495681_0030486 Ga0495681_0030486_416_1378 291
682 3300047470 Ga0495681_0042194 Ga0495681_0042194_554_1429 291
683 3300047470 Ga0495681_0044007 Ga0495681_0044007_184_1059 291
684 3300047470 Ga0495681_0075821 Ga0495681_0075821_67_1029 291
685 3300047470 Ga0495681_0079196 Ga0495681_0079196_162_1124 291
686 3300047471 Ga0495684_0146740 Ga0495684_0146740_656_1531 291
687 3300047472 Ga0495686_0011832 Ga0495686_0011832_1290_2291 291
688 3300047472 Ga0495686_0029647 Ga0495686_0029647_505_1380 291
689 3300047472 Ga0495686_0099960 Ga0495686_0099960_57_932 291
690 3300047472 Ga0495686_0167550 Ga0495686_0167550_16_978 291
691 3300047673 Ga0495593_0035166 Ga0495593_0035166_1550_2425 291
692 3300047673 Ga0495593_0060514 Ga0495593_0060514_805_1692 291
693 3300048088 Ga0495602_0163305 Ga0495602_0163305_298_1185 291
694 3300048091 Ga0495626_0000125 Ga0495626_0000125_36448_37449 291
695 3300048091 Ga0495626_0001796 Ga0495626_0001796_13613_14575 291
696 3300048091 Ga0495626_0004821 Ga0495626_0004821_2911_3786 291
697 3300048091 Ga0495626_0019437 Ga0495626_0019437_580_1455 291
698 3300048091 Ga0495626_0019580 Ga0495626_0019580_1536_2411 291
699 3300048091 Ga0495626_0026534 Ga0495626_0026534_1276_2151 291
700 3300048091 Ga0495626_0037187 Ga0495626_0037187_492_1367 291
701 3300048091 Ga0495626_0047813 Ga0495626_0047813_428_1303 291
702 3300048091 Ga0495626_0063581 Ga0495626_0063581_75_950 291
703 3300048091 Ga0495626_0077874 Ga0495626_0077874_479_1354 291
704 3300048905 Ga0496102_0065015 Ga0496102_0065015_595_1470 291
705 3300048905 Ga0496102_0208392 Ga0496102_0208392_533_1495 291
706 3300048913 Ga0496110_0049992 Ga0496110_0049992_1674_2636 291
707 3300048913 Ga0496110_0175404 Ga0496110_0175404_1003_1878 291
708 3300048919 Ga0496116_0001043 Ga0496116_0001043_26220_27182 291
709 3300048919 Ga0496116_0004638 Ga0496116_0004638_726_1601 291
710 3300048919 Ga0496116_0018663 Ga0496116_0018663_100_1125 291
711 3300048919 Ga0496116_0069705 Ga0496116_0069705_1343_2218 291
712 3300048919 Ga0496116_0100650 Ga0496116_0100650_152_1039 291
713 3300048919 Ga0496116_0142693 Ga0496116_0142693_159_1121 291
714 3300048920 Ga0496117_0047000 Ga0496117_0047000_1012_2037 291
715 3300048920 Ga0496117_0050821 Ga0496117_0050821_1760_2635 291
716 3300048920 Ga0496117_0053566 Ga0496117_0053566_615_1577 291
717 3300048920 Ga0496117_0067336 Ga0496117_0067336_1494_2369 291
718 3300048920 Ga0496117_0086027 Ga0496117_0086027_720_1682 291
719 3300048920 Ga0496117_0091099 Ga0496117_0091099_313_1188 291
720 3300048920 Ga0496117_0094012 Ga0496117_0094012_666_1553 291
721 3300048921 Ga0496118_0044010 Ga0496118_0044010_571_1533 291
722 3300048921 Ga0496118_0071816 Ga0496118_0071816_1539_2414 291
723 3300048921 Ga0496118_0086981 Ga0496118_0086981_256_1131 291
724 3300048921 Ga0496118_0144446 Ga0496118_0144446_52_1014 291
725 3300048921 Ga0496118_0181456 Ga0496118_0181456_40_1002 291
726 3300048923 Ga0496120_0122213 Ga0496120_0122213_91_978 291
727 3300048923 Ga0496120_0142244 Ga0496120_0142244_226_1101 291
728 3300048924 Ga0496121_0002337 Ga0496121_0002337_27762_28787 291
729 3300048924 Ga0496121_0004179 Ga0496121_0004179_12181_13143 291
730 3300048924 Ga0496121_0038182 Ga0496121_0038182_2199_3161 291
731 3300048924 Ga0496121_0097272 Ga0496121_0097272_175_1050 291
732 3300048925 Ga0496122_0021670 Ga0496122_0021670_4633_5595 291
733 3300048925 Ga0496122_0026521 Ga0496122_0026521_1629_2591 291
734 3300048925 Ga0496122_0046468 Ga0496122_0046468_1933_2808 291
735 3300048925 Ga0496122_0072157 Ga0496122_0072157_521_1546 291
736 3300048925 Ga0496122_0077118 Ga0496122_0077118_66_941 291
737 3300048925 Ga0496122_0164504 Ga0496122_0164504_271_1146 291
738 3300048926 Ga0496123_0001511 Ga0496123_0001511_1652_2614 291
739 3300048926 Ga0496123_0041688 Ga0496123_0041688_1790_2752 291
740 3300048926 Ga0496123_0059724 Ga0496123_0059724_1573_2448 291
741 3300048926 Ga0496123_0104605 Ga0496123_0104605_545_1507 291
742 3300048926 Ga0496123_0105572 Ga0496123_0105572_242_1117 291
743 3300048926 Ga0496123_0109509 Ga0496123_0109509_265_1152 291
744 3300048926 Ga0496123_0118448 Ga0496123_0118448_395_1420 291
745 3300048927 Ga0496124_0001524 Ga0496124_0001524_4387_5349 291
746 3300048927 Ga0496124_0001773 Ga0496124_0001773_1184_2209 291
747 3300048927 Ga0496124_0033048 Ga0496124_0033048_253_1128 291
748 3300048927 Ga0496124_0054267 Ga0496124_0054267_145_1107 291
749 3300048927 Ga0496124_0062509 Ga0496124_0062509_1589_2551 291
750 3300048927 Ga0496124_0063450 Ga0496124_0063450_1756_2631 291
751 3300048927 Ga0496124_0075351 Ga0496124_0075351_272_1147 291
752 3300048927 Ga0496124_0239997 Ga0496124_0239997_202_1077 291
753 3300048928 Ga0496125_0091942 Ga0496125_0091942_124_999 291
754 3300048928 Ga0496125_0115071 Ga0496125_0115071_976_1851 291
755 3300048928 Ga0496125_0165927 Ga0496125_0165927_520_1482 291
756 3300048928 Ga0496125_0231127 Ga0496125_0231127_218_1105 291
757 3300048929 Ga0496126_0092027 Ga0496126_0092027_130_1005 291
758 3300048929 Ga0496126_0125710 Ga0496126_0125710_264_1139 291
759 3300049459 Ga0495678_000049 Ga0495678_000049_96481_97443 291
760 3300049459 Ga0495678_000918 Ga0495678_000918_3126_4127 291
761 3300049459 Ga0495678_001783 Ga0495678_001783_7751_8713 291
762 3300049459 Ga0495678_016655 Ga0495678_016655_1857_2732 291
763 3300049459 Ga0495678_016849 Ga0495678_016849_20_982 291
764 3300049459 Ga0495678_017909 Ga0495678_017909_2206_3081 291
765 3300049459 Ga0495678_019253 Ga0495678_019253_195_1070 291
766 3300049459 Ga0495678_032576 Ga0495678_032576_734_1609 291
767 3300049459 Ga0495678_042946 Ga0495678_042946_402_1277 291
768 3300049459 Ga0495678_062025 Ga0495678_062025_337_1224 291
769 3300049459 Ga0495678_074266 Ga0495678_074266_168_1043 291
770 3300049459 Ga0495678_080216 Ga0495678_080216_60_935 291
771 3300049460 Ga0495682_0000153 Ga0495682_0000153_13769_14656 291
772 3300049460 Ga0495682_0004151 Ga0495682_0004151_1456_2481 291
773 3300049460 Ga0495682_0020304 Ga0495682_0020304_1332_2207 291
774 3300049460 Ga0495682_0042657 Ga0495682_0042657_439_1314 291
775 3300049460 Ga0495682_0065185 Ga0495682_0065185_86_961 291
776 3300049460 Ga0495682_0086038 Ga0495682_0086038_221_1096 291
777 3300049568 Ga0501031_0111953 Ga0501031_0111953_459_1421 291
778 3300049573 Ga0501037_0302412 Ga0501037_0302412_166_1098 291
779 3300049662 Ga0501222_004172 Ga0501222_004172_137_1012 291
780 3300049758 Ga0501241_004405 Ga0501241_004405_260_1135 291
781 3300049853 Ga0501226_000017 Ga0501226_000017_93368_94330 291
782 3300050491 nmdc:mga00v17_117429_c1 nmdc:mga00v17_117429_c1_112_987 291
783 3300053111 Ga0500572_004688 Ga0500572_004688_416_1291 291
784 3300053125 Ga0500618_025028 Ga0500618_025028_96_1058 291
785 3300053140 Ga0500573_0040451 Ga0500573_0040451_623_1585 291
786 iso_pu_bacteria 2510065053 2510285141 291
787 iso_pu_bacteria 2510065055 2510294022 291
788 iso_pu_bacteria 2510065058 2510313056 291
789 iso_pu_bacteria 2511231004 2511254580 291
790 iso_pu_bacteria 2511231006 2511266622 291
791 iso_pu_bacteria 2511231007 2511270760 291
792 iso_pu_bacteria 2511231008 2511276672 291
793 iso_pu_bacteria 2511231010 2511293035 291
794 iso_pu_bacteria 2511231011 2511296267 291
795 iso_pu_bacteria 2511231012 2511301895 291
796 iso_pu_bacteria 2511231015 2511321007 291
797 iso_pu_bacteria 2511231016 2511323983 291
798 iso_pu_bacteria 2511231017 2511331572 291
799 iso_pu_bacteria 2511231018 2511339038 291
800 iso_pu_bacteria 2511231019 2511345000 291
801 iso_pu_bacteria 2511231020 2511349346 291
802 iso_pu_bacteria 2511231021 2511356449 291
803 iso_pu_bacteria 2511231022 2511364427 291
804 iso_pu_bacteria 2511231023 2511370195 291
805 iso_pu_bacteria 2511231031 2511414636 291
806 iso_pu_bacteria 2511231156 2511826349 291
807 iso_pu_bacteria 2512047018 2512324148 291
808 iso_pu_bacteria 2554235341 2555671408 291
809 iso_pu_bacteria 2582580891 2583793818 291
810 iso_pu_bacteria 2597489887 2597859492 291
811 iso_pu_bacteria 2599185155 2599328589 291
812 iso_pu_bacteria 2599185160 2599354435 291
813 iso_pu_bacteria 2599185161 2599359851 291
814 iso_pu_bacteria 2599185162 2599366173 291
815 iso_pu_bacteria 2599185163 2599372963 291
816 iso_pu_bacteria 2599185164 2599379543 291
817 iso_pu_bacteria 2599185165 2599385479 291
818 iso_pu_bacteria 2599185166 2599391822 291
819 iso_pu_bacteria 2599185167 2599401751 291
820 iso_pu_bacteria 2599185168 2599403588 291
821 iso_pu_bacteria 2599185179 2599451604 291
822 iso_pu_bacteria 2599185181 2599461269 291
823 iso_pu_bacteria 2599185182 2599469813 291
824 iso_pu_bacteria 2599185185 2599482322 291
825 iso_pu_bacteria 2599185186 2599490289 291
826 iso_pu_bacteria 2599185188 2599504152 291
827 iso_pu_bacteria 2599185190 2599514995 291
828 iso_pu_bacteria 2599185191 2599521096 291
829 iso_pu_bacteria 2599185212 2599613438 291
830 iso_pu_bacteria 2599185248 2599772342 291
831 iso_pu_bacteria 2599185257 2599803959 291
832 iso_pu_bacteria 2599185288 2599882322 291
833 iso_pu_bacteria 2599185289 2599888936 291
834 iso_pu_bacteria 2599185290 2599894204 291
835 iso_pu_bacteria 2599185291 2599900565 291
836 iso_pu_bacteria 2599185300 2599935183 291
837 iso_pu_bacteria 2599185302 2599943961 291
838 iso_pu_bacteria 2599185303 2599952269 291
839 iso_pu_bacteria 2599185304 2599955827 291
840 iso_pu_bacteria 2599185305 2599961461 291
841 iso_pu_bacteria 2599185306 2599969861 291
842 iso_pu_bacteria 2599185307 2599974282 291
843 iso_pu_bacteria 2599185308 2599981469 291
844 iso_pu_bacteria 2599185309 2599985628 291
845 iso_pu_bacteria 2599185310 2599989551 291
846 iso_pu_bacteria 2599185311 2599994422 291
847 iso_pu_bacteria 2599185312 2600000103 291
848 iso_pu_bacteria 2599185313 2600009082 291
849 iso_pu_bacteria 2599185314 2600015290 291
850 iso_pu_bacteria 2599185315 2600019597 291
851 iso_pu_bacteria 2599185316 2600023716 291
852 iso_pu_bacteria 2599185317 2600032362 291
853 iso_pu_bacteria 2599185318 2600038805 291
854 iso_pu_bacteria 2599185319 2600044152 291
855 iso_pu_bacteria 2599185320 2600048358 291
856 iso_pu_bacteria 2599185321 2600054107 291
857 iso_pu_bacteria 2599185322 2600060327 291
858 iso_pu_bacteria 2599185323 2600066583 291
859 iso_pu_bacteria 2599185324 2600074366 291
860 iso_pu_bacteria 2599185325 2600078109 291
861 iso_pu_bacteria 2599185356 2600213885 291
862 iso_pu_bacteria 2600254930 2600361924 291
863 iso_pu_bacteria 2600254931 2600364396 291
864 iso_pu_bacteria 2600254954 2600443128 291
865 iso_pu_bacteria 2600255283 2601626575 291
866 iso_pu_bacteria 2600255313 2601774051 291
867 iso_pu_bacteria 2600255318 2601795595 291
868 iso_pu_bacteria 2600255389 2602009383 291
869 iso_pu_bacteria 2603880185 2606075664 291
870 iso_pu_bacteria 2603880199 2606128423 291
871 iso_pu_bacteria 2606217733 2608384633 291
872 iso_pu_bacteria 2619619299 2621300746 291
873 iso_pu_bacteria 2623620443 2624479533 291
874 iso_pu_bacteria 2623620446 2624493456 291
875 iso_pu_bacteria 2643221565 2643842742 291
876 iso_pu_bacteria 2643221589 2643952665 291
877 iso_pu_bacteria 2643221602 2644022427 291
878 iso_pu_bacteria 2643221633 2644187451 291
879 iso_pu_bacteria 2643221650 2644281828 291
880 iso_pu_bacteria 2651869719 2652544525 291
881 iso_pu_bacteria 2667528170 2671093226 291
882 iso_pu_bacteria 2667528171 2671097016 291
883 iso_pu_bacteria 2667528176 2671128910 291
884 iso_pu_bacteria 2671180172 2671770473 291
885 iso_pu_bacteria 2675903515 2678264698 291
886 iso_pu_bacteria 2713897148 2715753934 291
887 iso_pu_bacteria 2713897149 2715757799 291
888 iso_pu_bacteria 2718217725 2718633362 291
889 iso_pu_bacteria 2738541265 2738670636 291
890 iso_pu_bacteria 2738541271 2738691390 291
891 iso_pu_bacteria 2738541282 2738749029 291
892 iso_pu_bacteria 2738541294 2738812224 291
893 iso_pu_bacteria 2738541303 2738858071 291
894 iso_pu_bacteria 2738541309 2738899584 291
895 iso_pu_bacteria 2738543004 2739201234 291
896 iso_pu_bacteria 2738543015 2739262423 291
897 iso_pu_bacteria 2738543016 2739267165 291
898 iso_pu_bacteria 2738543020 2739286272 291
899 iso_pu_bacteria 2738543021 2739291585 291
900 iso_pu_bacteria 2738543025 2739316194 291
901 iso_pu_bacteria 2740892503 2743739022 291
902 iso_pu_bacteria 2744054620 2745005152 291
903 iso_pu_bacteria 2773857670 2774123429 291
904 iso_pu_bacteria 2773857672 2774128233 291
905 iso_pu_bacteria 2773857673 2774138423 291
906 iso_pu_bacteria 2784132072 2784316029 291
907 iso_pu_bacteria 2791355520 2794595040 291
908 iso_pu_bacteria 2808606361 2808857098 291
909 iso_pu_bacteria 2808606373 2808907254 291
910 iso_pu_bacteria 2808606376 2808926676 291
911 iso_pu_bacteria 2808606377 2808927462 291
912 iso_pu_bacteria 2808606378 2808937170 291
913 iso_pu_bacteria 2808606379 2808940647 291
914 iso_pu_bacteria 2808606380 2808948837 291
915 iso_pu_bacteria 2808606381 2808949999 291
916 iso_pu_bacteria 2808606382 2808957284 291
917 iso_pu_bacteria 2808606383 2808965486 291
918 iso_pu_bacteria 2808606385 2808980914 291
919 iso_pu_bacteria 2808606388 2808996638 291
920 iso_pu_bacteria 2808606389 2809000273 291
921 iso_pu_bacteria 2808606445 2809216476 291
922 iso_pu_bacteria 2811994881 2812368079 291
923 iso_pu_bacteria 2816332298 2817490014 291
924 iso_pu_bacteria 2818991456 2819654697 291
925 iso_pu_bacteria 2818991464 2819702110 291
926 iso_pu_bacteria 2823421272 2823424758 291
927 iso_pu_bacteria 2825651385 2825656415 291
928 iso_pu_bacteria 2826581358 2826584501 291
929 iso_pu_bacteria 2834028612 2834029819 291
930 iso_pu_bacteria 2842805378 2842805561 291
931 iso_pu_bacteria 2842815866 2842818055 291
932 iso_pu_bacteria 2842832357 2842832596 291
933 iso_pu_bacteria 2842849001 2842849309 291
934 iso_pu_bacteria 2842854478 2842856800 291
935 iso_pu_bacteria 2844665904 2844671928 291
936 iso_pu_bacteria 2852612431 2852617639 291
937 iso_pu_bacteria 2852657418 2852659019 291
938 iso_pu_bacteria 2852667396 2852672997 291
939 iso_pu_bacteria 2860339153 2860339918 291
940 iso_pu_bacteria 2880230671 2880232409 291
941 iso_pu_bacteria 2904518522 2904523900 291
942 iso_pu_bacteria 2908446538 2908448768 291
943 iso_pu_bacteria 2913036834 2913041172 291
944 iso_pu_bacteria 2917070673 2917075274 291
945 iso_pu_bacteria 2917832318 2917835417 291
946 iso_pu_bacteria 2919125081 2919129251 291
947 iso_pu_bacteria 2919385768 2919386500 291
948 iso_pu_bacteria 2919456309 2919457013 291
949 iso_pu_bacteria 2919481497 2919486066 291
950 iso_pu_bacteria 2919487758 2919491217 291
951 iso_pu_bacteria 2919501602 2919504484 291
952 iso_pu_bacteria 2923519811 2923522132 291
953 iso_pu_bacteria 2923586266 2923590156 291
954 iso_pu_bacteria 2926063275 2926064943 291
955 iso_pu_bacteria 2929144301 2929148625 291
956 iso_pu_bacteria 2931369376 2931373936 291
957 iso_pu_bacteria 2931390751 2931392890 291
958 iso_pu_bacteria 2931396565 2931400188 291
959 iso_pu_bacteria 2935353572 2935356262 291
960 iso_pu_bacteria 2939636861 2939639645 291
961 iso_pu_bacteria 2939651529 2939655843 291
962 iso_pu_bacteria 2945961074 2945965022 291
963 iso_pu_bacteria 2946006987 2946010962 291
964 iso_pu_bacteria 2969304461 2969306321 291
965 iso_pu_bacteria 2974289157 2974292025 291
966 iso_pu_bacteria 2974298342 2974299610 291
967 iso_pu_bacteria 2984286254 2984288077 291
968 iso_pu_bacteria 2984499530 2984501967 291
969 iso_pu_bacteria 2984504281 2984504534 291
970 iso_pu_bacteria 2988728565 2988730214 291
971 iso_pu_bacteria 2990196909 2990200195 291
972 iso_pu_bacteria 2998139840 2998141716 291
973 iso_pu_bacteria 3007252601 3007253446 291
974 iso_pu_bacteria 3007315729 3007317747 291
975 iso_pu_bacteria 3007395558 3007397404 291
976 iso_pu_bacteria 3007419365 3007424563 291
977 iso_pu_bacteria 3007511990 3007515670 291
978 iso_pu_bacteria 3007614139 3007618761 291
979 iso_pu_bacteria 3007619802 3007625501 291
980 iso_pu_bacteria 3007718800 3007719387 291
981 iso_pu_bacteria 3007855910 3007856307 291
982 iso_pu_bacteria 3007861166 3007863046 291
983 iso_pu_bacteria 3007866637 3007870557 291
984 iso_pu_bacteria 637000220 637321730 291
985 iso_pu_bacteria 8011350971 8011353882 291
986 iso_pu_bacteria 8015687852 8015692197 291
987 iso_pu_bacteria 8016728285 8016733658 291
988 iso_pu_bacteria 8019775933 8019776451 291
989 iso_pu_bacteria 8034962539 8034962735 291
990 iso_pu_bacteria 8054285046 8054285616 291
991 iso_pu_bacteria 8054503363 8054505387 291
992 iso_pu_bacteria 8055770955 8055775406 291
993 iso_pu_bacteria 8055817908 8055819956 291
994 iso_pu_bacteria 8056125926 8056130090 291
995 iso_pu_bacteria 8056131705 8056133726 291
996 iso_pu_bacteria 8056143049 8056144757 291
997 iso_pu_bacteria 8056155041 8056156134 291
998 iso_pu_bacteria 8056166840 8056169277 291
999 iso_pu_bacteria 8056172158 8056175464 291
1000 iso_pu_bacteria 8056177738 8056181240 291
1001 iso_pu_bacteria 8056569372 8056571449 291
1002 iso_pu_bacteria 8057798959 8057804222 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

167

291

0.91

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

43

126

0.89

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

200

334

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oby-assembly2.cif.gz_C crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9741 1 285
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9713 1 285
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9696 2 286
2oby-assembly2.cif.gz_C crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9511 1 285
4dup-assembly1.cif.gz_B crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9508 2 286
ID Description Score Start End Superfamily
af_A0A1D6HNQ2_3_340_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9785 1 286 3.90.180.10
af_C6TID4_1_124_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9759 4 89 3.90.180.10
af_Q4DAS0_3_129_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9747 4 88 3.90.180.10
af_A0A1D6HNQ2_126_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9678 89 242 3.40.50.720
af_Q75JT6_1_334_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9634 1 285 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A803NY03-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9824 1 286 GO:0016651
GO:0034045
GO:0070402
AF-A0A0S6UP13-F1-model_v4 Quinone oxidoreductase 0.9796 1 286 GO:0016651
GO:0070402
AF-A0A445BBA4-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9789 1 287 GO:0008270
GO:0016651
GO:0070402
AF-A0A7J6HSH9-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9786 1 289 GO:0016020
GO:0016651
GO:0070402
AF-A0A1B1BLD5-F1-model_v4 NADPH:quinone oxidoreductase 0.978 1 286 GO:0016651
GO:0070402

Feature Viewer

pLDDT pTM Quality
95.2 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map