F487907
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1002 | 450 | 781 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300015262|Ga0182007_10002759|Ga0182007_100027594 |
| Length | 341 |
| Sequence | MQESQVAFRRAGSVKTHYGGTVKALQGVEGQVVWADEPSPACDVGQVRIRVAAAGLNRADLLQKAGLYPPPPGASQVLGLECSGVISEVGPGSSWQVGDRVCALLAGGGMAEEVVVDGRHVLPVPEGLSLAEAAALPEVYGTAWLNLFQLAALKPGEKVLLHAGASGVGSAAIQLCKAFGNPCWVSVGSTDRLSYCEALGAQGGVVRTDGLESLNDLGPFDVILDPVGANYAQLNVKLLSVDGRWVLIGLMGGRSTELDLAQVLGKRIQLLGSTLRSRDEQFKANLISELGQQVWPLFADKRLSPQLAKTFAIKDAEAAFAELATNKVSGKVVLVIDELLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 4 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 5 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 6 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 7 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 8 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 9 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 10 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 11 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 12 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 13 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 14 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 15 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 16 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 17 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 18 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 19 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 20 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 21 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 22 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 23 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 24 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 25 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 26 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 27 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 28 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 29 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 30 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 31 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 32 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 33 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 34 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 35 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 36 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 37 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 38 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 39 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 40 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 41 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 42 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 43 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 44 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 45 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 46 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 47 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 48 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 49 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 50 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 51 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 52 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 53 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 54 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 55 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 56 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 57 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 58 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 59 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 60 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 61 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 62 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 63 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 64 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 65 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 66 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 67 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 68 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 69 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 70 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 71 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 72 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 73 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 74 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 75 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 76 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 77 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 78 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 79 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 80 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 81 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 82 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 83 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 84 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 85 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 86 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 87 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 88 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 89 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 90 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 91 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 92 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 93 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 94 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 95 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 96 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 97 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 98 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 99 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 100 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 101 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 102 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 103 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 104 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 105 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 106 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 107 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 108 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 109 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 110 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 111 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 112 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 113 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 114 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 115 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 116 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 117 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 118 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 119 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 120 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 121 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 122 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 123 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 124 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 125 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 126 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 127 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 128 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 129 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 130 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 131 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 132 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 133 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 134 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 135 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 136 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 137 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 138 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 139 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 140 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 141 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 142 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 143 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 144 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 145 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 146 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 147 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 148 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 149 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 150 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 151 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 152 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 153 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 154 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 155 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 156 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 157 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 158 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 159 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 160 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 161 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 162 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 163 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 164 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 165 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 166 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 167 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 168 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 169 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 170 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 171 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 172 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 173 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 174 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 175 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 176 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 177 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 178 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 179 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 180 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 181 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 182 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 183 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 184 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 185 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 186 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 187 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 188 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 189 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 190 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 191 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 192 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 193 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 194 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 195 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 196 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 197 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 198 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 199 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 200 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 201 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 202 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 203 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 204 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 205 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 206 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 207 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 208 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 209 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 210 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 211 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 212 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 213 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 214 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 215 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 216 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 217 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 218 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 219 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 220 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 221 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 227 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 229 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 230 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 231 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 232 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 233 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 234 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 235 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 236 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 244 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 246 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 254 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 255 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 256 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 257 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 267 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 268 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 270 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 293 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 295 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 296 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 297 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 298 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 299 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 300 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 301 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 302 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 303 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 304 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 305 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 306 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 307 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 308 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 309 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 310 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 311 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 312 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 313 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 314 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 315 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 316 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 317 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 318 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 319 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 320 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 321 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 322 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 323 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 324 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 325 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 326 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 327 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 328 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 329 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 330 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 331 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 332 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 333 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 334 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 335 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 336 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 337 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 338 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 339 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 406 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 407 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 408 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 409 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 410 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 411 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 412 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 413 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 414 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 415 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 416 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 417 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 418 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 423 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 424 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 425 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 426 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 427 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 428 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 429 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 431 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 432 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 433 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 434 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 435 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 436 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 437 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 438 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 439 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 440 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 441 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 442 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 443 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 444 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 445 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 446 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 447 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 448 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 449 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 450 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.94 |
| Metatranscriptomes | 0 |
| Isolates | 22.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 7.39 |
| Nodule | 2.2 |
| Rhizoplane | 7.19 |
| Rhizosphere | 70.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_9054 | 2124908027 | Bacteria | 2380 |
| 2 | SwRhRL2b_contig_249379 | 2162886007 | Bacteria | 2007 |
| 3 | SwRhRL2b_contig_3818765 | 2162886007 | Bacteria | 2929 |
| 4 | JGI24735J21928_10001792 | 3300002067 | Bacteria | 7537 |
| 5 | JGI25162J39368_1000018 | 3300002737 | Bacteria | 277875 |
| 6 | JGI25157J39369_1000011 | 3300002741 | Bacteria | 206831 |
| 7 | JGI25163J39215_1000612 | 3300002771 | Bacteria | 9846 |
| 8 | JGI25163J39215_1001671 | 3300002771 | Bacteria | 3224 |
| 9 | JGI25163J39215_1001757 | 3300002771 | Bacteria | 3006 |
| 10 | JGI25164J39214_1000007 | 3300002772 | Bacteria | 312507 |
| 11 | JGI25164J39214_1000194 | 3300002772 | Bacteria | 52332 |
| 12 | JGI25164J39214_1000513 | 3300002772 | Bacteria | 18583 |
| 13 | JGI25165J46597_1000029 | 3300003214 | Bacteria | 312507 |
| 14 | JGI25165J46597_1000348 | 3300003214 | Bacteria | 52332 |
| 15 | JGI25165J46597_1000430 | 3300003214 | Bacteria | 42934 |
| 16 | Ga0055535_1000025 | 3300003761 | Bacteria | 213549 |
| 17 | Ga0055535_1000103 | 3300003761 | Bacteria | 91199 |
| 18 | Ga0055542_1000010 | 3300003762 | Bacteria | 414813 |
| 19 | Ga0055542_1000024 | 3300003762 | Bacteria | 277875 |
| 20 | Ga0055529_1000029 | 3300003763 | Bacteria | 277978 |
| 21 | Ga0055536_1000111 | 3300003781 | Bacteria | 71634 |
| 22 | Ga0055530_10000146 | 3300003791 | Bacteria | 63397 |
| 23 | Ga0055530_10001124 | 3300003791 | Bacteria | 20902 |
| 24 | Ga0055540_1000822 | 3300003792 | Bacteria | 20902 |
| 25 | Ga0055540_1001173 | 3300003792 | Bacteria | 16221 |
| 26 | Ga0055540_1001379 | 3300003792 | Bacteria | 14505 |
| 27 | Ga0055531_10005378 | 3300003794 | Bacteria | 7503 |
| 28 | Ga0065714_10003020 | 3300005288 | Bacteria | 10111 |
| 29 | Ga0065714_10008503 | 3300005288 | Bacteria | 3283 |
| 30 | Ga0065714_10010964 | 3300005288 | Bacteria | 2862 |
| 31 | Ga0065704_10000811 | 3300005289 | Bacteria | 15100 |
| 32 | Ga0065704_10128936 | 3300005289 | Bacteria | 1626 |
| 33 | Ga0065712_10001766 | 3300005290 | Bacteria | 11896 |
| 34 | Ga0065712_10067928 | 3300005290 | Bacteria | 20363 |
| 35 | Ga0065712_10095511 | 3300005290 | Bacteria | 2216 |
| 36 | Ga0070670_100001032 | 3300005331 | Bacteria | 22056 |
| 37 | Ga0070670_100039965 | 3300005331 | Bacteria | 4034 |
| 38 | Ga0070661_100000410 | 3300005344 | Bacteria | 33146 |
| 39 | Ga0070709_10380710 | 3300005434 | Bacteria | 1049 |
| 40 | Ga0070662_100000575 | 3300005457 | Bacteria | 22374 |
| 41 | Ga0070662_100231300 | 3300005457 | Bacteria | 1479 |
| 42 | Ga0070699_100484596 | 3300005518 | Bacteria | 1123 |
| 43 | Ga0068853_100017790 | 3300005539 | Bacteria | 5869 |
| 44 | Ga0070664_100000377 | 3300005564 | Bacteria | 33163 |
| 45 | Ga0070664_100508048 | 3300005564 | Bacteria | 1111 |
| 46 | Ga0068854_100020669 | 3300005578 | Bacteria | 4459 |
| 47 | Ga0068851_10000251 | 3300005834 | Bacteria | 25318 |
| 48 | Ga0081455_10008620 | 3300005937 | Bacteria | 10577 |
| 49 | Ga0075364_10111970 | 3300006051 | Bacteria | 1822 |
| 50 | Ga0075432_10001356 | 3300006058 | Bacteria | 7950 |
| 51 | Ga0075432_10004567 | 3300006058 | Bacteria | 4712 |
| 52 | Ga0075432_10033448 | 3300006058 | Bacteria | 1783 |
| 53 | Ga0075432_10071867 | 3300006058 | Bacteria | 1244 |
| 54 | Ga0075362_10031647 | 3300006177 | Bacteria | 2291 |
| 55 | Ga0075362_10052897 | 3300006177 | Bacteria | 1821 |
| 56 | Ga0075362_10092813 | 3300006177 | Bacteria | 1403 |
| 57 | Ga0075369_10005588 | 3300006186 | Bacteria | 4707 |
| 58 | Ga0079104_1000364 | 3300006946 | Bacteria | 54402 |
| 59 | Ga0105251_10000275 | 3300009011 | Bacteria | 51691 |
| 60 | Ga0105251_10000284 | 3300009011 | Bacteria | 50987 |
| 61 | Ga0105251_10003067 | 3300009011 | Bacteria | 12418 |
| 62 | Ga0105251_10003252 | 3300009011 | Bacteria | 11939 |
| 63 | Ga0105251_10004649 | 3300009011 | Bacteria | 9252 |
| 64 | Ga0105251_10005474 | 3300009011 | Bacteria | 8282 |
| 65 | Ga0105251_10007774 | 3300009011 | Bacteria | 6534 |
| 66 | Ga0105251_10017472 | 3300009011 | Bacteria | 3843 |
| 67 | Ga0105251_10019528 | 3300009011 | Bacteria | 3577 |
| 68 | Ga0105251_10021821 | 3300009011 | Bacteria | 3336 |
| 69 | Ga0105251_10028781 | 3300009011 | Bacteria | 2804 |
| 70 | Ga0105251_10050514 | 3300009011 | Bacteria | 1986 |
| 71 | Ga0105251_10068203 | 3300009011 | Bacteria | 1660 |
| 72 | Ga0105251_10122040 | 3300009011 | Bacteria | 1183 |
| 73 | Ga0105244_10000248 | 3300009036 | Bacteria | 55384 |
| 74 | Ga0105244_10001261 | 3300009036 | Bacteria | 20750 |
| 75 | Ga0105244_10009784 | 3300009036 | Bacteria | 5857 |
| 76 | Ga0105244_10012090 | 3300009036 | Bacteria | 5127 |
| 77 | Ga0105244_10020378 | 3300009036 | Bacteria | 3686 |
| 78 | Ga0105244_10026295 | 3300009036 | Bacteria | 3151 |
| 79 | Ga0105244_10043759 | 3300009036 | Bacteria | 2308 |
| 80 | Ga0105244_10079305 | 3300009036 | Bacteria | 1627 |
| 81 | Ga0105250_10000232 | 3300009092 | Bacteria | 46504 |
| 82 | Ga0105250_10001490 | 3300009092 | Bacteria | 12642 |
| 83 | Ga0105250_10001860 | 3300009092 | Bacteria | 10989 |
| 84 | Ga0105250_10016458 | 3300009092 | Bacteria | 3012 |
| 85 | Ga0105250_10023495 | 3300009092 | Bacteria | 2484 |
| 86 | Ga0105250_10050018 | 3300009092 | Bacteria | 1677 |
| 87 | Ga0105243_10001441 | 3300009148 | Bacteria | 20939 |
| 88 | Ga0105243_10002007 | 3300009148 | Bacteria | 17310 |
| 89 | Ga0105243_10053799 | 3300009148 | Bacteria | 3194 |
| 90 | Ga0105243_10200929 | 3300009148 | Bacteria | 1748 |
| 91 | Ga0105242_10002563 | 3300009176 | Bacteria | 14245 |
| 92 | Ga0105237_10002926 | 3300009545 | Bacteria | 20681 |
| 93 | Ga0105249_10098399 | 3300009553 | Bacteria | 2747 |
| 94 | Ga0099796_10102136 | 3300010159 | Bacteria | 1080 |
| 95 | Ga0105246_10001555 | 3300011119 | Bacteria | 13637 |
| 96 | Ga0105246_10015749 | 3300011119 | Bacteria | 4780 |
| 97 | Ga0105246_10023510 | 3300011119 | Bacteria | 3989 |
| 98 | Ga0105246_10055583 | 3300011119 | Bacteria | 2732 |
| 99 | Ga0157345_1000292 | 3300012498 | Bacteria | 6601 |
| 100 | Ga0157373_10002707 | 3300013100 | Bacteria | 13428 |
| 101 | Ga0157373_10013017 | 3300013100 | Bacteria | 6105 |
| 102 | Ga0157373_10014185 | 3300013100 | Bacteria | 5844 |
| 103 | Ga0157373_10111685 | 3300013100 | Bacteria | 1921 |
| 104 | Ga0157373_10140465 | 3300013100 | Bacteria | 1698 |
| 105 | Ga0157371_10003281 | 3300013102 | Bacteria | 14813 |
| 106 | Ga0157371_10004368 | 3300013102 | Bacteria | 12370 |
| 107 | Ga0157371_10014445 | 3300013102 | Bacteria | 5958 |
| 108 | Ga0157371_10137678 | 3300013102 | Bacteria | 1739 |
| 109 | Ga0157370_10000162 | 3300013104 | Bacteria | 81640 |
| 110 | Ga0157370_10031069 | 3300013104 | Bacteria | 5228 |
| 111 | Ga0157370_10043496 | 3300013104 | Bacteria | 4322 |
| 112 | Ga0157370_10085672 | 3300013104 | Bacteria | 2960 |
| 113 | Ga0157370_10109001 | 3300013104 | Bacteria | 2589 |
| 114 | Ga0157370_10183943 | 3300013104 | Bacteria | 1941 |
| 115 | Ga0157370_10192611 | 3300013104 | Bacteria | 1892 |
| 116 | Ga0157369_10024884 | 3300013105 | Bacteria | 6652 |
| 117 | Ga0157369_10030369 | 3300013105 | Bacteria | 5960 |
| 118 | Ga0157369_10032322 | 3300013105 | Bacteria | 5756 |
| 119 | Ga0157369_10086755 | 3300013105 | Bacteria | 3342 |
| 120 | Ga0163162_10009884 | 3300013306 | Bacteria | 9280 |
| 121 | Ga0163162_10286440 | 3300013306 | Bacteria | 1779 |
| 122 | Ga0157372_10086657 | 3300013307 | Bacteria | 3553 |
| 123 | Ga0157375_10097473 | 3300013308 | Bacteria | 3015 |
| 124 | Ga0157375_10766014 | 3300013308 | Bacteria | 1116 |
| 125 | Ga0182008_10005686 | 3300014497 | Bacteria | 7062 |
| 126 | Ga0182008_10011957 | 3300014497 | Bacteria | 4600 |
| 127 | Ga0182008_10021333 | 3300014497 | Bacteria | 3326 |
| 128 | Ga0182008_10021424 | 3300014497 | Bacteria | 3318 |
| 129 | Ga0182008_10041281 | 3300014497 | Bacteria | 2301 |
| 130 | Ga0182006_1001230 | 3300015261 | Bacteria | 15900 |
| 131 | Ga0182006_1002590 | 3300015261 | Bacteria | 9781 |
| 132 | Ga0182006_1008846 | 3300015261 | Bacteria | 4547 |
| 133 | Ga0182006_1021402 | 3300015261 | Bacteria | 2697 |
| 134 | Ga0182006_1023158 | 3300015261 | Bacteria | 2573 |
| 135 | Ga0182006_1026917 | 3300015261 | Bacteria | 2351 |
| 136 | Ga0182006_1056635 | 3300015261 | Bacteria | 1493 |
| 137 | Ga0182006_1070478 | 3300015261 | Bacteria | 1297 |
| 138 | Ga0182007_10001571 | 3300015262 | Bacteria | 12179 |
| 139 | Ga0182007_10002759 | 3300015262 | Bacteria | 8577 |
| 140 | Ga0182007_10021435 | 3300015262 | Bacteria | 2295 |
| 141 | Ga0182005_1004406 | 3300015265 | Bacteria | 4558 |
| 142 | Ga0182005_1005003 | 3300015265 | Bacteria | 4191 |
| 143 | Ga0182005_1017950 | 3300015265 | Bacteria | 1957 |
| 144 | Ga0182005_1022377 | 3300015265 | Bacteria | 1732 |
| 145 | Ga0182005_1022935 | 3300015265 | Bacteria | 1708 |
| 146 | Ga0182005_1023813 | 3300015265 | Bacteria | 1672 |
| 147 | Ga0163161_10012776 | 3300017792 | Bacteria | 5832 |
| 148 | Ga0209760_100011 | 3300025207 | Bacteria | 197221 |
| 149 | Ga0209760_100064 | 3300025207 | Bacteria | 91180 |
| 150 | Ga0209784_100026 | 3300025224 | Bacteria | 371540 |
| 151 | Ga0209566_102356 | 3300025225 | Bacteria | 3594 |
| 152 | Ga0209672_102246 | 3300025228 | Bacteria | 4977 |
| 153 | Ga0209563_100694 | 3300025230 | Bacteria | 10611 |
| 154 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 155 | Ga0207427_100023 | 3300025231 | Bacteria | 439725 |
| 156 | Ga0207427_100082 | 3300025231 | Bacteria | 142809 |
| 157 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 158 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 159 | Ga0209437_100069 | 3300025233 | Bacteria | 307733 |
| 160 | Ga0209437_100245 | 3300025233 | Bacteria | 88331 |
| 161 | Ga0209258_100059 | 3300025242 | Bacteria | 324934 |
| 162 | Ga0209258_101045 | 3300025242 | Bacteria | 12271 |
| 163 | Ga0209258_101292 | 3300025242 | Bacteria | 9314 |
| 164 | Ga0209646_1001047 | 3300025246 | Bacteria | 8338 |
| 165 | Ga0209026_1000036 | 3300025250 | Bacteria | 296607 |
| 166 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 167 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 168 | Ga0209759_1000023 | 3300025256 | Bacteria | 321695 |
| 169 | Ga0209759_1002192 | 3300025256 | Bacteria | 8942 |
| 170 | Ga0209759_1021902 | 3300025256 | Bacteria | 1442 |
| 171 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 172 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 173 | Ga0209233_1000105 | 3300025261 | Bacteria | 272035 |
| 174 | Ga0209455_1000020 | 3300025272 | Bacteria | 702259 |
| 175 | Ga0209130_1022753 | 3300025284 | Bacteria | 1392 |
| 176 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 177 | Ga0209676_1000369 | 3300025292 | Bacteria | 83704 |
| 178 | Ga0209676_1001140 | 3300025292 | Bacteria | 29053 |
| 179 | Ga0209676_1003514 | 3300025292 | Bacteria | 9576 |
| 180 | Ga0209676_1004051 | 3300025292 | Bacteria | 8429 |
| 181 | Ga0209050_1000070 | 3300025298 | Bacteria | 296366 |
| 182 | Ga0209050_1000235 | 3300025298 | Bacteria | 121420 |
| 183 | Ga0209050_1000380 | 3300025298 | Bacteria | 83704 |
| 184 | Ga0209050_1001241 | 3300025298 | Bacteria | 29500 |
| 185 | Ga0209051_1000086 | 3300025303 | Bacteria | 183550 |
| 186 | Ga0209051_1000123 | 3300025303 | Bacteria | 144298 |
| 187 | Ga0209051_1001064 | 3300025303 | Bacteria | 25530 |
| 188 | Ga0209051_1036421 | 3300025303 | Bacteria | 1817 |
| 189 | Ga0209051_1051857 | 3300025303 | Bacteria | 1361 |
| 190 | Ga0209257_1000421 | 3300025304 | Bacteria | 81748 |
| 191 | Ga0209257_1010774 | 3300025304 | Bacteria | 4545 |
| 192 | Ga0207656_10000094 | 3300025321 | Bacteria | 33269 |
| 193 | Ga0207696_1000025 | 3300025711 | Bacteria | 418650 |
| 194 | Ga0207696_1000161 | 3300025711 | Bacteria | 109070 |
| 195 | Ga0207696_1000399 | 3300025711 | Bacteria | 40570 |
| 196 | Ga0207696_1002704 | 3300025711 | Bacteria | 8488 |
| 197 | Ga0207696_1004662 | 3300025711 | Bacteria | 5860 |
| 198 | Ga0207696_1010679 | 3300025711 | Bacteria | 3352 |
| 199 | Ga0207655_1000113 | 3300025728 | Bacteria | 167376 |
| 200 | Ga0207655_1000269 | 3300025728 | Bacteria | 81483 |
| 201 | Ga0207655_1000976 | 3300025728 | Bacteria | 29345 |
| 202 | Ga0207655_1002157 | 3300025728 | Bacteria | 16397 |
| 203 | Ga0207655_1003563 | 3300025728 | Bacteria | 11530 |
| 204 | Ga0207655_1004512 | 3300025728 | Bacteria | 9847 |
| 205 | Ga0207655_1011189 | 3300025728 | Bacteria | 5363 |
| 206 | Ga0207655_1016647 | 3300025728 | Bacteria | 4010 |
| 207 | Ga0207655_1065760 | 3300025728 | Bacteria | 1374 |
| 208 | Ga0207713_1000102 | 3300025735 | Bacteria | 139512 |
| 209 | Ga0207713_1000344 | 3300025735 | Bacteria | 50995 |
| 210 | Ga0207713_1001819 | 3300025735 | Bacteria | 16288 |
| 211 | Ga0207713_1002656 | 3300025735 | Bacteria | 12830 |
| 212 | Ga0207713_1003166 | 3300025735 | Bacteria | 11392 |
| 213 | Ga0207713_1005358 | 3300025735 | Bacteria | 8054 |
| 214 | Ga0207713_1006303 | 3300025735 | Bacteria | 7248 |
| 215 | Ga0207713_1006787 | 3300025735 | Bacteria | 6908 |
| 216 | Ga0207713_1021584 | 3300025735 | Bacteria | 3082 |
| 217 | Ga0207713_1035118 | 3300025735 | Bacteria | 2167 |
| 218 | Ga0207684_10407806 | 3300025910 | Bacteria | 1168 |
| 219 | Ga0207671_10001551 | 3300025914 | Bacteria | 26296 |
| 220 | Ga0207649_10000061 | 3300025920 | Bacteria | 98067 |
| 221 | Ga0207681_10013490 | 3300025923 | Bacteria | 5058 |
| 222 | Ga0207650_10000419 | 3300025925 | Bacteria | 37719 |
| 223 | Ga0207650_10001683 | 3300025925 | Bacteria | 15718 |
| 224 | Ga0207706_10000668 | 3300025933 | Bacteria | 36073 |
| 225 | Ga0207686_10002078 | 3300025934 | Bacteria | 11029 |
| 226 | Ga0207709_10000223 | 3300025935 | Bacteria | 71537 |
| 227 | Ga0207709_10000835 | 3300025935 | Bacteria | 23621 |
| 228 | Ga0207709_10030251 | 3300025935 | Bacteria | 3148 |
| 229 | Ga0207709_10049445 | 3300025935 | Bacteria | 2567 |
| 230 | Ga0207679_10000018 | 3300025945 | Bacteria | 238375 |
| 231 | Ga0207640_10018613 | 3300025981 | Bacteria | 4085 |
| 232 | Ga0207639_10016158 | 3300026041 | Bacteria | 5273 |
| 233 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 234 | Ga0209281_1000331 | 3300027111 | Bacteria | 81645 |
| 235 | Ga0209281_1002825 | 3300027111 | Bacteria | 6375 |
| 236 | Ga0209371_1000365 | 3300027312 | Bacteria | 48737 |
| 237 | Ga0207428_10021464 | 3300027907 | Bacteria | 5468 |
| 238 | Ga0207428_10026590 | 3300027907 | Bacteria | 4829 |
| 239 | Ga0207428_10105296 | 3300027907 | Bacteria | 2176 |
| 240 | Ga0207428_10133142 | 3300027907 | Bacteria | 1902 |
| 241 | Ga0207428_10242544 | 3300027907 | Bacteria | 1346 |
| 242 | Ga0268256_1000236 | 3300030500 | Bacteria | 57974 |
| 243 | Ga0314311_1137078 | 3300030733 | Bacteria | 2096 |
| 244 | Ga0316178_1174406 | 3300030735 | Bacteria | 18287 |
| 245 | Ga0307408_100000025 | 3300031548 | Bacteria | 267563 |
| 246 | Ga0307408_100036272 | 3300031548 | Bacteria | 3465 |
| 247 | Ga0307408_100144895 | 3300031548 | Bacteria | 1868 |
| 248 | Ga0307516_10194648 | 3300031730 | Bacteria | 1751 |
| 249 | Ga0307405_10040867 | 3300031731 | Bacteria | 2811 |
| 250 | Ga0307412_10115724 | 3300031911 | Bacteria | 1922 |
| 251 | Ga0307412_10325564 | 3300031911 | Bacteria | 1224 |
| 252 | Ga0307409_100026395 | 3300031995 | Bacteria | 4095 |
| 253 | Ga0307414_10062721 | 3300032004 | Bacteria | 2639 |
| 254 | Ga0307414_10096469 | 3300032004 | Bacteria | 2212 |
| 255 | Ga0373927_0179601 | 3300035695 | Bacteria | 1388 |
| 256 | Ga0395899_0022460 | 3300037312 | Bacteria | 4784 |
| 257 | Ga0395900_0054481 | 3300037418 | Bacteria | 4118 |
| 258 | Ga0395898_0026985 | 3300037466 | Bacteria | 5770 |
| 259 | Ga0237819_00881 | 3300038705 | Bacteria | 9379 |
| 260 | Ga0400483_011826 | 3300039062 | Bacteria | 13740 |
| 261 | Ga0400483_279756 | 3300039062 | Bacteria | 11311 |
| 262 | Ga0436363_0138769 | 3300039450 | Bacteria | 1887 |
| 263 | Ga0439436_0016475 | 3300041404 | Bacteria | 2216 |
| 264 | Ga0439438_002391 | 3300041405 | Bacteria | 7994 |
| 265 | Ga0439438_005853 | 3300041405 | Bacteria | 4454 |
| 266 | Ga0439438_010670 | 3300041405 | Bacteria | 2893 |
| 267 | Ga0439438_025483 | 3300041405 | Bacteria | 1611 |
| 268 | Ga0439447_001809 | 3300041407 | Bacteria | 7835 |
| 269 | Ga0439447_006010 | 3300041407 | Bacteria | 3982 |
| 270 | Ga0439447_010708 | 3300041407 | Bacteria | 2709 |
| 271 | Ga0439447_029585 | 3300041407 | Bacteria | 1385 |
| 272 | Ga0439447_033238 | 3300041407 | Bacteria | 1286 |
| 273 | Ga0439466_0004608 | 3300041411 | Bacteria | 5298 |
| 274 | Ga0439466_0009682 | 3300041411 | Bacteria | 3597 |
| 275 | Ga0439466_0014226 | 3300041411 | Bacteria | 2900 |
| 276 | Ga0439466_0017268 | 3300041411 | Bacteria | 2601 |
| 277 | Ga0439466_0024300 | 3300041411 | Bacteria | 2125 |
| 278 | Ga0439431_0004367 | 3300041997 | Bacteria | 3106 |
| 279 | Ga0439437_000520 | 3300042000 | Bacteria | 3822 |
| 280 | Ga0439443_002718 | 3300042003 | Bacteria | 2149 |
| 281 | Ga0439432_002368 | 3300042006 | Bacteria | 7116 |
| 282 | Ga0439432_007415 | 3300042006 | Bacteria | 3888 |
| 283 | Ga0439432_018956 | 3300042006 | Bacteria | 2295 |
| 284 | Ga0439432_021257 | 3300042006 | Bacteria | 2153 |
| 285 | Ga0439432_031308 | 3300042006 | Bacteria | 1721 |
| 286 | Ga0439452_000667 | 3300042010 | Bacteria | 16915 |
| 287 | Ga0439452_011937 | 3300042010 | Bacteria | 2484 |
| 288 | Ga0439452_016034 | 3300042010 | Bacteria | 2041 |
| 289 | Ga0439452_018731 | 3300042010 | Bacteria | 1840 |
| 290 | Ga0439452_034005 | 3300042010 | Bacteria | 1234 |
| 291 | Ga0439456_000315 | 3300042013 | Bacteria | 11172 |
| 292 | Ga0439456_012132 | 3300042013 | Bacteria | 1786 |
| 293 | Ga0439456_014249 | 3300042013 | Bacteria | 1657 |
| 294 | Ga0439463_001299 | 3300042016 | Bacteria | 6640 |
| 295 | Ga0439463_003312 | 3300042016 | Bacteria | 4083 |
| 296 | Ga0450911_000017 | 3300042115 | Bacteria | 104823 |
| 297 | Ga0450911_002369 | 3300042115 | Bacteria | 3754 |
| 298 | Ga0450911_008410 | 3300042115 | Bacteria | 1471 |
| 299 | Ga0450913_001977 | 3300042117 | Bacteria | 1209 |
| 300 | Ga0450902_008097 | 3300042137 | Bacteria | 1636 |
| 301 | Ga0450903_005766 | 3300042138 | Bacteria | 2067 |
| 302 | Ga0450904_000166 | 3300042139 | Bacteria | 14541 |
| 303 | Ga0450904_002326 | 3300042139 | Bacteria | 2297 |
| 304 | Ga0450904_005246 | 3300042139 | Bacteria | 1319 |
| 305 | Ga0450906_004046 | 3300042145 | Bacteria | 3101 |
| 306 | Ga0450907_000439 | 3300042146 | Bacteria | 12184 |
| 307 | Ga0450910_000985 | 3300042147 | Bacteria | 3450 |
| 308 | Ga0439446_0000026 | 3300042156 | Bacteria | 25155 |
| 309 | Ga0439446_0059653 | 3300042156 | Bacteria | 1151 |
| 310 | Ga0439434_0009636 | 3300042435 | Bacteria | 2842 |
| 311 | Ga0439434_0044252 | 3300042435 | Bacteria | 1371 |
| 312 | Ga0439459_0000879 | 3300042438 | Bacteria | 4200 |
| 313 | Ga0439464_0006527 | 3300042439 | Bacteria | 3041 |
| 314 | Ga0439464_0018885 | 3300042439 | Bacteria | 1878 |
| 315 | Ga0439460_0001955 | 3300042461 | Bacteria | 4930 |
| 316 | Ga0450916_000791 | 3300042530 | Bacteria | 2949 |
| 317 | Ga0450893_0001272 | 3300042532 | Bacteria | 3813 |
| 318 | Ga0451577_0033401 | 3300042876 | Bacteria | 4638 |
| 319 | Ga0439440_0002330 | 3300042993 | Bacteria | 3572 |
| 320 | Ga0439440_0043154 | 3300042993 | Bacteria | 1105 |
| 321 | Ga0495617_009670 | 3300046452 | Bacteria | 3307 |
| 322 | Ga0495617_009807 | 3300046452 | Bacteria | 3284 |
| 323 | Ga0495627_000040 | 3300046453 | Bacteria | 195248 |
| 324 | Ga0495627_001207 | 3300046453 | Bacteria | 16248 |
| 325 | Ga0495627_002117 | 3300046453 | Bacteria | 10035 |
| 326 | Ga0495627_009066 | 3300046453 | Bacteria | 3676 |
| 327 | Ga0495627_014002 | 3300046453 | Bacteria | 2811 |
| 328 | Ga0495627_028094 | 3300046453 | Bacteria | 1799 |
| 329 | Ga0495603_0017243 | 3300046455 | Bacteria | 4371 |
| 330 | Ga0495590_0005676 | 3300046457 | Bacteria | 4909 |
| 331 | Ga0495590_0009911 | 3300046457 | Bacteria | 3602 |
| 332 | Ga0495590_0025595 | 3300046457 | Bacteria | 2074 |
| 333 | Ga0495590_0037316 | 3300046457 | Bacteria | 1694 |
| 334 | Ga0495591_000023 | 3300046458 | Bacteria | 191598 |
| 335 | Ga0495591_001720 | 3300046458 | Bacteria | 13044 |
| 336 | Ga0495591_002767 | 3300046458 | Bacteria | 9469 |
| 337 | Ga0495591_007086 | 3300046458 | Bacteria | 4828 |
| 338 | Ga0495591_008921 | 3300046458 | Bacteria | 4043 |
| 339 | Ga0495591_016013 | 3300046458 | Bacteria | 2627 |
| 340 | Ga0495638_0023429 | 3300046460 | Bacteria | 4038 |
| 341 | Ga0495638_0026283 | 3300046460 | Bacteria | 3773 |
| 342 | Ga0495638_0044887 | 3300046460 | Bacteria | 2782 |
| 343 | Ga0495638_0095137 | 3300046460 | Bacteria | 1789 |
| 344 | Ga0495638_0101843 | 3300046460 | Bacteria | 1716 |
| 345 | Ga0495638_0117272 | 3300046460 | Bacteria | 1576 |
| 346 | Ga0495638_0222737 | 3300046460 | Bacteria | 1053 |
| 347 | Ga0495653_0001688 | 3300046463 | Bacteria | 17382 |
| 348 | Ga0495653_0075011 | 3300046463 | Bacteria | 2518 |
| 349 | Ga0495653_0109414 | 3300046463 | Bacteria | 1988 |
| 350 | Ga0495653_0153470 | 3300046463 | Bacteria | 1606 |
| 351 | Ga0495650_0001179 | 3300046471 | Bacteria | 27791 |
| 352 | Ga0495650_0021310 | 3300046471 | Bacteria | 3136 |
| 353 | Ga0495650_0023543 | 3300046471 | Bacteria | 2929 |
| 354 | Ga0495650_0024731 | 3300046471 | Bacteria | 2831 |
| 355 | Ga0495650_0036242 | 3300046471 | Bacteria | 2160 |
| 356 | Ga0495650_0040558 | 3300046471 | Bacteria | 1997 |
| 357 | Ga0495650_0096008 | 3300046471 | Bacteria | 1119 |
| 358 | Ga0495605_0000048 | 3300046474 | Bacteria | 170182 |
| 359 | Ga0495605_0000094 | 3300046474 | Bacteria | 112717 |
| 360 | Ga0495605_0001067 | 3300046474 | Bacteria | 18295 |
| 361 | Ga0495605_0002988 | 3300046474 | Bacteria | 10219 |
| 362 | Ga0495605_0005577 | 3300046474 | Bacteria | 7318 |
| 363 | Ga0495605_0019091 | 3300046474 | Bacteria | 3668 |
| 364 | Ga0495605_0027745 | 3300046474 | Bacteria | 2930 |
| 365 | Ga0495605_0030595 | 3300046474 | Bacteria | 2758 |
| 366 | Ga0495605_0047399 | 3300046474 | Bacteria | 2108 |
| 367 | Ga0495605_0082438 | 3300046474 | Bacteria | 1502 |
| 368 | Ga0495639_0014215 | 3300046475 | Bacteria | 3444 |
| 369 | Ga0495584_0019852 | 3300046491 | Bacteria | 3414 |
| 370 | Ga0495584_0038569 | 3300046491 | Bacteria | 2414 |
| 371 | Ga0495584_0058589 | 3300046491 | Bacteria | 1937 |
| 372 | Ga0495584_0150297 | 3300046491 | Bacteria | 1183 |
| 373 | Ga0495585_0028644 | 3300046492 | Bacteria | 3175 |
| 374 | Ga0495585_0033388 | 3300046492 | Bacteria | 2912 |
| 375 | Ga0495585_0038594 | 3300046492 | Bacteria | 2687 |
| 376 | Ga0495585_0053125 | 3300046492 | Bacteria | 2242 |
| 377 | Ga0495585_0105470 | 3300046492 | Bacteria | 1503 |
| 378 | Ga0495596_0001228 | 3300046500 | Bacteria | 14950 |
| 379 | Ga0495596_0002112 | 3300046500 | Bacteria | 10892 |
| 380 | Ga0495596_0063070 | 3300046500 | Bacteria | 1441 |
| 381 | Ga0495607_0000893 | 3300046501 | Bacteria | 27775 |
| 382 | Ga0495607_0000972 | 3300046501 | Bacteria | 26545 |
| 383 | Ga0495607_0001113 | 3300046501 | Bacteria | 24369 |
| 384 | Ga0495607_0001564 | 3300046501 | Bacteria | 20007 |
| 385 | Ga0495607_0007321 | 3300046501 | Bacteria | 7651 |
| 386 | Ga0495607_0009646 | 3300046501 | Bacteria | 6523 |
| 387 | Ga0495607_0011176 | 3300046501 | Bacteria | 5993 |
| 388 | Ga0495607_0016917 | 3300046501 | Bacteria | 4694 |
| 389 | Ga0495607_0019252 | 3300046501 | Bacteria | 4338 |
| 390 | Ga0495607_0021308 | 3300046501 | Bacteria | 4080 |
| 391 | Ga0495607_0039860 | 3300046501 | Bacteria | 2802 |
| 392 | Ga0495607_0042425 | 3300046501 | Bacteria | 2696 |
| 393 | Ga0495607_0064024 | 3300046501 | Bacteria | 2078 |
| 394 | Ga0495607_0084220 | 3300046501 | Bacteria | 1740 |
| 395 | Ga0495607_0087591 | 3300046501 | Bacteria | 1694 |
| 396 | Ga0495607_0096301 | 3300046501 | Bacteria | 1593 |
| 397 | Ga0495607_0172485 | 3300046501 | Bacteria | 1091 |
| 398 | Ga0495607_0191470 | 3300046501 | Bacteria | 1018 |
| 399 | Ga0495583_0000096 | 3300046506 | Bacteria | 151090 |
| 400 | Ga0495583_0002375 | 3300046506 | Bacteria | 16249 |
| 401 | Ga0495583_0004233 | 3300046506 | Bacteria | 10418 |
| 402 | Ga0495583_0004686 | 3300046506 | Bacteria | 9632 |
| 403 | Ga0495583_0004830 | 3300046506 | Bacteria | 9432 |
| 404 | Ga0495583_0008065 | 3300046506 | Bacteria | 6494 |
| 405 | Ga0495583_0023222 | 3300046506 | Bacteria | 3142 |
| 406 | Ga0495583_0031157 | 3300046506 | Bacteria | 2588 |
| 407 | Ga0495606_0000076 | 3300046507 | Bacteria | 166969 |
| 408 | Ga0495606_0000167 | 3300046507 | Bacteria | 115739 |
| 409 | Ga0495606_0000608 | 3300046507 | Bacteria | 56665 |
| 410 | Ga0495606_0003110 | 3300046507 | Bacteria | 18033 |
| 411 | Ga0495606_0003580 | 3300046507 | Bacteria | 16376 |
| 412 | Ga0495606_0003873 | 3300046507 | Bacteria | 15447 |
| 413 | Ga0495606_0020781 | 3300046507 | Bacteria | 4826 |
| 414 | Ga0495606_0029098 | 3300046507 | Bacteria | 3885 |
| 415 | Ga0495606_0031245 | 3300046507 | Bacteria | 3705 |
| 416 | Ga0495606_0035413 | 3300046507 | Bacteria | 3411 |
| 417 | Ga0495606_0044791 | 3300046507 | Bacteria | 2939 |
| 418 | Ga0495606_0060369 | 3300046507 | Bacteria | 2428 |
| 419 | Ga0495606_0071520 | 3300046507 | Bacteria | 2183 |
| 420 | Ga0495606_0105579 | 3300046507 | Bacteria | 1707 |
| 421 | Ga0495610_0003673 | 3300046512 | Bacteria | 11795 |
| 422 | Ga0495610_0029882 | 3300046512 | Bacteria | 2862 |
| 423 | Ga0495610_0034875 | 3300046512 | Bacteria | 2587 |
| 424 | Ga0495610_0042094 | 3300046512 | Bacteria | 2287 |
| 425 | Ga0495610_0042670 | 3300046512 | Bacteria | 2266 |
| 426 | Ga0495610_0045081 | 3300046512 | Bacteria | 2183 |
| 427 | Ga0495616_0001347 | 3300046513 | Bacteria | 17142 |
| 428 | Ga0495616_0010197 | 3300046513 | Bacteria | 5451 |
| 429 | Ga0495616_0014233 | 3300046513 | Bacteria | 4461 |
| 430 | Ga0495616_0026394 | 3300046513 | Bacteria | 3092 |
| 431 | Ga0495616_0043632 | 3300046513 | Bacteria | 2277 |
| 432 | Ga0495616_0044749 | 3300046513 | Bacteria | 2244 |
| 433 | Ga0495616_0055653 | 3300046513 | Bacteria | 1957 |
| 434 | Ga0495616_0056399 | 3300046513 | Bacteria | 1940 |
| 435 | Ga0495616_0106807 | 3300046513 | Bacteria | 1305 |
| 436 | Ga0495620_0000001 | 3300046515 | Bacteria | 386508 |
| 437 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 438 | Ga0495620_0000736 | 3300046515 | Bacteria | 20171 |
| 439 | Ga0495620_0001383 | 3300046515 | Bacteria | 14599 |
| 440 | Ga0495620_0010185 | 3300046515 | Bacteria | 4966 |
| 441 | Ga0495620_0020358 | 3300046515 | Bacteria | 3241 |
| 442 | Ga0495620_0022320 | 3300046515 | Bacteria | 3050 |
| 443 | Ga0495620_0068247 | 3300046515 | Bacteria | 1460 |
| 444 | Ga0495620_0071961 | 3300046515 | Bacteria | 1412 |
| 445 | Ga0495620_0077028 | 3300046515 | Bacteria | 1354 |
| 446 | Ga0495631_0000361 | 3300046518 | Bacteria | 31358 |
| 447 | Ga0495631_0011216 | 3300046518 | Bacteria | 4413 |
| 448 | Ga0495631_0013811 | 3300046518 | Bacteria | 3911 |
| 449 | Ga0495631_0037631 | 3300046518 | Bacteria | 2154 |
| 450 | Ga0495631_0041744 | 3300046518 | Bacteria | 2029 |
| 451 | Ga0495632_0001293 | 3300046519 | Bacteria | 21160 |
| 452 | Ga0495632_0009098 | 3300046519 | Bacteria | 6011 |
| 453 | Ga0495632_0018573 | 3300046519 | Bacteria | 3812 |
| 454 | Ga0495632_0026907 | 3300046519 | Bacteria | 3019 |
| 455 | Ga0495632_0027921 | 3300046519 | Bacteria | 2949 |
| 456 | Ga0495632_0032968 | 3300046519 | Bacteria | 2663 |
| 457 | Ga0495632_0048392 | 3300046519 | Bacteria | 2105 |
| 458 | Ga0495632_0055072 | 3300046519 | Bacteria | 1948 |
| 459 | Ga0495632_0060055 | 3300046519 | Bacteria | 1848 |
| 460 | Ga0495632_0068125 | 3300046519 | Bacteria | 1715 |
| 461 | Ga0495632_0071228 | 3300046519 | Bacteria | 1670 |
| 462 | Ga0495632_0106812 | 3300046519 | Bacteria | 1316 |
| 463 | Ga0495632_0117266 | 3300046519 | Bacteria | 1246 |
| 464 | Ga0495637_0000583 | 3300046520 | Bacteria | 25971 |
| 465 | Ga0495637_0006191 | 3300046520 | Bacteria | 6021 |
| 466 | Ga0495637_0008837 | 3300046520 | Bacteria | 4932 |
| 467 | Ga0495637_0009658 | 3300046520 | Bacteria | 4700 |
| 468 | Ga0495637_0010701 | 3300046520 | Bacteria | 4427 |
| 469 | Ga0495637_0019602 | 3300046520 | Bacteria | 3125 |
| 470 | Ga0495637_0023730 | 3300046520 | Bacteria | 2781 |
| 471 | Ga0495637_0027828 | 3300046520 | Bacteria | 2525 |
| 472 | Ga0495637_0034806 | 3300046520 | Bacteria | 2203 |
| 473 | Ga0495637_0042478 | 3300046520 | Bacteria | 1944 |
| 474 | Ga0495637_0051564 | 3300046520 | Bacteria | 1721 |
| 475 | Ga0495637_0064442 | 3300046520 | Bacteria | 1494 |
| 476 | Ga0495637_0117289 | 3300046520 | Bacteria | 1027 |
| 477 | Ga0495643_0000673 | 3300046522 | Bacteria | 40197 |
| 478 | Ga0495643_0000785 | 3300046522 | Bacteria | 35224 |
| 479 | Ga0495643_0011714 | 3300046522 | Bacteria | 5324 |
| 480 | Ga0495643_0034692 | 3300046522 | Bacteria | 2783 |
| 481 | Ga0495643_0070369 | 3300046522 | Bacteria | 1837 |
| 482 | Ga0495643_0140461 | 3300046522 | Bacteria | 1205 |
| 483 | Ga0495643_0169472 | 3300046522 | Bacteria | 1068 |
| 484 | Ga0495644_0005422 | 3300046523 | Bacteria | 4981 |
| 485 | Ga0495644_0016173 | 3300046523 | Bacteria | 2857 |
| 486 | Ga0495644_0020076 | 3300046523 | Bacteria | 2549 |
| 487 | Ga0495644_0027817 | 3300046523 | Bacteria | 2141 |
| 488 | Ga0495648_0008068 | 3300046524 | Bacteria | 8328 |
| 489 | Ga0495648_0008743 | 3300046524 | Bacteria | 7930 |
| 490 | Ga0495648_0019177 | 3300046524 | Bacteria | 4819 |
| 491 | Ga0495648_0029004 | 3300046524 | Bacteria | 3678 |
| 492 | Ga0495648_0030511 | 3300046524 | Bacteria | 3563 |
| 493 | Ga0495648_0041982 | 3300046524 | Bacteria | 2882 |
| 494 | Ga0495648_0067821 | 3300046524 | Bacteria | 2084 |
| 495 | Ga0495648_0078373 | 3300046524 | Bacteria | 1889 |
| 496 | Ga0495648_0078685 | 3300046524 | Bacteria | 1884 |
| 497 | Ga0495648_0083334 | 3300046524 | Bacteria | 1812 |
| 498 | Ga0495648_0126020 | 3300046524 | Bacteria | 1368 |
| 499 | Ga0495648_0198136 | 3300046524 | Bacteria | 1007 |
| 500 | Ga0495666_0019899 | 3300046526 | Bacteria | 3329 |
| 501 | Ga0495666_0119399 | 3300046526 | Bacteria | 1235 |
| 502 | Ga0495642_0001507 | 3300046528 | Bacteria | 10362 |
| 503 | Ga0495642_0009207 | 3300046528 | Bacteria | 3780 |
| 504 | Ga0495654_0001014 | 3300046530 | Bacteria | 20561 |
| 505 | Ga0495654_0001425 | 3300046530 | Bacteria | 16486 |
| 506 | Ga0495654_0003292 | 3300046530 | Bacteria | 9954 |
| 507 | Ga0495654_0004160 | 3300046530 | Bacteria | 8670 |
| 508 | Ga0495654_0015896 | 3300046530 | Bacteria | 3988 |
| 509 | Ga0495654_0018333 | 3300046530 | Bacteria | 3669 |
| 510 | Ga0495654_0032304 | 3300046530 | Bacteria | 2653 |
| 511 | Ga0495654_0037006 | 3300046530 | Bacteria | 2450 |
| 512 | Ga0495654_0041036 | 3300046530 | Bacteria | 2303 |
| 513 | Ga0495654_0050130 | 3300046530 | Bacteria | 2041 |
| 514 | Ga0495654_0073257 | 3300046530 | Bacteria | 1620 |
| 515 | Ga0495654_0074100 | 3300046530 | Bacteria | 1608 |
| 516 | Ga0495654_0083276 | 3300046530 | Bacteria | 1495 |
| 517 | Ga0495654_0085444 | 3300046530 | Bacteria | 1472 |
| 518 | Ga0495587_0097056 | 3300046536 | Bacteria | 1699 |
| 519 | Ga0495587_0250428 | 3300046536 | Bacteria | 996 |
| 520 | Ga0495609_0000012 | 3300046538 | Bacteria | 333994 |
| 521 | Ga0495609_0000079 | 3300046538 | Bacteria | 118997 |
| 522 | Ga0495609_0000799 | 3300046538 | Bacteria | 23561 |
| 523 | Ga0495609_0020773 | 3300046538 | Bacteria | 3030 |
| 524 | Ga0495609_0024870 | 3300046538 | Bacteria | 2745 |
| 525 | Ga0495609_0109095 | 3300046538 | Bacteria | 1195 |
| 526 | Ga0495597_0000016 | 3300046542 | Bacteria | 167456 |
| 527 | Ga0495597_0009148 | 3300046542 | Bacteria | 4915 |
| 528 | Ga0495597_0015221 | 3300046542 | Bacteria | 3644 |
| 529 | Ga0495597_0018427 | 3300046542 | Bacteria | 3276 |
| 530 | Ga0495597_0072903 | 3300046542 | Bacteria | 1476 |
| 531 | Ga0495597_0085496 | 3300046542 | Bacteria | 1344 |
| 532 | Ga0495622_0015164 | 3300046557 | Bacteria | 3582 |
| 533 | Ga0495622_0016356 | 3300046557 | Bacteria | 3453 |
| 534 | Ga0495633_0000034 | 3300046558 | Bacteria | 185552 |
| 535 | Ga0495633_0017328 | 3300046558 | Bacteria | 3686 |
| 536 | Ga0495633_0024822 | 3300046558 | Bacteria | 2957 |
| 537 | Ga0495633_0096518 | 3300046558 | Bacteria | 1373 |
| 538 | Ga0495668_0002256 | 3300046616 | Bacteria | 16217 |
| 539 | Ga0495668_0023584 | 3300046616 | Bacteria | 3506 |
| 540 | Ga0495668_0026859 | 3300046616 | Bacteria | 3264 |
| 541 | Ga0495668_0027121 | 3300046616 | Bacteria | 3245 |
| 542 | Ga0495668_0027373 | 3300046616 | Bacteria | 3230 |
| 543 | Ga0495668_0225564 | 3300046616 | Bacteria | 1026 |
| 544 | Ga0495634_0043592 | 3300046642 | Bacteria | 3040 |
| 545 | Ga0495611_0002095 | 3300046648 | Bacteria | 9371 |
| 546 | Ga0495611_0003561 | 3300046648 | Bacteria | 6845 |
| 547 | Ga0495611_0004112 | 3300046648 | Bacteria | 6337 |
| 548 | Ga0495611_0040427 | 3300046648 | Bacteria | 2079 |
| 549 | Ga0495625_0000185 | 3300046660 | Bacteria | 97863 |
| 550 | Ga0495625_0074759 | 3300046660 | Bacteria | 2372 |
| 551 | Ga0495625_0096238 | 3300046660 | Bacteria | 2039 |
| 552 | Ga0495625_0099653 | 3300046660 | Bacteria | 1997 |
| 553 | Ga0495625_0104960 | 3300046660 | Bacteria | 1936 |
| 554 | Ga0495625_0112061 | 3300046660 | Bacteria | 1864 |
| 555 | Ga0495625_0115766 | 3300046660 | Bacteria | 1829 |
| 556 | Ga0495635_0038697 | 3300046663 | Bacteria | 3301 |
| 557 | Ga0495659_0006501 | 3300046664 | Bacteria | 3691 |
| 558 | Ga0495659_0010963 | 3300046664 | Bacteria | 2919 |
| 559 | Ga0495661_0000004 | 3300046665 | Bacteria | 555340 |
| 560 | Ga0495661_0000028 | 3300046665 | Bacteria | 182191 |
| 561 | Ga0495661_0000088 | 3300046665 | Bacteria | 111782 |
| 562 | Ga0495661_0000146 | 3300046665 | Bacteria | 82292 |
| 563 | Ga0495661_0006678 | 3300046665 | Bacteria | 8098 |
| 564 | Ga0495661_0007167 | 3300046665 | Bacteria | 7780 |
| 565 | Ga0495661_0007616 | 3300046665 | Bacteria | 7545 |
| 566 | Ga0495661_0033661 | 3300046665 | Bacteria | 3230 |
| 567 | Ga0495661_0051739 | 3300046665 | Bacteria | 2478 |
| 568 | Ga0495661_0064528 | 3300046665 | Bacteria | 2160 |
| 569 | Ga0495661_0113925 | 3300046665 | Bacteria | 1503 |
| 570 | Ga0495623_0042430 | 3300046679 | Bacteria | 2897 |
| 571 | Ga0495669_0016942 | 3300046684 | Bacteria | 3125 |
| 572 | Ga0495613_0145210 | 3300046689 | Bacteria | 1693 |
| 573 | Ga0495624_0087188 | 3300046690 | Bacteria | 1927 |
| 574 | Ga0495670_0009810 | 3300046691 | Bacteria | 4707 |
| 575 | Ga0495670_0011441 | 3300046691 | Bacteria | 4364 |
| 576 | Ga0495670_0093401 | 3300046691 | Bacteria | 1542 |
| 577 | Ga0495670_0183475 | 3300046691 | Bacteria | 1105 |
| 578 | Ga0495671_0007977 | 3300046692 | Bacteria | 5984 |
| 579 | Ga0495671_0022459 | 3300046692 | Bacteria | 3306 |
| 580 | Ga0495671_0026438 | 3300046692 | Bacteria | 3008 |
| 581 | Ga0495671_0026874 | 3300046692 | Bacteria | 2978 |
| 582 | Ga0495671_0033954 | 3300046692 | Bacteria | 2596 |
| 583 | Ga0495671_0058828 | 3300046692 | Bacteria | 1900 |
| 584 | Ga0495671_0059785 | 3300046692 | Bacteria | 1882 |
| 585 | Ga0495671_0070706 | 3300046692 | Bacteria | 1714 |
| 586 | Ga0495671_0072743 | 3300046692 | Bacteria | 1688 |
| 587 | Ga0495649_0000445 | 3300046694 | Bacteria | 35787 |
| 588 | Ga0495649_0000699 | 3300046694 | Bacteria | 27370 |
| 589 | Ga0495649_0001861 | 3300046694 | Bacteria | 15440 |
| 590 | Ga0495649_0018962 | 3300046694 | Bacteria | 3864 |
| 591 | Ga0495649_0034226 | 3300046694 | Bacteria | 2795 |
| 592 | Ga0495649_0041788 | 3300046694 | Bacteria | 2505 |
| 593 | Ga0495649_0047307 | 3300046694 | Bacteria | 2339 |
| 594 | Ga0495649_0049862 | 3300046694 | Bacteria | 2273 |
| 595 | Ga0495649_0055490 | 3300046694 | Bacteria | 2140 |
| 596 | Ga0495649_0083759 | 3300046694 | Bacteria | 1703 |
| 597 | Ga0495649_0085329 | 3300046694 | Bacteria | 1685 |
| 598 | Ga0495649_0089962 | 3300046694 | Bacteria | 1637 |
| 599 | Ga0495649_0103200 | 3300046694 | Bacteria | 1514 |
| 600 | Ga0495589_0002693 | 3300046794 | Bacteria | 9819 |
| 601 | Ga0495589_0022642 | 3300046794 | Bacteria | 3205 |
| 602 | Ga0495589_0032567 | 3300046794 | Bacteria | 2620 |
| 603 | Ga0495589_0050517 | 3300046794 | Bacteria | 2056 |
| 604 | Ga0495600_0074118 | 3300046809 | Bacteria | 2222 |
| 605 | Ga0495600_0104308 | 3300046809 | Bacteria | 1847 |
| 606 | Ga0495660_0003327 | 3300046810 | Bacteria | 9969 |
| 607 | Ga0495660_0006173 | 3300046810 | Bacteria | 7113 |
| 608 | Ga0495660_0020264 | 3300046810 | Bacteria | 3811 |
| 609 | Ga0495660_0032533 | 3300046810 | Bacteria | 2928 |
| 610 | Ga0495660_0039041 | 3300046810 | Bacteria | 2637 |
| 611 | Ga0495660_0071840 | 3300046810 | Bacteria | 1834 |
| 612 | Ga0495660_0079596 | 3300046810 | Bacteria | 1720 |
| 613 | Ga0495660_0091256 | 3300046810 | Bacteria | 1582 |
| 614 | Ga0495660_0098328 | 3300046810 | Bacteria | 1509 |
| 615 | Ga0495660_0159451 | 3300046810 | Bacteria | 1107 |
| 616 | Ga0495604_0074539 | 3300047317 | Bacteria | 2557 |
| 617 | Ga0495604_0163243 | 3300047317 | Bacteria | 1572 |
| 618 | Ga0495672_0001231 | 3300047320 | Bacteria | 25711 |
| 619 | Ga0495672_0023814 | 3300047320 | Bacteria | 3955 |
| 620 | Ga0495672_0026378 | 3300047320 | Bacteria | 3708 |
| 621 | Ga0495672_0028199 | 3300047320 | Bacteria | 3555 |
| 622 | Ga0495672_0033814 | 3300047320 | Bacteria | 3165 |
| 623 | Ga0495672_0035798 | 3300047320 | Bacteria | 3054 |
| 624 | Ga0495672_0045498 | 3300047320 | Bacteria | 2625 |
| 625 | Ga0495672_0054056 | 3300047320 | Bacteria | 2349 |
| 626 | Ga0495672_0060894 | 3300047320 | Bacteria | 2177 |
| 627 | Ga0495672_0065070 | 3300047320 | Bacteria | 2085 |
| 628 | Ga0495672_0084549 | 3300047320 | Bacteria | 1759 |
| 629 | Ga0495676_0000160 | 3300047321 | Bacteria | 51908 |
| 630 | Ga0495676_0064969 | 3300047321 | Bacteria | 2834 |
| 631 | Ga0495676_0295111 | 3300047321 | Bacteria | 1094 |
| 632 | Ga0495680_0059649 | 3300047322 | Bacteria | 2944 |
| 633 | Ga0495680_0139795 | 3300047322 | Bacteria | 1772 |
| 634 | Ga0495680_0302553 | 3300047322 | Bacteria | 1122 |
| 635 | Ga0495683_0000034 | 3300047323 | Bacteria | 148959 |
| 636 | Ga0495683_0000216 | 3300047323 | Bacteria | 54311 |
| 637 | Ga0495683_0010981 | 3300047323 | Bacteria | 4776 |
| 638 | Ga0495683_0022020 | 3300047323 | Bacteria | 3279 |
| 639 | Ga0495683_0051853 | 3300047323 | Bacteria | 2049 |
| 640 | Ga0495683_0089758 | 3300047323 | Bacteria | 1490 |
| 641 | Ga0495683_0129158 | 3300047323 | Bacteria | 1193 |
| 642 | Ga0495687_019903 | 3300047443 | Bacteria | 3281 |
| 643 | Ga0495677_0030674 | 3300047445 | Bacteria | 1956 |
| 644 | Ga0495679_000377 | 3300047446 | Bacteria | 34132 |
| 645 | Ga0495679_014863 | 3300047446 | Bacteria | 2866 |
| 646 | Ga0495679_015263 | 3300047446 | Bacteria | 2815 |
| 647 | Ga0495679_015573 | 3300047446 | Bacteria | 2777 |
| 648 | Ga0495679_021050 | 3300047446 | Bacteria | 2261 |
| 649 | Ga0495679_024414 | 3300047446 | Bacteria | 2037 |
| 650 | Ga0495679_031583 | 3300047446 | Bacteria | 1707 |
| 651 | Ga0495685_031430 | 3300047447 | Bacteria | 1825 |
| 652 | Ga0495673_0002712 | 3300047469 | Bacteria | 12168 |
| 653 | Ga0495673_0006452 | 3300047469 | Bacteria | 6889 |
| 654 | Ga0495673_0010072 | 3300047469 | Bacteria | 5170 |
| 655 | Ga0495673_0015923 | 3300047469 | Bacteria | 3858 |
| 656 | Ga0495673_0016934 | 3300047469 | Bacteria | 3713 |
| 657 | Ga0495673_0033689 | 3300047469 | Bacteria | 2374 |
| 658 | Ga0495673_0036706 | 3300047469 | Bacteria | 2244 |
| 659 | Ga0495673_0037163 | 3300047469 | Bacteria | 2226 |
| 660 | Ga0495673_0040815 | 3300047469 | Bacteria | 2092 |
| 661 | Ga0495673_0042642 | 3300047469 | Bacteria | 2035 |
| 662 | Ga0495673_0048050 | 3300047469 | Bacteria | 1883 |
| 663 | Ga0495673_0055315 | 3300047469 | Bacteria | 1721 |
| 664 | Ga0495673_0069862 | 3300047469 | Bacteria | 1480 |
| 665 | Ga0495673_0087283 | 3300047469 | Bacteria | 1280 |
| 666 | Ga0495681_0009159 | 3300047470 | Bacteria | 6125 |
| 667 | Ga0495681_0013039 | 3300047470 | Bacteria | 4850 |
| 668 | Ga0495681_0021377 | 3300047470 | Bacteria | 3489 |
| 669 | Ga0495681_0025854 | 3300047470 | Bacteria | 3066 |
| 670 | Ga0495681_0030486 | 3300047470 | Bacteria | 2745 |
| 671 | Ga0495681_0042194 | 3300047470 | Bacteria | 2209 |
| 672 | Ga0495681_0044007 | 3300047470 | Bacteria | 2149 |
| 673 | Ga0495681_0075821 | 3300047470 | Bacteria | 1513 |
| 674 | Ga0495681_0079196 | 3300047470 | Bacteria | 1470 |
| 675 | Ga0495684_0146740 | 3300047471 | Bacteria | 1766 |
| 676 | Ga0495686_0011832 | 3300047472 | Bacteria | 6137 |
| 677 | Ga0495686_0029647 | 3300047472 | Bacteria | 3558 |
| 678 | Ga0495686_0099960 | 3300047472 | Bacteria | 1750 |
| 679 | Ga0495686_0167550 | 3300047472 | Bacteria | 1279 |
| 680 | Ga0495593_0035166 | 3300047673 | Bacteria | 2721 |
| 681 | Ga0495593_0060514 | 3300047673 | Bacteria | 1982 |
| 682 | Ga0495602_0163305 | 3300048088 | Bacteria | 1736 |
| 683 | Ga0495626_0000125 | 3300048091 | Bacteria | 99451 |
| 684 | Ga0495626_0001796 | 3300048091 | Bacteria | 16211 |
| 685 | Ga0495626_0004821 | 3300048091 | Bacteria | 8133 |
| 686 | Ga0495626_0019437 | 3300048091 | Bacteria | 3398 |
| 687 | Ga0495626_0019580 | 3300048091 | Bacteria | 3384 |
| 688 | Ga0495626_0026534 | 3300048091 | Bacteria | 2822 |
| 689 | Ga0495626_0037187 | 3300048091 | Bacteria | 2314 |
| 690 | Ga0495626_0047813 | 3300048091 | Bacteria | 1987 |
| 691 | Ga0495626_0063581 | 3300048091 | Bacteria | 1673 |
| 692 | Ga0495626_0077874 | 3300048091 | Bacteria | 1477 |
| 693 | Ga0496102_0065015 | 3300048905 | Bacteria | 3342 |
| 694 | Ga0496102_0208392 | 3300048905 | Bacteria | 1843 |
| 695 | Ga0496110_0049992 | 3300048913 | Bacteria | 3670 |
| 696 | Ga0496110_0175404 | 3300048913 | Bacteria | 1945 |
| 697 | Ga0496115_0000372 | 3300048918 | Bacteria | 37081 |
| 698 | Ga0496116_0001043 | 3300048919 | Bacteria | 33784 |
| 699 | Ga0496116_0004638 | 3300048919 | Bacteria | 13019 |
| 700 | Ga0496116_0018663 | 3300048919 | Bacteria | 5335 |
| 701 | Ga0496116_0069705 | 3300048919 | Bacteria | 2234 |
| 702 | Ga0496116_0100650 | 3300048919 | Bacteria | 1727 |
| 703 | Ga0496116_0142693 | 3300048919 | Bacteria | 1344 |
| 704 | Ga0496117_0047000 | 3300048920 | Bacteria | 3100 |
| 705 | Ga0496117_0050821 | 3300048920 | Bacteria | 2937 |
| 706 | Ga0496117_0053566 | 3300048920 | Bacteria | 2833 |
| 707 | Ga0496117_0067336 | 3300048920 | Bacteria | 2423 |
| 708 | Ga0496117_0086027 | 3300048920 | Bacteria | 2044 |
| 709 | Ga0496117_0091099 | 3300048920 | Bacteria | 1962 |
| 710 | Ga0496117_0094012 | 3300048920 | Bacteria | 1920 |
| 711 | Ga0496118_0044010 | 3300048921 | Bacteria | 3500 |
| 712 | Ga0496118_0071816 | 3300048921 | Bacteria | 2489 |
| 713 | Ga0496118_0086981 | 3300048921 | Bacteria | 2169 |
| 714 | Ga0496118_0144446 | 3300048921 | Bacteria | 1501 |
| 715 | Ga0496118_0181456 | 3300048921 | Bacteria | 1271 |
| 716 | Ga0496120_0122213 | 3300048923 | Bacteria | 1344 |
| 717 | Ga0496120_0142244 | 3300048923 | Bacteria | 1216 |
| 718 | Ga0496121_0002337 | 3300048924 | Bacteria | 29283 |
| 719 | Ga0496121_0004179 | 3300048924 | Bacteria | 19722 |
| 720 | Ga0496121_0038182 | 3300048924 | Bacteria | 4257 |
| 721 | Ga0496121_0097272 | 3300048924 | Bacteria | 2281 |
| 722 | Ga0496122_0021670 | 3300048925 | Bacteria | 5743 |
| 723 | Ga0496122_0026521 | 3300048925 | Bacteria | 4991 |
| 724 | Ga0496122_0046468 | 3300048925 | Bacteria | 3361 |
| 725 | Ga0496122_0072157 | 3300048925 | Bacteria | 2456 |
| 726 | Ga0496122_0077118 | 3300048925 | Bacteria | 2342 |
| 727 | Ga0496122_0164504 | 3300048925 | Bacteria | 1347 |
| 728 | Ga0496123_0001511 | 3300048926 | Bacteria | 32223 |
| 729 | Ga0496123_0041688 | 3300048926 | Bacteria | 3177 |
| 730 | Ga0496123_0059724 | 3300048926 | Bacteria | 2462 |
| 731 | Ga0496123_0104605 | 3300048926 | Bacteria | 1636 |
| 732 | Ga0496123_0105572 | 3300048926 | Bacteria | 1625 |
| 733 | Ga0496123_0109509 | 3300048926 | Bacteria | 1582 |
| 734 | Ga0496123_0118448 | 3300048926 | Bacteria | 1495 |
| 735 | Ga0496124_0001524 | 3300048927 | Bacteria | 33727 |
| 736 | Ga0496124_0001773 | 3300048927 | Bacteria | 30021 |
| 737 | Ga0496124_0033048 | 3300048927 | Bacteria | 4556 |
| 738 | Ga0496124_0054267 | 3300048927 | Bacteria | 3393 |
| 739 | Ga0496124_0062509 | 3300048927 | Bacteria | 3115 |
| 740 | Ga0496124_0063450 | 3300048927 | Bacteria | 3086 |
| 741 | Ga0496124_0075351 | 3300048927 | Bacteria | 2787 |
| 742 | Ga0496124_0239997 | 3300048927 | Bacteria | 1348 |
| 743 | Ga0496125_0091942 | 3300048928 | Bacteria | 2270 |
| 744 | Ga0496125_0115071 | 3300048928 | Bacteria | 1935 |
| 745 | Ga0496125_0165927 | 3300048928 | Bacteria | 1492 |
| 746 | Ga0496125_0231127 | 3300048928 | Bacteria | 1182 |
| 747 | Ga0496126_0032090 | 3300048929 | Bacteria | 4953 |
| 748 | Ga0496126_0092027 | 3300048929 | Bacteria | 2665 |
| 749 | Ga0496126_0125710 | 3300048929 | Bacteria | 2219 |
| 750 | Ga0495678_000049 | 3300049459 | Bacteria | 163929 |
| 751 | Ga0495678_000918 | 3300049459 | Bacteria | 25900 |
| 752 | Ga0495678_001783 | 3300049459 | Bacteria | 15918 |
| 753 | Ga0495678_016655 | 3300049459 | Bacteria | 3353 |
| 754 | Ga0495678_016849 | 3300049459 | Bacteria | 3327 |
| 755 | Ga0495678_017909 | 3300049459 | Bacteria | 3197 |
| 756 | Ga0495678_019253 | 3300049459 | Bacteria | 3049 |
| 757 | Ga0495678_032576 | 3300049459 | Bacteria | 2158 |
| 758 | Ga0495678_042946 | 3300049459 | Bacteria | 1798 |
| 759 | Ga0495678_062025 | 3300049459 | Bacteria | 1400 |
| 760 | Ga0495678_074266 | 3300049459 | Bacteria | 1237 |
| 761 | Ga0495678_080216 | 3300049459 | Bacteria | 1173 |
| 762 | Ga0495682_0000153 | 3300049460 | Bacteria | 59021 |
| 763 | Ga0495682_0004151 | 3300049460 | Bacteria | 6281 |
| 764 | Ga0495682_0020304 | 3300049460 | Bacteria | 2494 |
| 765 | Ga0495682_0021639 | 3300049460 | Bacteria | 2408 |
| 766 | Ga0495682_0042657 | 3300049460 | Bacteria | 1662 |
| 767 | Ga0495682_0065185 | 3300049460 | Bacteria | 1313 |
| 768 | Ga0495682_0086038 | 3300049460 | Bacteria | 1129 |
| 769 | Ga0501031_0111953 | 3300049568 | Bacteria | 1783 |
| 770 | Ga0501037_0302412 | 3300049573 | Bacteria | 1111 |
| 771 | Ga0501222_004172 | 3300049662 | Bacteria | 1963 |
| 772 | Ga0501241_004405 | 3300049758 | Bacteria | 2641 |
| 773 | Ga0501226_000017 | 3300049853 | Bacteria | 150879 |
| 774 | nmdc:mga03683_112256_c1 | 3300050489 | Bacteria | 1206 |
| 775 | nmdc:mga03683_2291_c1 | 3300050489 | Bacteria | 4706 |
| 776 | nmdc:mga00v17_117429_c1 | 3300050491 | Bacteria | 1692 |
| 777 | nmdc:mga0sz30_19496_c1 | 3300050516 | Bacteria | 2728 |
| 778 | Ga0500572_004688 | 3300053111 | Bacteria | 3100 |
| 779 | Ga0500618_025028 | 3300053125 | Bacteria | 1433 |
| 780 | Ga0500573_0040451 | 3300053140 | Bacteria | 2692 |
| 781 | Ga0500552_001318 | 3300053733 | Bacteria | 2362 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042156 | Ga0439446_0000026 | Ga0439446_0000026_12997_13977 | 259 |
| 2 | 3300041411 | Ga0439466_0004608 | Ga0439466_0004608_2495_3478 | 264 |
| 3 | 3300015261 | Ga0182006_1021402 | Ga0182006_10214021 | 268 |
| 4 | 3300042016 | Ga0439463_001299 | Ga0439463_001299_290_1195 | 272 |
| 5 | iso_pu_bacteria | 2919697872 | 2919699279 | 277 |
| 6 | 3300046474 | Ga0495605_0047399 | Ga0495605_0047399_278_1123 | 281 |
| 7 | 3300046507 | Ga0495606_0003873 | Ga0495606_0003873_27_872 | 281 |
| 8 | 3300005434 | Ga0070709_10380710 | Ga0070709_103807101 | 284 |
| 9 | 3300005518 | Ga0070699_100484596 | Ga0070699_1004845961 | 284 |
| 10 | 3300006177 | Ga0075362_10031647 | Ga0075362_100316473 | 284 |
| 11 | 3300006177 | Ga0075362_10092813 | Ga0075362_100928131 | 284 |
| 12 | 3300006186 | Ga0075369_10005588 | Ga0075369_100055882 | 284 |
| 13 | 3300010159 | Ga0099796_10102136 | Ga0099796_101021361 | 284 |
| 14 | 3300025910 | Ga0207684_10407806 | Ga0207684_104078061 | 284 |
| 15 | 3300035695 | Ga0373927_0179601 | Ga0373927_0179601_221_1225 | 284 |
| 16 | 3300037312 | Ga0395899_0022460 | Ga0395899_0022460_29_1018 | 284 |
| 17 | 3300037418 | Ga0395900_0054481 | Ga0395900_0054481_3078_4067 | 284 |
| 18 | 3300037466 | Ga0395898_0026985 | Ga0395898_0026985_4451_5440 | 284 |
| 19 | 3300046453 | Ga0495627_002117 | Ga0495627_002117_8264_9151 | 284 |
| 20 | 3300046471 | Ga0495650_0040558 | Ga0495650_0040558_616_1503 | 284 |
| 21 | 3300046518 | Ga0495631_0000361 | Ga0495631_0000361_29815_30702 | 284 |
| 22 | 3300046519 | Ga0495632_0055072 | Ga0495632_0055072_668_1555 | 284 |
| 23 | 3300046530 | Ga0495654_0001014 | Ga0495654_0001014_14555_15442 | 284 |
| 24 | 3300046692 | Ga0495671_0022459 | Ga0495671_0022459_938_1825 | 284 |
| 25 | 3300047320 | Ga0495672_0054056 | Ga0495672_0054056_1127_2014 | 284 |
| 26 | 3300050489 | nmdc:mga03683_112256_c1 | nmdc:mga03683_112256_c1_249_1166 | 284 |
| 27 | 3300050489 | nmdc:mga03683_2291_c1 | nmdc:mga03683_2291_c1_1445_2437 | 284 |
| 28 | 3300050516 | nmdc:mga0sz30_19496_c1 | nmdc:mga0sz30_19496_c1_1295_2287 | 284 |
| 29 | 3300053733 | Ga0500552_001318 | Ga0500552_001318_35_1027 | 284 |
| 30 | 3300005937 | Ga0081455_10008620 | Ga0081455_100086203 | 285 |
| 31 | 3300002737 | JGI25162J39368_1000018 | JGI25162J39368_1000018180 | 286 |
| 32 | 3300002741 | JGI25157J39369_1000011 | JGI25157J39369_10000119 | 286 |
| 33 | 3300002771 | JGI25163J39215_1000612 | JGI25163J39215_10006129 | 286 |
| 34 | 3300002772 | JGI25164J39214_1000007 | JGI25164J39214_1000007180 | 286 |
| 35 | 3300003214 | JGI25165J46597_1000029 | JGI25165J46597_1000029107 | 286 |
| 36 | 3300003761 | Ga0055535_1000025 | Ga0055535_100002513 | 286 |
| 37 | 3300003761 | Ga0055535_1000103 | Ga0055535_100010314 | 286 |
| 38 | 3300003762 | Ga0055542_1000010 | Ga0055542_1000010334 | 286 |
| 39 | 3300003762 | Ga0055542_1000024 | Ga0055542_1000024180 | 286 |
| 40 | 3300003763 | Ga0055529_1000029 | Ga0055529_1000029180 | 286 |
| 41 | 3300025224 | Ga0209784_100026 | Ga0209784_100026168 | 286 |
| 42 | 3300025225 | Ga0209566_102356 | Ga0209566_1023565 | 286 |
| 43 | 3300025228 | Ga0209672_102246 | Ga0209672_1022466 | 286 |
| 44 | 3300025231 | Ga0207427_100023 | Ga0207427_100023168 | 286 |
| 45 | 3300025233 | Ga0209437_100069 | Ga0209437_10006994 | 286 |
| 46 | 3300025233 | Ga0209437_100245 | Ga0209437_1002457 | 286 |
| 47 | 3300025242 | Ga0209258_100059 | Ga0209258_100059168 | 286 |
| 48 | 3300025242 | Ga0209258_101292 | Ga0209258_1012926 | 286 |
| 49 | 3300025246 | Ga0209646_1001047 | Ga0209646_10010474 | 286 |
| 50 | 3300025250 | Ga0209026_1000036 | Ga0209026_100003685 | 286 |
| 51 | 3300025254 | Ga0209148_1000005 | Ga0209148_100000517 | 286 |
| 52 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010167 | 286 |
| 53 | 3300025256 | Ga0209759_1000023 | Ga0209759_10000236 | 286 |
| 54 | 3300025256 | Ga0209759_1002192 | Ga0209759_10021924 | 286 |
| 55 | 3300025261 | Ga0209233_1000009 | Ga0209233_10000091004 | 286 |
| 56 | 3300025272 | Ga0209455_1000020 | Ga0209455_1000020436 | 286 |
| 57 | 3300041404 | Ga0439436_0016475 | Ga0439436_0016475_95_1060 | 286 |
| 58 | 3300041405 | Ga0439438_002391 | Ga0439438_002391_1116_2081 | 286 |
| 59 | 3300041407 | Ga0439447_001809 | Ga0439447_001809_1030_1995 | 286 |
| 60 | 3300041411 | Ga0439466_0009682 | Ga0439466_0009682_1706_2566 | 286 |
| 61 | 3300041411 | Ga0439466_0017268 | Ga0439466_0017268_1371_2336 | 286 |
| 62 | 3300042006 | Ga0439432_002368 | Ga0439432_002368_1104_2069 | 286 |
| 63 | 3300046507 | Ga0495606_0003110 | Ga0495606_0003110_16681_17658 | 286 |
| 64 | 3300046694 | Ga0495649_0000699 | Ga0495649_0000699_16065_17042 | 286 |
| 65 | 3300048918 | Ga0496115_0000372 | Ga0496115_0000372_19736_20713 | 286 |
| 66 | 3300048929 | Ga0496126_0032090 | Ga0496126_0032090_2836_3813 | 286 |
| 67 | 3300049460 | Ga0495682_0021639 | Ga0495682_0021639_1065_2042 | 286 |
| 68 | iso_pu_bacteria | 2928963466 | 2928963945 | 286 |
| 69 | 3300002067 | JGI24735J21928_10001792 | JGI24735J21928_100017924 | 287 |
| 70 | 3300025242 | Ga0209258_101045 | Ga0209258_1010459 | 287 |
| 71 | 3300039062 | Ga0400483_011826 | Ga0400483_011826_1565_2533 | 287 |
| 72 | 3300039062 | Ga0400483_279756 | Ga0400483_279756_1699_2667 | 287 |
| 73 | iso_pu_bacteria | 2912963787 | 2912967695 | 287 |
| 74 | iso_pu_bacteria | 2923153595 | 2923158101 | 287 |
| 75 | 2124908027 | MRS2a_Contig_9054 | MRS2a_00417880 | 291 |
| 76 | 2162886007 | SwRhRL2b_contig_249379 | SwRhRL2b_0881.00007150 | 291 |
| 77 | 2162886007 | SwRhRL2b_contig_3818765 | SwRhRL2b_0405.00001640 | 291 |
| 78 | 3300002771 | JGI25163J39215_1001671 | JGI25163J39215_10016711 | 291 |
| 79 | 3300002771 | JGI25163J39215_1001757 | JGI25163J39215_10017574 | 291 |
| 80 | 3300002772 | JGI25164J39214_1000194 | JGI25164J39214_100019411 | 291 |
| 81 | 3300002772 | JGI25164J39214_1000513 | JGI25164J39214_10005135 | 291 |
| 82 | 3300003214 | JGI25165J46597_1000348 | JGI25165J46597_100034811 | 291 |
| 83 | 3300003214 | JGI25165J46597_1000430 | JGI25165J46597_10004305 | 291 |
| 84 | 3300003781 | Ga0055536_1000111 | Ga0055536_100011159 | 291 |
| 85 | 3300003791 | Ga0055530_10000146 | Ga0055530_1000014616 | 291 |
| 86 | 3300003791 | Ga0055530_10001124 | Ga0055530_1000112418 | 291 |
| 87 | 3300003792 | Ga0055540_1000822 | Ga0055540_100082218 | 291 |
| 88 | 3300003792 | Ga0055540_1001173 | Ga0055540_10011737 | 291 |
| 89 | 3300003792 | Ga0055540_1001379 | Ga0055540_10013798 | 291 |
| 90 | 3300003794 | Ga0055531_10005378 | Ga0055531_100053783 | 291 |
| 91 | 3300005288 | Ga0065714_10003020 | Ga0065714_100030207 | 291 |
| 92 | 3300005288 | Ga0065714_10008503 | Ga0065714_100085034 | 291 |
| 93 | 3300005288 | Ga0065714_10010964 | Ga0065714_100109642 | 291 |
| 94 | 3300005289 | Ga0065704_10000811 | Ga0065704_1000081116 | 291 |
| 95 | 3300005289 | Ga0065704_10128936 | Ga0065704_101289361 | 291 |
| 96 | 3300005290 | Ga0065712_10001766 | Ga0065712_100017661 | 291 |
| 97 | 3300005290 | Ga0065712_10067928 | Ga0065712_100679281 | 291 |
| 98 | 3300005290 | Ga0065712_10095511 | Ga0065712_100955111 | 291 |
| 99 | 3300005331 | Ga0070670_100001032 | Ga0070670_10000103220 | 291 |
| 100 | 3300005331 | Ga0070670_100039965 | Ga0070670_1000399652 | 291 |
| 101 | 3300005344 | Ga0070661_100000410 | Ga0070661_10000041017 | 291 |
| 102 | 3300005457 | Ga0070662_100000575 | Ga0070662_1000005754 | 291 |
| 103 | 3300005457 | Ga0070662_100231300 | Ga0070662_1002313002 | 291 |
| 104 | 3300005539 | Ga0068853_100017790 | Ga0068853_1000177902 | 291 |
| 105 | 3300005564 | Ga0070664_100000377 | Ga0070664_10000037717 | 291 |
| 106 | 3300005564 | Ga0070664_100508048 | Ga0070664_1005080481 | 291 |
| 107 | 3300005578 | Ga0068854_100020669 | Ga0068854_1000206693 | 291 |
| 108 | 3300005834 | Ga0068851_10000251 | Ga0068851_100002516 | 291 |
| 109 | 3300006051 | Ga0075364_10111970 | Ga0075364_101119702 | 291 |
| 110 | 3300006058 | Ga0075432_10001356 | Ga0075432_100013564 | 291 |
| 111 | 3300006058 | Ga0075432_10004567 | Ga0075432_100045672 | 291 |
| 112 | 3300006058 | Ga0075432_10033448 | Ga0075432_100334481 | 291 |
| 113 | 3300006058 | Ga0075432_10071867 | Ga0075432_100718672 | 291 |
| 114 | 3300006177 | Ga0075362_10052897 | Ga0075362_100528972 | 291 |
| 115 | 3300006946 | Ga0079104_1000364 | Ga0079104_100036439 | 291 |
| 116 | 3300009011 | Ga0105251_10000275 | Ga0105251_1000027532 | 291 |
| 117 | 3300009011 | Ga0105251_10000284 | Ga0105251_100002845 | 291 |
| 118 | 3300009011 | Ga0105251_10003067 | Ga0105251_100030674 | 291 |
| 119 | 3300009011 | Ga0105251_10003252 | Ga0105251_100032522 | 291 |
| 120 | 3300009011 | Ga0105251_10004649 | Ga0105251_100046497 | 291 |
| 121 | 3300009011 | Ga0105251_10005474 | Ga0105251_100054748 | 291 |
| 122 | 3300009011 | Ga0105251_10007774 | Ga0105251_100077745 | 291 |
| 123 | 3300009011 | Ga0105251_10017472 | Ga0105251_100174722 | 291 |
| 124 | 3300009011 | Ga0105251_10019528 | Ga0105251_100195284 | 291 |
| 125 | 3300009011 | Ga0105251_10021821 | Ga0105251_100218211 | 291 |
| 126 | 3300009011 | Ga0105251_10028781 | Ga0105251_100287811 | 291 |
| 127 | 3300009011 | Ga0105251_10050514 | Ga0105251_100505141 | 291 |
| 128 | 3300009011 | Ga0105251_10068203 | Ga0105251_100682032 | 291 |
| 129 | 3300009011 | Ga0105251_10122040 | Ga0105251_101220402 | 291 |
| 130 | 3300009036 | Ga0105244_10000248 | Ga0105244_1000024841 | 291 |
| 131 | 3300009036 | Ga0105244_10001261 | Ga0105244_1000126118 | 291 |
| 132 | 3300009036 | Ga0105244_10009784 | Ga0105244_100097846 | 291 |
| 133 | 3300009036 | Ga0105244_10012090 | Ga0105244_100120901 | 291 |
| 134 | 3300009036 | Ga0105244_10020378 | Ga0105244_100203783 | 291 |
| 135 | 3300009036 | Ga0105244_10026295 | Ga0105244_100262954 | 291 |
| 136 | 3300009036 | Ga0105244_10043759 | Ga0105244_100437592 | 291 |
| 137 | 3300009036 | Ga0105244_10079305 | Ga0105244_100793052 | 291 |
| 138 | 3300009092 | Ga0105250_10000232 | Ga0105250_1000023228 | 291 |
| 139 | 3300009092 | Ga0105250_10001490 | Ga0105250_1000149012 | 291 |
| 140 | 3300009092 | Ga0105250_10001860 | Ga0105250_100018602 | 291 |
| 141 | 3300009092 | Ga0105250_10016458 | Ga0105250_100164581 | 291 |
| 142 | 3300009092 | Ga0105250_10023495 | Ga0105250_100234951 | 291 |
| 143 | 3300009092 | Ga0105250_10050018 | Ga0105250_100500181 | 291 |
| 144 | 3300009148 | Ga0105243_10001441 | Ga0105243_1000144115 | 291 |
| 145 | 3300009148 | Ga0105243_10002007 | Ga0105243_1000200715 | 291 |
| 146 | 3300009148 | Ga0105243_10053799 | Ga0105243_100537992 | 291 |
| 147 | 3300009148 | Ga0105243_10200929 | Ga0105243_102009292 | 291 |
| 148 | 3300009176 | Ga0105242_10002563 | Ga0105242_1000256310 | 291 |
| 149 | 3300009545 | Ga0105237_10002926 | Ga0105237_100029267 | 291 |
| 150 | 3300009553 | Ga0105249_10098399 | Ga0105249_100983993 | 291 |
| 151 | 3300011119 | Ga0105246_10001555 | Ga0105246_100015557 | 291 |
| 152 | 3300011119 | Ga0105246_10015749 | Ga0105246_100157492 | 291 |
| 153 | 3300011119 | Ga0105246_10023510 | Ga0105246_100235102 | 291 |
| 154 | 3300011119 | Ga0105246_10055583 | Ga0105246_100555831 | 291 |
| 155 | 3300012498 | Ga0157345_1000292 | Ga0157345_10002927 | 291 |
| 156 | 3300013100 | Ga0157373_10002707 | Ga0157373_100027077 | 291 |
| 157 | 3300013100 | Ga0157373_10013017 | Ga0157373_100130173 | 291 |
| 158 | 3300013100 | Ga0157373_10014185 | Ga0157373_100141857 | 291 |
| 159 | 3300013100 | Ga0157373_10111685 | Ga0157373_101116851 | 291 |
| 160 | 3300013100 | Ga0157373_10140465 | Ga0157373_101404652 | 291 |
| 161 | 3300013102 | Ga0157371_10003281 | Ga0157371_100032818 | 291 |
| 162 | 3300013102 | Ga0157371_10004368 | Ga0157371_100043682 | 291 |
| 163 | 3300013102 | Ga0157371_10014445 | Ga0157371_100144457 | 291 |
| 164 | 3300013102 | Ga0157371_10137678 | Ga0157371_101376782 | 291 |
| 165 | 3300013104 | Ga0157370_10000162 | Ga0157370_1000016228 | 291 |
| 166 | 3300013104 | Ga0157370_10031069 | Ga0157370_100310692 | 291 |
| 167 | 3300013104 | Ga0157370_10043496 | Ga0157370_100434962 | 291 |
| 168 | 3300013104 | Ga0157370_10085672 | Ga0157370_100856722 | 291 |
| 169 | 3300013104 | Ga0157370_10109001 | Ga0157370_101090012 | 291 |
| 170 | 3300013104 | Ga0157370_10183943 | Ga0157370_101839431 | 291 |
| 171 | 3300013104 | Ga0157370_10192611 | Ga0157370_101926112 | 291 |
| 172 | 3300013105 | Ga0157369_10024884 | Ga0157369_100248847 | 291 |
| 173 | 3300013105 | Ga0157369_10030369 | Ga0157369_100303697 | 291 |
| 174 | 3300013105 | Ga0157369_10032322 | Ga0157369_100323221 | 291 |
| 175 | 3300013105 | Ga0157369_10086755 | Ga0157369_100867551 | 291 |
| 176 | 3300013306 | Ga0163162_10009884 | Ga0163162_100098847 | 291 |
| 177 | 3300013306 | Ga0163162_10286440 | Ga0163162_102864402 | 291 |
| 178 | 3300013307 | Ga0157372_10086657 | Ga0157372_100866574 | 291 |
| 179 | 3300013308 | Ga0157375_10097473 | Ga0157375_100974734 | 291 |
| 180 | 3300013308 | Ga0157375_10766014 | Ga0157375_107660141 | 291 |
| 181 | 3300014497 | Ga0182008_10005686 | Ga0182008_100056868 | 291 |
| 182 | 3300014497 | Ga0182008_10011957 | Ga0182008_100119574 | 291 |
| 183 | 3300014497 | Ga0182008_10021333 | Ga0182008_100213334 | 291 |
| 184 | 3300014497 | Ga0182008_10021424 | Ga0182008_100214242 | 291 |
| 185 | 3300014497 | Ga0182008_10041281 | Ga0182008_100412812 | 291 |
| 186 | 3300015261 | Ga0182006_1001230 | Ga0182006_10012301 | 291 |
| 187 | 3300015261 | Ga0182006_1002590 | Ga0182006_10025905 | 291 |
| 188 | 3300015261 | Ga0182006_1008846 | Ga0182006_10088463 | 291 |
| 189 | 3300015261 | Ga0182006_1023158 | Ga0182006_10231581 | 291 |
| 190 | 3300015261 | Ga0182006_1026917 | Ga0182006_10269172 | 291 |
| 191 | 3300015261 | Ga0182006_1056635 | Ga0182006_10566352 | 291 |
| 192 | 3300015261 | Ga0182006_1070478 | Ga0182006_10704781 | 291 |
| 193 | 3300015262 | Ga0182007_10001571 | Ga0182007_100015712 | 291 |
| 194 | 3300015262 | Ga0182007_10002759 | Ga0182007_100027594 | 291 |
| 195 | 3300015262 | Ga0182007_10021435 | Ga0182007_100214353 | 291 |
| 196 | 3300015265 | Ga0182005_1004406 | Ga0182005_10044063 | 291 |
| 197 | 3300015265 | Ga0182005_1005003 | Ga0182005_10050034 | 291 |
| 198 | 3300015265 | Ga0182005_1017950 | Ga0182005_10179501 | 291 |
| 199 | 3300015265 | Ga0182005_1022377 | Ga0182005_10223771 | 291 |
| 200 | 3300015265 | Ga0182005_1022935 | Ga0182005_10229351 | 291 |
| 201 | 3300015265 | Ga0182005_1023813 | Ga0182005_10238132 | 291 |
| 202 | 3300017792 | Ga0163161_10012776 | Ga0163161_100127761 | 291 |
| 203 | 3300025207 | Ga0209760_100011 | Ga0209760_1000112 | 291 |
| 204 | 3300025207 | Ga0209760_100064 | Ga0209760_10006411 | 291 |
| 205 | 3300025230 | Ga0209563_100694 | Ga0209563_1006945 | 291 |
| 206 | 3300025231 | Ga0207427_100008 | Ga0207427_100008183 | 291 |
| 207 | 3300025231 | Ga0207427_100082 | Ga0207427_100082123 | 291 |
| 208 | 3300025233 | Ga0209437_100006 | Ga0209437_100006254 | 291 |
| 209 | 3300025233 | Ga0209437_100014 | Ga0209437_100014528 | 291 |
| 210 | 3300025256 | Ga0209759_1021902 | Ga0209759_10219021 | 291 |
| 211 | 3300025261 | Ga0209233_1000008 | Ga0209233_1000008528 | 291 |
| 212 | 3300025261 | Ga0209233_1000105 | Ga0209233_1000105235 | 291 |
| 213 | 3300025284 | Ga0209130_1022753 | Ga0209130_10227532 | 291 |
| 214 | 3300025292 | Ga0209676_1000006 | Ga0209676_1000006235 | 291 |
| 215 | 3300025292 | Ga0209676_1000369 | Ga0209676_100036980 | 291 |
| 216 | 3300025292 | Ga0209676_1001140 | Ga0209676_10011405 | 291 |
| 217 | 3300025292 | Ga0209676_1003514 | Ga0209676_10035143 | 291 |
| 218 | 3300025292 | Ga0209676_1004051 | Ga0209676_10040513 | 291 |
| 219 | 3300025298 | Ga0209050_1000070 | Ga0209050_1000070284 | 291 |
| 220 | 3300025298 | Ga0209050_1000235 | Ga0209050_1000235111 | 291 |
| 221 | 3300025298 | Ga0209050_1000380 | Ga0209050_100038080 | 291 |
| 222 | 3300025298 | Ga0209050_1001241 | Ga0209050_10012413 | 291 |
| 223 | 3300025303 | Ga0209051_1000086 | Ga0209051_1000086117 | 291 |
| 224 | 3300025303 | Ga0209051_1000123 | Ga0209051_10001235 | 291 |
| 225 | 3300025303 | Ga0209051_1001064 | Ga0209051_100106418 | 291 |
| 226 | 3300025303 | Ga0209051_1036421 | Ga0209051_10364212 | 291 |
| 227 | 3300025303 | Ga0209051_1051857 | Ga0209051_10518571 | 291 |
| 228 | 3300025304 | Ga0209257_1000421 | Ga0209257_100042180 | 291 |
| 229 | 3300025304 | Ga0209257_1010774 | Ga0209257_10107742 | 291 |
| 230 | 3300025321 | Ga0207656_10000094 | Ga0207656_100000943 | 291 |
| 231 | 3300025711 | Ga0207696_1000025 | Ga0207696_1000025295 | 291 |
| 232 | 3300025711 | Ga0207696_1000161 | Ga0207696_100016136 | 291 |
| 233 | 3300025711 | Ga0207696_1000399 | Ga0207696_100039928 | 291 |
| 234 | 3300025711 | Ga0207696_1002704 | Ga0207696_10027045 | 291 |
| 235 | 3300025711 | Ga0207696_1004662 | Ga0207696_10046627 | 291 |
| 236 | 3300025711 | Ga0207696_1010679 | Ga0207696_10106792 | 291 |
| 237 | 3300025728 | Ga0207655_1000113 | Ga0207655_100011357 | 291 |
| 238 | 3300025728 | Ga0207655_1000269 | Ga0207655_100026931 | 291 |
| 239 | 3300025728 | Ga0207655_1000976 | Ga0207655_10009767 | 291 |
| 240 | 3300025728 | Ga0207655_1002157 | Ga0207655_10021572 | 291 |
| 241 | 3300025728 | Ga0207655_1003563 | Ga0207655_10035638 | 291 |
| 242 | 3300025728 | Ga0207655_1004512 | Ga0207655_10045126 | 291 |
| 243 | 3300025728 | Ga0207655_1011189 | Ga0207655_10111892 | 291 |
| 244 | 3300025728 | Ga0207655_1016647 | Ga0207655_10166472 | 291 |
| 245 | 3300025728 | Ga0207655_1065760 | Ga0207655_10657601 | 291 |
| 246 | 3300025735 | Ga0207713_1000102 | Ga0207713_100010224 | 291 |
| 247 | 3300025735 | Ga0207713_1000344 | Ga0207713_10003445 | 291 |
| 248 | 3300025735 | Ga0207713_1001819 | Ga0207713_100181915 | 291 |
| 249 | 3300025735 | Ga0207713_1002656 | Ga0207713_10026566 | 291 |
| 250 | 3300025735 | Ga0207713_1003166 | Ga0207713_10031662 | 291 |
| 251 | 3300025735 | Ga0207713_1005358 | Ga0207713_10053588 | 291 |
| 252 | 3300025735 | Ga0207713_1006303 | Ga0207713_10063034 | 291 |
| 253 | 3300025735 | Ga0207713_1006787 | Ga0207713_10067873 | 291 |
| 254 | 3300025735 | Ga0207713_1021584 | Ga0207713_10215843 | 291 |
| 255 | 3300025735 | Ga0207713_1035118 | Ga0207713_10351181 | 291 |
| 256 | 3300025914 | Ga0207671_10001551 | Ga0207671_1000155117 | 291 |
| 257 | 3300025920 | Ga0207649_10000061 | Ga0207649_1000006183 | 291 |
| 258 | 3300025923 | Ga0207681_10013490 | Ga0207681_100134902 | 291 |
| 259 | 3300025925 | Ga0207650_10000419 | Ga0207650_1000041912 | 291 |
| 260 | 3300025925 | Ga0207650_10001683 | Ga0207650_1000168310 | 291 |
| 261 | 3300025933 | Ga0207706_10000668 | Ga0207706_1000066825 | 291 |
| 262 | 3300025934 | Ga0207686_10002078 | Ga0207686_100020789 | 291 |
| 263 | 3300025935 | Ga0207709_10000223 | Ga0207709_100002237 | 291 |
| 264 | 3300025935 | Ga0207709_10000835 | Ga0207709_1000083514 | 291 |
| 265 | 3300025935 | Ga0207709_10030251 | Ga0207709_100302513 | 291 |
| 266 | 3300025935 | Ga0207709_10049445 | Ga0207709_100494452 | 291 |
| 267 | 3300025945 | Ga0207679_10000018 | Ga0207679_10000018208 | 291 |
| 268 | 3300025981 | Ga0207640_10018613 | Ga0207640_100186132 | 291 |
| 269 | 3300026041 | Ga0207639_10016158 | Ga0207639_100161582 | 291 |
| 270 | 3300027111 | Ga0209281_1000010 | Ga0209281_1000010561 | 291 |
| 271 | 3300027111 | Ga0209281_1000331 | Ga0209281_100033167 | 291 |
| 272 | 3300027111 | Ga0209281_1002825 | Ga0209281_10028254 | 291 |
| 273 | 3300027312 | Ga0209371_1000365 | Ga0209371_100036511 | 291 |
| 274 | 3300027907 | Ga0207428_10021464 | Ga0207428_100214646 | 291 |
| 275 | 3300027907 | Ga0207428_10026590 | Ga0207428_100265903 | 291 |
| 276 | 3300027907 | Ga0207428_10105296 | Ga0207428_101052963 | 291 |
| 277 | 3300027907 | Ga0207428_10133142 | Ga0207428_101331422 | 291 |
| 278 | 3300027907 | Ga0207428_10242544 | Ga0207428_102425441 | 291 |
| 279 | 3300030500 | Ga0268256_1000236 | Ga0268256_100023620 | 291 |
| 280 | 3300030733 | Ga0314311_1137078 | Ga0314311_11370782 | 291 |
| 281 | 3300030735 | Ga0316178_1174406 | Ga0316178_117440612 | 291 |
| 282 | 3300031548 | Ga0307408_100000025 | Ga0307408_10000002546 | 291 |
| 283 | 3300031548 | Ga0307408_100036272 | Ga0307408_1000362724 | 291 |
| 284 | 3300031548 | Ga0307408_100144895 | Ga0307408_1001448951 | 291 |
| 285 | 3300031730 | Ga0307516_10194648 | Ga0307516_101946482 | 291 |
| 286 | 3300031731 | Ga0307405_10040867 | Ga0307405_100408672 | 291 |
| 287 | 3300031911 | Ga0307412_10115724 | Ga0307412_101157243 | 291 |
| 288 | 3300031911 | Ga0307412_10325564 | Ga0307412_103255641 | 291 |
| 289 | 3300031995 | Ga0307409_100026395 | Ga0307409_1000263955 | 291 |
| 290 | 3300032004 | Ga0307414_10062721 | Ga0307414_100627212 | 291 |
| 291 | 3300032004 | Ga0307414_10096469 | Ga0307414_100964692 | 291 |
| 292 | 3300038705 | Ga0237819_00881 | Ga0237819_00881_591_1466 | 291 |
| 293 | 3300039450 | Ga0436363_0138769 | Ga0436363_0138769_716_1678 | 291 |
| 294 | 3300041405 | Ga0439438_005853 | Ga0439438_005853_3420_4295 | 291 |
| 295 | 3300041405 | Ga0439438_010670 | Ga0439438_010670_1965_2840 | 291 |
| 296 | 3300041405 | Ga0439438_025483 | Ga0439438_025483_130_1005 | 291 |
| 297 | 3300041407 | Ga0439447_006010 | Ga0439447_006010_2979_3854 | 291 |
| 298 | 3300041407 | Ga0439447_010708 | Ga0439447_010708_1479_2354 | 291 |
| 299 | 3300041407 | Ga0439447_029585 | Ga0439447_029585_55_930 | 291 |
| 300 | 3300041407 | Ga0439447_033238 | Ga0439447_033238_140_1015 | 291 |
| 301 | 3300041411 | Ga0439466_0014226 | Ga0439466_0014226_1464_2339 | 291 |
| 302 | 3300041411 | Ga0439466_0024300 | Ga0439466_0024300_558_1433 | 291 |
| 303 | 3300041997 | Ga0439431_0004367 | Ga0439431_0004367_142_1017 | 291 |
| 304 | 3300042000 | Ga0439437_000520 | Ga0439437_000520_1167_2129 | 291 |
| 305 | 3300042003 | Ga0439443_002718 | Ga0439443_002718_93_1055 | 291 |
| 306 | 3300042006 | Ga0439432_007415 | Ga0439432_007415_158_1033 | 291 |
| 307 | 3300042006 | Ga0439432_018956 | Ga0439432_018956_1262_2137 | 291 |
| 308 | 3300042006 | Ga0439432_021257 | Ga0439432_021257_1095_2057 | 291 |
| 309 | 3300042006 | Ga0439432_031308 | Ga0439432_031308_119_994 | 291 |
| 310 | 3300042010 | Ga0439452_000667 | Ga0439452_000667_15751_16626 | 291 |
| 311 | 3300042010 | Ga0439452_011937 | Ga0439452_011937_1091_1966 | 291 |
| 312 | 3300042010 | Ga0439452_016034 | Ga0439452_016034_544_1419 | 291 |
| 313 | 3300042010 | Ga0439452_018731 | Ga0439452_018731_561_1523 | 291 |
| 314 | 3300042010 | Ga0439452_034005 | Ga0439452_034005_132_1007 | 291 |
| 315 | 3300042013 | Ga0439456_000315 | Ga0439456_000315_1131_2006 | 291 |
| 316 | 3300042013 | Ga0439456_012132 | Ga0439456_012132_290_1177 | 291 |
| 317 | 3300042013 | Ga0439456_014249 | Ga0439456_014249_715_1590 | 291 |
| 318 | 3300042016 | Ga0439463_003312 | Ga0439463_003312_1386_2273 | 291 |
| 319 | 3300042115 | Ga0450911_000017 | Ga0450911_000017_81342_82304 | 291 |
| 320 | 3300042115 | Ga0450911_002369 | Ga0450911_002369_2597_3472 | 291 |
| 321 | 3300042115 | Ga0450911_008410 | Ga0450911_008410_207_1094 | 291 |
| 322 | 3300042117 | Ga0450913_001977 | Ga0450913_001977_97_1059 | 291 |
| 323 | 3300042137 | Ga0450902_008097 | Ga0450902_008097_26_901 | 291 |
| 324 | 3300042138 | Ga0450903_005766 | Ga0450903_005766_522_1397 | 291 |
| 325 | 3300042139 | Ga0450904_000166 | Ga0450904_000166_10984_11946 | 291 |
| 326 | 3300042139 | Ga0450904_002326 | Ga0450904_002326_397_1284 | 291 |
| 327 | 3300042139 | Ga0450904_005246 | Ga0450904_005246_49_924 | 291 |
| 328 | 3300042145 | Ga0450906_004046 | Ga0450906_004046_178_1140 | 291 |
| 329 | 3300042146 | Ga0450907_000439 | Ga0450907_000439_1255_2130 | 291 |
| 330 | 3300042147 | Ga0450910_000985 | Ga0450910_000985_2420_3295 | 291 |
| 331 | 3300042156 | Ga0439446_0059653 | Ga0439446_0059653_43_918 | 291 |
| 332 | 3300042435 | Ga0439434_0009636 | Ga0439434_0009636_1038_1913 | 291 |
| 333 | 3300042435 | Ga0439434_0044252 | Ga0439434_0044252_409_1284 | 291 |
| 334 | 3300042438 | Ga0439459_0000879 | Ga0439459_0000879_1365_2327 | 291 |
| 335 | 3300042439 | Ga0439464_0006527 | Ga0439464_0006527_697_1683 | 291 |
| 336 | 3300042439 | Ga0439464_0018885 | Ga0439464_0018885_790_1776 | 291 |
| 337 | 3300042461 | Ga0439460_0001955 | Ga0439460_0001955_3143_4018 | 291 |
| 338 | 3300042530 | Ga0450916_000791 | Ga0450916_000791_1697_2659 | 291 |
| 339 | 3300042532 | Ga0450893_0001272 | Ga0450893_0001272_1086_2048 | 291 |
| 340 | 3300042876 | Ga0451577_0033401 | Ga0451577_0033401_254_1216 | 291 |
| 341 | 3300042993 | Ga0439440_0002330 | Ga0439440_0002330_1477_2352 | 291 |
| 342 | 3300042993 | Ga0439440_0043154 | Ga0439440_0043154_219_1094 | 291 |
| 343 | 3300046452 | Ga0495617_009670 | Ga0495617_009670_717_1592 | 291 |
| 344 | 3300046452 | Ga0495617_009807 | Ga0495617_009807_1854_2729 | 291 |
| 345 | 3300046453 | Ga0495627_000040 | Ga0495627_000040_87895_88857 | 291 |
| 346 | 3300046453 | Ga0495627_001207 | Ga0495627_001207_1278_2153 | 291 |
| 347 | 3300046453 | Ga0495627_009066 | Ga0495627_009066_747_1709 | 291 |
| 348 | 3300046453 | Ga0495627_014002 | Ga0495627_014002_1843_2718 | 291 |
| 349 | 3300046453 | Ga0495627_028094 | Ga0495627_028094_390_1265 | 291 |
| 350 | 3300046455 | Ga0495603_0017243 | Ga0495603_0017243_1281_2156 | 291 |
| 351 | 3300046457 | Ga0495590_0005676 | Ga0495590_0005676_39_914 | 291 |
| 352 | 3300046457 | Ga0495590_0009911 | Ga0495590_0009911_903_1778 | 291 |
| 353 | 3300046457 | Ga0495590_0025595 | Ga0495590_0025595_1184_2059 | 291 |
| 354 | 3300046457 | Ga0495590_0037316 | Ga0495590_0037316_563_1438 | 291 |
| 355 | 3300046458 | Ga0495591_000023 | Ga0495591_000023_90548_91510 | 291 |
| 356 | 3300046458 | Ga0495591_001720 | Ga0495591_001720_7175_8137 | 291 |
| 357 | 3300046458 | Ga0495591_002767 | Ga0495591_002767_8428_9429 | 291 |
| 358 | 3300046458 | Ga0495591_007086 | Ga0495591_007086_3649_4524 | 291 |
| 359 | 3300046458 | Ga0495591_008921 | Ga0495591_008921_1027_1989 | 291 |
| 360 | 3300046458 | Ga0495591_016013 | Ga0495591_016013_1490_2365 | 291 |
| 361 | 3300046460 | Ga0495638_0023429 | Ga0495638_0023429_2898_3860 | 291 |
| 362 | 3300046460 | Ga0495638_0026283 | Ga0495638_0026283_2641_3516 | 291 |
| 363 | 3300046460 | Ga0495638_0044887 | Ga0495638_0044887_1441_2316 | 291 |
| 364 | 3300046460 | Ga0495638_0095137 | Ga0495638_0095137_748_1623 | 291 |
| 365 | 3300046460 | Ga0495638_0101843 | Ga0495638_0101843_318_1280 | 291 |
| 366 | 3300046460 | Ga0495638_0117272 | Ga0495638_0117272_342_1304 | 291 |
| 367 | 3300046460 | Ga0495638_0222737 | Ga0495638_0222737_98_973 | 291 |
| 368 | 3300046463 | Ga0495653_0001688 | Ga0495653_0001688_395_1282 | 291 |
| 369 | 3300046463 | Ga0495653_0075011 | Ga0495653_0075011_1398_2273 | 291 |
| 370 | 3300046463 | Ga0495653_0109414 | Ga0495653_0109414_354_1241 | 291 |
| 371 | 3300046463 | Ga0495653_0153470 | Ga0495653_0153470_174_1049 | 291 |
| 372 | 3300046471 | Ga0495650_0001179 | Ga0495650_0001179_10901_11863 | 291 |
| 373 | 3300046471 | Ga0495650_0021310 | Ga0495650_0021310_373_1248 | 291 |
| 374 | 3300046471 | Ga0495650_0023543 | Ga0495650_0023543_383_1345 | 291 |
| 375 | 3300046471 | Ga0495650_0024731 | Ga0495650_0024731_348_1223 | 291 |
| 376 | 3300046471 | Ga0495650_0036242 | Ga0495650_0036242_584_1546 | 291 |
| 377 | 3300046471 | Ga0495650_0096008 | Ga0495650_0096008_86_961 | 291 |
| 378 | 3300046474 | Ga0495605_0000048 | Ga0495605_0000048_80505_81467 | 291 |
| 379 | 3300046474 | Ga0495605_0000094 | Ga0495605_0000094_62830_63792 | 291 |
| 380 | 3300046474 | Ga0495605_0001067 | Ga0495605_0001067_1367_2329 | 291 |
| 381 | 3300046474 | Ga0495605_0002988 | Ga0495605_0002988_810_1772 | 291 |
| 382 | 3300046474 | Ga0495605_0005577 | Ga0495605_0005577_474_1499 | 291 |
| 383 | 3300046474 | Ga0495605_0019091 | Ga0495605_0019091_1889_2764 | 291 |
| 384 | 3300046474 | Ga0495605_0027745 | Ga0495605_0027745_264_1139 | 291 |
| 385 | 3300046474 | Ga0495605_0030595 | Ga0495605_0030595_1215_2177 | 291 |
| 386 | 3300046474 | Ga0495605_0082438 | Ga0495605_0082438_177_1052 | 291 |
| 387 | 3300046475 | Ga0495639_0014215 | Ga0495639_0014215_609_1484 | 291 |
| 388 | 3300046491 | Ga0495584_0019852 | Ga0495584_0019852_148_1023 | 291 |
| 389 | 3300046491 | Ga0495584_0038569 | Ga0495584_0038569_828_1703 | 291 |
| 390 | 3300046491 | Ga0495584_0058589 | Ga0495584_0058589_407_1282 | 291 |
| 391 | 3300046491 | Ga0495584_0150297 | Ga0495584_0150297_150_1025 | 291 |
| 392 | 3300046492 | Ga0495585_0028644 | Ga0495585_0028644_1624_2520 | 291 |
| 393 | 3300046492 | Ga0495585_0033388 | Ga0495585_0033388_191_1066 | 291 |
| 394 | 3300046492 | Ga0495585_0038594 | Ga0495585_0038594_195_1070 | 291 |
| 395 | 3300046492 | Ga0495585_0053125 | Ga0495585_0053125_40_915 | 291 |
| 396 | 3300046492 | Ga0495585_0105470 | Ga0495585_0105470_195_1070 | 291 |
| 397 | 3300046500 | Ga0495596_0001228 | Ga0495596_0001228_12352_13227 | 291 |
| 398 | 3300046500 | Ga0495596_0002112 | Ga0495596_0002112_467_1429 | 291 |
| 399 | 3300046500 | Ga0495596_0063070 | Ga0495596_0063070_62_937 | 291 |
| 400 | 3300046501 | Ga0495607_0000893 | Ga0495607_0000893_6524_7486 | 291 |
| 401 | 3300046501 | Ga0495607_0000972 | Ga0495607_0000972_8557_9519 | 291 |
| 402 | 3300046501 | Ga0495607_0001113 | Ga0495607_0001113_16246_17208 | 291 |
| 403 | 3300046501 | Ga0495607_0001564 | Ga0495607_0001564_1307_2269 | 291 |
| 404 | 3300046501 | Ga0495607_0007321 | Ga0495607_0007321_20_982 | 291 |
| 405 | 3300046501 | Ga0495607_0009646 | Ga0495607_0009646_931_1893 | 291 |
| 406 | 3300046501 | Ga0495607_0011176 | Ga0495607_0011176_453_1328 | 291 |
| 407 | 3300046501 | Ga0495607_0016917 | Ga0495607_0016917_2525_3400 | 291 |
| 408 | 3300046501 | Ga0495607_0019252 | Ga0495607_0019252_2809_3684 | 291 |
| 409 | 3300046501 | Ga0495607_0021308 | Ga0495607_0021308_2841_3803 | 291 |
| 410 | 3300046501 | Ga0495607_0039860 | Ga0495607_0039860_1821_2783 | 291 |
| 411 | 3300046501 | Ga0495607_0042425 | Ga0495607_0042425_505_1380 | 291 |
| 412 | 3300046501 | Ga0495607_0064024 | Ga0495607_0064024_384_1280 | 291 |
| 413 | 3300046501 | Ga0495607_0084220 | Ga0495607_0084220_729_1691 | 291 |
| 414 | 3300046501 | Ga0495607_0087591 | Ga0495607_0087591_235_1110 | 291 |
| 415 | 3300046501 | Ga0495607_0096301 | Ga0495607_0096301_82_957 | 291 |
| 416 | 3300046501 | Ga0495607_0172485 | Ga0495607_0172485_28_903 | 291 |
| 417 | 3300046501 | Ga0495607_0191470 | Ga0495607_0191470_69_956 | 291 |
| 418 | 3300046506 | Ga0495583_0000096 | Ga0495583_0000096_66657_67619 | 291 |
| 419 | 3300046506 | Ga0495583_0002375 | Ga0495583_0002375_8404_9366 | 291 |
| 420 | 3300046506 | Ga0495583_0004233 | Ga0495583_0004233_8092_9054 | 291 |
| 421 | 3300046506 | Ga0495583_0004686 | Ga0495583_0004686_1400_2275 | 291 |
| 422 | 3300046506 | Ga0495583_0004830 | Ga0495583_0004830_1568_2530 | 291 |
| 423 | 3300046506 | Ga0495583_0008065 | Ga0495583_0008065_189_1151 | 291 |
| 424 | 3300046506 | Ga0495583_0023222 | Ga0495583_0023222_2170_3132 | 291 |
| 425 | 3300046506 | Ga0495583_0031157 | Ga0495583_0031157_210_1085 | 291 |
| 426 | 3300046507 | Ga0495606_0000076 | Ga0495606_0000076_107658_108620 | 291 |
| 427 | 3300046507 | Ga0495606_0000167 | Ga0495606_0000167_15168_16193 | 291 |
| 428 | 3300046507 | Ga0495606_0000608 | Ga0495606_0000608_46211_47212 | 291 |
| 429 | 3300046507 | Ga0495606_0003580 | Ga0495606_0003580_855_1742 | 291 |
| 430 | 3300046507 | Ga0495606_0020781 | Ga0495606_0020781_3909_4784 | 291 |
| 431 | 3300046507 | Ga0495606_0029098 | Ga0495606_0029098_2035_2997 | 291 |
| 432 | 3300046507 | Ga0495606_0031245 | Ga0495606_0031245_123_998 | 291 |
| 433 | 3300046507 | Ga0495606_0035413 | Ga0495606_0035413_1589_2464 | 291 |
| 434 | 3300046507 | Ga0495606_0044791 | Ga0495606_0044791_95_970 | 291 |
| 435 | 3300046507 | Ga0495606_0060369 | Ga0495606_0060369_605_1480 | 291 |
| 436 | 3300046507 | Ga0495606_0071520 | Ga0495606_0071520_42_1004 | 291 |
| 437 | 3300046507 | Ga0495606_0105579 | Ga0495606_0105579_47_922 | 291 |
| 438 | 3300046512 | Ga0495610_0003673 | Ga0495610_0003673_2682_3644 | 291 |
| 439 | 3300046512 | Ga0495610_0029882 | Ga0495610_0029882_81_956 | 291 |
| 440 | 3300046512 | Ga0495610_0034875 | Ga0495610_0034875_192_1067 | 291 |
| 441 | 3300046512 | Ga0495610_0042094 | Ga0495610_0042094_400_1275 | 291 |
| 442 | 3300046512 | Ga0495610_0042670 | Ga0495610_0042670_744_1706 | 291 |
| 443 | 3300046512 | Ga0495610_0045081 | Ga0495610_0045081_192_1067 | 291 |
| 444 | 3300046513 | Ga0495616_0001347 | Ga0495616_0001347_16148_17110 | 291 |
| 445 | 3300046513 | Ga0495616_0010197 | Ga0495616_0010197_4457_5419 | 291 |
| 446 | 3300046513 | Ga0495616_0014233 | Ga0495616_0014233_299_1174 | 291 |
| 447 | 3300046513 | Ga0495616_0026394 | Ga0495616_0026394_611_1486 | 291 |
| 448 | 3300046513 | Ga0495616_0043632 | Ga0495616_0043632_1275_2150 | 291 |
| 449 | 3300046513 | Ga0495616_0044749 | Ga0495616_0044749_83_958 | 291 |
| 450 | 3300046513 | Ga0495616_0055653 | Ga0495616_0055653_889_1764 | 291 |
| 451 | 3300046513 | Ga0495616_0056399 | Ga0495616_0056399_516_1391 | 291 |
| 452 | 3300046513 | Ga0495616_0106807 | Ga0495616_0106807_252_1214 | 291 |
| 453 | 3300046515 | Ga0495620_0000001 | Ga0495620_0000001_31706_32668 | 291 |
| 454 | 3300046515 | Ga0495620_0000003 | Ga0495620_0000003_288353_289315 | 291 |
| 455 | 3300046515 | Ga0495620_0000736 | Ga0495620_0000736_1466_2428 | 291 |
| 456 | 3300046515 | Ga0495620_0001383 | Ga0495620_0001383_5046_6008 | 291 |
| 457 | 3300046515 | Ga0495620_0010185 | Ga0495620_0010185_3184_4146 | 291 |
| 458 | 3300046515 | Ga0495620_0020358 | Ga0495620_0020358_512_1387 | 291 |
| 459 | 3300046515 | Ga0495620_0022320 | Ga0495620_0022320_416_1378 | 291 |
| 460 | 3300046515 | Ga0495620_0068247 | Ga0495620_0068247_327_1202 | 291 |
| 461 | 3300046515 | Ga0495620_0071961 | Ga0495620_0071961_66_1028 | 291 |
| 462 | 3300046515 | Ga0495620_0077028 | Ga0495620_0077028_419_1294 | 291 |
| 463 | 3300046518 | Ga0495631_0011216 | Ga0495631_0011216_1770_2645 | 291 |
| 464 | 3300046518 | Ga0495631_0013811 | Ga0495631_0013811_1342_2304 | 291 |
| 465 | 3300046518 | Ga0495631_0037631 | Ga0495631_0037631_468_1343 | 291 |
| 466 | 3300046518 | Ga0495631_0041744 | Ga0495631_0041744_1025_1987 | 291 |
| 467 | 3300046519 | Ga0495632_0001293 | Ga0495632_0001293_1044_2006 | 291 |
| 468 | 3300046519 | Ga0495632_0009098 | Ga0495632_0009098_357_1232 | 291 |
| 469 | 3300046519 | Ga0495632_0018573 | Ga0495632_0018573_972_1934 | 291 |
| 470 | 3300046519 | Ga0495632_0026907 | Ga0495632_0026907_1940_2902 | 291 |
| 471 | 3300046519 | Ga0495632_0027921 | Ga0495632_0027921_33_995 | 291 |
| 472 | 3300046519 | Ga0495632_0032968 | Ga0495632_0032968_1535_2497 | 291 |
| 473 | 3300046519 | Ga0495632_0048392 | Ga0495632_0048392_119_994 | 291 |
| 474 | 3300046519 | Ga0495632_0060055 | Ga0495632_0060055_899_1774 | 291 |
| 475 | 3300046519 | Ga0495632_0068125 | Ga0495632_0068125_729_1604 | 291 |
| 476 | 3300046519 | Ga0495632_0071228 | Ga0495632_0071228_671_1546 | 291 |
| 477 | 3300046519 | Ga0495632_0106812 | Ga0495632_0106812_268_1143 | 291 |
| 478 | 3300046519 | Ga0495632_0117266 | Ga0495632_0117266_258_1133 | 291 |
| 479 | 3300046520 | Ga0495637_0000583 | Ga0495637_0000583_23370_24332 | 291 |
| 480 | 3300046520 | Ga0495637_0006191 | Ga0495637_0006191_357_1232 | 291 |
| 481 | 3300046520 | Ga0495637_0008837 | Ga0495637_0008837_55_930 | 291 |
| 482 | 3300046520 | Ga0495637_0009658 | Ga0495637_0009658_2218_3219 | 291 |
| 483 | 3300046520 | Ga0495637_0010701 | Ga0495637_0010701_785_1747 | 291 |
| 484 | 3300046520 | Ga0495637_0019602 | Ga0495637_0019602_283_1245 | 291 |
| 485 | 3300046520 | Ga0495637_0023730 | Ga0495637_0023730_1176_2138 | 291 |
| 486 | 3300046520 | Ga0495637_0027828 | Ga0495637_0027828_548_1423 | 291 |
| 487 | 3300046520 | Ga0495637_0034806 | Ga0495637_0034806_874_1836 | 291 |
| 488 | 3300046520 | Ga0495637_0042478 | Ga0495637_0042478_116_991 | 291 |
| 489 | 3300046520 | Ga0495637_0051564 | Ga0495637_0051564_393_1268 | 291 |
| 490 | 3300046520 | Ga0495637_0064442 | Ga0495637_0064442_128_1003 | 291 |
| 491 | 3300046520 | Ga0495637_0117289 | Ga0495637_0117289_79_954 | 291 |
| 492 | 3300046522 | Ga0495643_0000673 | Ga0495643_0000673_16902_17864 | 291 |
| 493 | 3300046522 | Ga0495643_0000785 | Ga0495643_0000785_8674_9636 | 291 |
| 494 | 3300046522 | Ga0495643_0011714 | Ga0495643_0011714_3642_4604 | 291 |
| 495 | 3300046522 | Ga0495643_0034692 | Ga0495643_0034692_1803_2678 | 291 |
| 496 | 3300046522 | Ga0495643_0070369 | Ga0495643_0070369_407_1282 | 291 |
| 497 | 3300046522 | Ga0495643_0140461 | Ga0495643_0140461_200_1075 | 291 |
| 498 | 3300046522 | Ga0495643_0169472 | Ga0495643_0169472_20_982 | 291 |
| 499 | 3300046523 | Ga0495644_0005422 | Ga0495644_0005422_1163_2164 | 291 |
| 500 | 3300046523 | Ga0495644_0016173 | Ga0495644_0016173_258_1133 | 291 |
| 501 | 3300046523 | Ga0495644_0020076 | Ga0495644_0020076_899_1774 | 291 |
| 502 | 3300046523 | Ga0495644_0027817 | Ga0495644_0027817_747_1709 | 291 |
| 503 | 3300046524 | Ga0495648_0008068 | Ga0495648_0008068_6751_7713 | 291 |
| 504 | 3300046524 | Ga0495648_0008743 | Ga0495648_0008743_2490_3452 | 291 |
| 505 | 3300046524 | Ga0495648_0019177 | Ga0495648_0019177_1603_2565 | 291 |
| 506 | 3300046524 | Ga0495648_0029004 | Ga0495648_0029004_2697_3659 | 291 |
| 507 | 3300046524 | Ga0495648_0030511 | Ga0495648_0030511_941_1816 | 291 |
| 508 | 3300046524 | Ga0495648_0041982 | Ga0495648_0041982_1922_2854 | 291 |
| 509 | 3300046524 | Ga0495648_0067821 | Ga0495648_0067821_721_1596 | 291 |
| 510 | 3300046524 | Ga0495648_0078373 | Ga0495648_0078373_109_984 | 291 |
| 511 | 3300046524 | Ga0495648_0078685 | Ga0495648_0078685_734_1609 | 291 |
| 512 | 3300046524 | Ga0495648_0083334 | Ga0495648_0083334_43_918 | 291 |
| 513 | 3300046524 | Ga0495648_0126020 | Ga0495648_0126020_267_1229 | 291 |
| 514 | 3300046524 | Ga0495648_0198136 | Ga0495648_0198136_56_931 | 291 |
| 515 | 3300046526 | Ga0495666_0019899 | Ga0495666_0019899_69_1031 | 291 |
| 516 | 3300046526 | Ga0495666_0119399 | Ga0495666_0119399_203_1078 | 291 |
| 517 | 3300046528 | Ga0495642_0001507 | Ga0495642_0001507_1287_2162 | 291 |
| 518 | 3300046528 | Ga0495642_0009207 | Ga0495642_0009207_948_1823 | 291 |
| 519 | 3300046530 | Ga0495654_0001425 | Ga0495654_0001425_15505_16467 | 291 |
| 520 | 3300046530 | Ga0495654_0003292 | Ga0495654_0003292_8738_9700 | 291 |
| 521 | 3300046530 | Ga0495654_0004160 | Ga0495654_0004160_2868_3830 | 291 |
| 522 | 3300046530 | Ga0495654_0015896 | Ga0495654_0015896_255_1130 | 291 |
| 523 | 3300046530 | Ga0495654_0018333 | Ga0495654_0018333_12_944 | 291 |
| 524 | 3300046530 | Ga0495654_0032304 | Ga0495654_0032304_211_1086 | 291 |
| 525 | 3300046530 | Ga0495654_0037006 | Ga0495654_0037006_427_1302 | 291 |
| 526 | 3300046530 | Ga0495654_0041036 | Ga0495654_0041036_195_1070 | 291 |
| 527 | 3300046530 | Ga0495654_0050130 | Ga0495654_0050130_738_1613 | 291 |
| 528 | 3300046530 | Ga0495654_0073257 | Ga0495654_0073257_219_1181 | 291 |
| 529 | 3300046530 | Ga0495654_0074100 | Ga0495654_0074100_142_1104 | 291 |
| 530 | 3300046530 | Ga0495654_0083276 | Ga0495654_0083276_540_1472 | 291 |
| 531 | 3300046530 | Ga0495654_0085444 | Ga0495654_0085444_67_942 | 291 |
| 532 | 3300046536 | Ga0495587_0097056 | Ga0495587_0097056_524_1486 | 291 |
| 533 | 3300046536 | Ga0495587_0250428 | Ga0495587_0250428_90_965 | 291 |
| 534 | 3300046538 | Ga0495609_0000012 | Ga0495609_0000012_69347_70309 | 291 |
| 535 | 3300046538 | Ga0495609_0000079 | Ga0495609_0000079_109281_110243 | 291 |
| 536 | 3300046538 | Ga0495609_0000799 | Ga0495609_0000799_21218_22180 | 291 |
| 537 | 3300046538 | Ga0495609_0020773 | Ga0495609_0020773_2069_2944 | 291 |
| 538 | 3300046538 | Ga0495609_0024870 | Ga0495609_0024870_1808_2683 | 291 |
| 539 | 3300046538 | Ga0495609_0109095 | Ga0495609_0109095_170_1045 | 291 |
| 540 | 3300046542 | Ga0495597_0000016 | Ga0495597_0000016_84702_85664 | 291 |
| 541 | 3300046542 | Ga0495597_0009148 | Ga0495597_0009148_39_914 | 291 |
| 542 | 3300046542 | Ga0495597_0015221 | Ga0495597_0015221_1355_2317 | 291 |
| 543 | 3300046542 | Ga0495597_0018427 | Ga0495597_0018427_473_1348 | 291 |
| 544 | 3300046542 | Ga0495597_0072903 | Ga0495597_0072903_480_1442 | 291 |
| 545 | 3300046542 | Ga0495597_0085496 | Ga0495597_0085496_133_1095 | 291 |
| 546 | 3300046557 | Ga0495622_0015164 | Ga0495622_0015164_606_1481 | 291 |
| 547 | 3300046557 | Ga0495622_0016356 | Ga0495622_0016356_1949_2824 | 291 |
| 548 | 3300046558 | Ga0495633_0000034 | Ga0495633_0000034_117960_118922 | 291 |
| 549 | 3300046558 | Ga0495633_0017328 | Ga0495633_0017328_1762_2637 | 291 |
| 550 | 3300046558 | Ga0495633_0024822 | Ga0495633_0024822_308_1183 | 291 |
| 551 | 3300046558 | Ga0495633_0096518 | Ga0495633_0096518_21_908 | 291 |
| 552 | 3300046616 | Ga0495668_0002256 | Ga0495668_0002256_14746_15747 | 291 |
| 553 | 3300046616 | Ga0495668_0023584 | Ga0495668_0023584_1368_2243 | 291 |
| 554 | 3300046616 | Ga0495668_0026859 | Ga0495668_0026859_49_1011 | 291 |
| 555 | 3300046616 | Ga0495668_0027121 | Ga0495668_0027121_425_1387 | 291 |
| 556 | 3300046616 | Ga0495668_0027373 | Ga0495668_0027373_1249_2211 | 291 |
| 557 | 3300046616 | Ga0495668_0225564 | Ga0495668_0225564_47_922 | 291 |
| 558 | 3300046642 | Ga0495634_0043592 | Ga0495634_0043592_371_1333 | 291 |
| 559 | 3300046648 | Ga0495611_0002095 | Ga0495611_0002095_1373_2335 | 291 |
| 560 | 3300046648 | Ga0495611_0003561 | Ga0495611_0003561_147_1109 | 291 |
| 561 | 3300046648 | Ga0495611_0004112 | Ga0495611_0004112_670_1545 | 291 |
| 562 | 3300046648 | Ga0495611_0040427 | Ga0495611_0040427_263_1138 | 291 |
| 563 | 3300046660 | Ga0495625_0000185 | Ga0495625_0000185_88384_89346 | 291 |
| 564 | 3300046660 | Ga0495625_0074759 | Ga0495625_0074759_94_1056 | 291 |
| 565 | 3300046660 | Ga0495625_0096238 | Ga0495625_0096238_426_1301 | 291 |
| 566 | 3300046660 | Ga0495625_0099653 | Ga0495625_0099653_385_1260 | 291 |
| 567 | 3300046660 | Ga0495625_0104960 | Ga0495625_0104960_435_1397 | 291 |
| 568 | 3300046660 | Ga0495625_0112061 | Ga0495625_0112061_540_1502 | 291 |
| 569 | 3300046660 | Ga0495625_0115766 | Ga0495625_0115766_117_1079 | 291 |
| 570 | 3300046663 | Ga0495635_0038697 | Ga0495635_0038697_440_1402 | 291 |
| 571 | 3300046664 | Ga0495659_0006501 | Ga0495659_0006501_1967_2842 | 291 |
| 572 | 3300046664 | Ga0495659_0010963 | Ga0495659_0010963_258_1133 | 291 |
| 573 | 3300046665 | Ga0495661_0000004 | Ga0495661_0000004_487694_488656 | 291 |
| 574 | 3300046665 | Ga0495661_0000028 | Ga0495661_0000028_16012_16908 | 291 |
| 575 | 3300046665 | Ga0495661_0000088 | Ga0495661_0000088_80815_81816 | 291 |
| 576 | 3300046665 | Ga0495661_0000146 | Ga0495661_0000146_72308_73270 | 291 |
| 577 | 3300046665 | Ga0495661_0006678 | Ga0495661_0006678_214_1176 | 291 |
| 578 | 3300046665 | Ga0495661_0007167 | Ga0495661_0007167_6757_7719 | 291 |
| 579 | 3300046665 | Ga0495661_0007616 | Ga0495661_0007616_6473_7348 | 291 |
| 580 | 3300046665 | Ga0495661_0033661 | Ga0495661_0033661_1001_1876 | 291 |
| 581 | 3300046665 | Ga0495661_0051739 | Ga0495661_0051739_1090_2052 | 291 |
| 582 | 3300046665 | Ga0495661_0064528 | Ga0495661_0064528_441_1403 | 291 |
| 583 | 3300046665 | Ga0495661_0113925 | Ga0495661_0113925_486_1448 | 291 |
| 584 | 3300046679 | Ga0495623_0042430 | Ga0495623_0042430_562_1437 | 291 |
| 585 | 3300046684 | Ga0495669_0016942 | Ga0495669_0016942_1264_2139 | 291 |
| 586 | 3300046689 | Ga0495613_0145210 | Ga0495613_0145210_546_1433 | 291 |
| 587 | 3300046690 | Ga0495624_0087188 | Ga0495624_0087188_670_1557 | 291 |
| 588 | 3300046691 | Ga0495670_0009810 | Ga0495670_0009810_302_1177 | 291 |
| 589 | 3300046691 | Ga0495670_0011441 | Ga0495670_0011441_2977_3939 | 291 |
| 590 | 3300046691 | Ga0495670_0093401 | Ga0495670_0093401_43_918 | 291 |
| 591 | 3300046691 | Ga0495670_0183475 | Ga0495670_0183475_131_1093 | 291 |
| 592 | 3300046692 | Ga0495671_0007977 | Ga0495671_0007977_4872_5747 | 291 |
| 593 | 3300046692 | Ga0495671_0026438 | Ga0495671_0026438_165_1040 | 291 |
| 594 | 3300046692 | Ga0495671_0026874 | Ga0495671_0026874_629_1591 | 291 |
| 595 | 3300046692 | Ga0495671_0033954 | Ga0495671_0033954_1487_2362 | 291 |
| 596 | 3300046692 | Ga0495671_0058828 | Ga0495671_0058828_767_1642 | 291 |
| 597 | 3300046692 | Ga0495671_0059785 | Ga0495671_0059785_399_1274 | 291 |
| 598 | 3300046692 | Ga0495671_0070706 | Ga0495671_0070706_208_1170 | 291 |
| 599 | 3300046692 | Ga0495671_0072743 | Ga0495671_0072743_66_1028 | 291 |
| 600 | 3300046694 | Ga0495649_0000445 | Ga0495649_0000445_489_1451 | 291 |
| 601 | 3300046694 | Ga0495649_0001861 | Ga0495649_0001861_14165_15127 | 291 |
| 602 | 3300046694 | Ga0495649_0018962 | Ga0495649_0018962_520_1482 | 291 |
| 603 | 3300046694 | Ga0495649_0034226 | Ga0495649_0034226_951_1913 | 291 |
| 604 | 3300046694 | Ga0495649_0041788 | Ga0495649_0041788_419_1294 | 291 |
| 605 | 3300046694 | Ga0495649_0047307 | Ga0495649_0047307_1011_1886 | 291 |
| 606 | 3300046694 | Ga0495649_0049862 | Ga0495649_0049862_1286_2161 | 291 |
| 607 | 3300046694 | Ga0495649_0055490 | Ga0495649_0055490_387_1262 | 291 |
| 608 | 3300046694 | Ga0495649_0083759 | Ga0495649_0083759_255_1217 | 291 |
| 609 | 3300046694 | Ga0495649_0085329 | Ga0495649_0085329_518_1393 | 291 |
| 610 | 3300046694 | Ga0495649_0089962 | Ga0495649_0089962_592_1467 | 291 |
| 611 | 3300046694 | Ga0495649_0103200 | Ga0495649_0103200_509_1471 | 291 |
| 612 | 3300046794 | Ga0495589_0002693 | Ga0495589_0002693_2459_3421 | 291 |
| 613 | 3300046794 | Ga0495589_0022642 | Ga0495589_0022642_1841_2716 | 291 |
| 614 | 3300046794 | Ga0495589_0032567 | Ga0495589_0032567_1010_1885 | 291 |
| 615 | 3300046794 | Ga0495589_0050517 | Ga0495589_0050517_980_1855 | 291 |
| 616 | 3300046809 | Ga0495600_0074118 | Ga0495600_0074118_1111_1986 | 291 |
| 617 | 3300046809 | Ga0495600_0104308 | Ga0495600_0104308_273_1160 | 291 |
| 618 | 3300046810 | Ga0495660_0003327 | Ga0495660_0003327_165_1127 | 291 |
| 619 | 3300046810 | Ga0495660_0006173 | Ga0495660_0006173_4739_5701 | 291 |
| 620 | 3300046810 | Ga0495660_0020264 | Ga0495660_0020264_1170_2132 | 291 |
| 621 | 3300046810 | Ga0495660_0032533 | Ga0495660_0032533_1402_2364 | 291 |
| 622 | 3300046810 | Ga0495660_0039041 | Ga0495660_0039041_192_1067 | 291 |
| 623 | 3300046810 | Ga0495660_0071840 | Ga0495660_0071840_65_940 | 291 |
| 624 | 3300046810 | Ga0495660_0079596 | Ga0495660_0079596_654_1529 | 291 |
| 625 | 3300046810 | Ga0495660_0091256 | Ga0495660_0091256_94_969 | 291 |
| 626 | 3300046810 | Ga0495660_0098328 | Ga0495660_0098328_343_1218 | 291 |
| 627 | 3300046810 | Ga0495660_0159451 | Ga0495660_0159451_110_985 | 291 |
| 628 | 3300047317 | Ga0495604_0074539 | Ga0495604_0074539_986_1948 | 291 |
| 629 | 3300047317 | Ga0495604_0163243 | Ga0495604_0163243_429_1316 | 291 |
| 630 | 3300047320 | Ga0495672_0001231 | Ga0495672_0001231_18985_19860 | 291 |
| 631 | 3300047320 | Ga0495672_0023814 | Ga0495672_0023814_1447_2409 | 291 |
| 632 | 3300047320 | Ga0495672_0026378 | Ga0495672_0026378_702_1577 | 291 |
| 633 | 3300047320 | Ga0495672_0028199 | Ga0495672_0028199_1772_2647 | 291 |
| 634 | 3300047320 | Ga0495672_0033814 | Ga0495672_0033814_167_1129 | 291 |
| 635 | 3300047320 | Ga0495672_0035798 | Ga0495672_0035798_192_1067 | 291 |
| 636 | 3300047320 | Ga0495672_0045498 | Ga0495672_0045498_374_1336 | 291 |
| 637 | 3300047320 | Ga0495672_0060894 | Ga0495672_0060894_604_1479 | 291 |
| 638 | 3300047320 | Ga0495672_0065070 | Ga0495672_0065070_1144_2031 | 291 |
| 639 | 3300047320 | Ga0495672_0084549 | Ga0495672_0084549_180_1067 | 291 |
| 640 | 3300047321 | Ga0495676_0000160 | Ga0495676_0000160_43876_44877 | 291 |
| 641 | 3300047321 | Ga0495676_0064969 | Ga0495676_0064969_1659_2534 | 291 |
| 642 | 3300047321 | Ga0495676_0295111 | Ga0495676_0295111_71_958 | 291 |
| 643 | 3300047322 | Ga0495680_0059649 | Ga0495680_0059649_512_1474 | 291 |
| 644 | 3300047322 | Ga0495680_0139795 | Ga0495680_0139795_301_1188 | 291 |
| 645 | 3300047322 | Ga0495680_0302553 | Ga0495680_0302553_43_939 | 291 |
| 646 | 3300047323 | Ga0495683_0000034 | Ga0495683_0000034_81531_82493 | 291 |
| 647 | 3300047323 | Ga0495683_0000216 | Ga0495683_0000216_16018_16980 | 291 |
| 648 | 3300047323 | Ga0495683_0010981 | Ga0495683_0010981_3282_4157 | 291 |
| 649 | 3300047323 | Ga0495683_0022020 | Ga0495683_0022020_736_1611 | 291 |
| 650 | 3300047323 | Ga0495683_0051853 | Ga0495683_0051853_965_1927 | 291 |
| 651 | 3300047323 | Ga0495683_0089758 | Ga0495683_0089758_134_1009 | 291 |
| 652 | 3300047323 | Ga0495683_0129158 | Ga0495683_0129158_246_1121 | 291 |
| 653 | 3300047443 | Ga0495687_019903 | Ga0495687_019903_533_1408 | 291 |
| 654 | 3300047445 | Ga0495677_0030674 | Ga0495677_0030674_1018_1893 | 291 |
| 655 | 3300047446 | Ga0495679_000377 | Ga0495679_000377_1502_2464 | 291 |
| 656 | 3300047446 | Ga0495679_014863 | Ga0495679_014863_92_1054 | 291 |
| 657 | 3300047446 | Ga0495679_015263 | Ga0495679_015263_296_1171 | 291 |
| 658 | 3300047446 | Ga0495679_015573 | Ga0495679_015573_96_971 | 291 |
| 659 | 3300047446 | Ga0495679_021050 | Ga0495679_021050_92_967 | 291 |
| 660 | 3300047446 | Ga0495679_024414 | Ga0495679_024414_762_1637 | 291 |
| 661 | 3300047446 | Ga0495679_031583 | Ga0495679_031583_151_1113 | 291 |
| 662 | 3300047447 | Ga0495685_031430 | Ga0495685_031430_202_1077 | 291 |
| 663 | 3300047469 | Ga0495673_0002712 | Ga0495673_0002712_10841_11716 | 291 |
| 664 | 3300047469 | Ga0495673_0006452 | Ga0495673_0006452_541_1566 | 291 |
| 665 | 3300047469 | Ga0495673_0010072 | Ga0495673_0010072_1309_2271 | 291 |
| 666 | 3300047469 | Ga0495673_0015923 | Ga0495673_0015923_2603_3478 | 291 |
| 667 | 3300047469 | Ga0495673_0016934 | Ga0495673_0016934_1042_1917 | 291 |
| 668 | 3300047469 | Ga0495673_0033689 | Ga0495673_0033689_1331_2206 | 291 |
| 669 | 3300047469 | Ga0495673_0036706 | Ga0495673_0036706_1289_2221 | 291 |
| 670 | 3300047469 | Ga0495673_0037163 | Ga0495673_0037163_66_1028 | 291 |
| 671 | 3300047469 | Ga0495673_0040815 | Ga0495673_0040815_682_1557 | 291 |
| 672 | 3300047469 | Ga0495673_0042642 | Ga0495673_0042642_686_1711 | 291 |
| 673 | 3300047469 | Ga0495673_0048050 | Ga0495673_0048050_766_1641 | 291 |
| 674 | 3300047469 | Ga0495673_0055315 | Ga0495673_0055315_443_1405 | 291 |
| 675 | 3300047469 | Ga0495673_0069862 | Ga0495673_0069862_105_1067 | 291 |
| 676 | 3300047469 | Ga0495673_0087283 | Ga0495673_0087283_241_1116 | 291 |
| 677 | 3300047470 | Ga0495681_0009159 | Ga0495681_0009159_4894_5769 | 291 |
| 678 | 3300047470 | Ga0495681_0013039 | Ga0495681_0013039_3489_4490 | 291 |
| 679 | 3300047470 | Ga0495681_0021377 | Ga0495681_0021377_2162_3037 | 291 |
| 680 | 3300047470 | Ga0495681_0025854 | Ga0495681_0025854_165_1127 | 291 |
| 681 | 3300047470 | Ga0495681_0030486 | Ga0495681_0030486_416_1378 | 291 |
| 682 | 3300047470 | Ga0495681_0042194 | Ga0495681_0042194_554_1429 | 291 |
| 683 | 3300047470 | Ga0495681_0044007 | Ga0495681_0044007_184_1059 | 291 |
| 684 | 3300047470 | Ga0495681_0075821 | Ga0495681_0075821_67_1029 | 291 |
| 685 | 3300047470 | Ga0495681_0079196 | Ga0495681_0079196_162_1124 | 291 |
| 686 | 3300047471 | Ga0495684_0146740 | Ga0495684_0146740_656_1531 | 291 |
| 687 | 3300047472 | Ga0495686_0011832 | Ga0495686_0011832_1290_2291 | 291 |
| 688 | 3300047472 | Ga0495686_0029647 | Ga0495686_0029647_505_1380 | 291 |
| 689 | 3300047472 | Ga0495686_0099960 | Ga0495686_0099960_57_932 | 291 |
| 690 | 3300047472 | Ga0495686_0167550 | Ga0495686_0167550_16_978 | 291 |
| 691 | 3300047673 | Ga0495593_0035166 | Ga0495593_0035166_1550_2425 | 291 |
| 692 | 3300047673 | Ga0495593_0060514 | Ga0495593_0060514_805_1692 | 291 |
| 693 | 3300048088 | Ga0495602_0163305 | Ga0495602_0163305_298_1185 | 291 |
| 694 | 3300048091 | Ga0495626_0000125 | Ga0495626_0000125_36448_37449 | 291 |
| 695 | 3300048091 | Ga0495626_0001796 | Ga0495626_0001796_13613_14575 | 291 |
| 696 | 3300048091 | Ga0495626_0004821 | Ga0495626_0004821_2911_3786 | 291 |
| 697 | 3300048091 | Ga0495626_0019437 | Ga0495626_0019437_580_1455 | 291 |
| 698 | 3300048091 | Ga0495626_0019580 | Ga0495626_0019580_1536_2411 | 291 |
| 699 | 3300048091 | Ga0495626_0026534 | Ga0495626_0026534_1276_2151 | 291 |
| 700 | 3300048091 | Ga0495626_0037187 | Ga0495626_0037187_492_1367 | 291 |
| 701 | 3300048091 | Ga0495626_0047813 | Ga0495626_0047813_428_1303 | 291 |
| 702 | 3300048091 | Ga0495626_0063581 | Ga0495626_0063581_75_950 | 291 |
| 703 | 3300048091 | Ga0495626_0077874 | Ga0495626_0077874_479_1354 | 291 |
| 704 | 3300048905 | Ga0496102_0065015 | Ga0496102_0065015_595_1470 | 291 |
| 705 | 3300048905 | Ga0496102_0208392 | Ga0496102_0208392_533_1495 | 291 |
| 706 | 3300048913 | Ga0496110_0049992 | Ga0496110_0049992_1674_2636 | 291 |
| 707 | 3300048913 | Ga0496110_0175404 | Ga0496110_0175404_1003_1878 | 291 |
| 708 | 3300048919 | Ga0496116_0001043 | Ga0496116_0001043_26220_27182 | 291 |
| 709 | 3300048919 | Ga0496116_0004638 | Ga0496116_0004638_726_1601 | 291 |
| 710 | 3300048919 | Ga0496116_0018663 | Ga0496116_0018663_100_1125 | 291 |
| 711 | 3300048919 | Ga0496116_0069705 | Ga0496116_0069705_1343_2218 | 291 |
| 712 | 3300048919 | Ga0496116_0100650 | Ga0496116_0100650_152_1039 | 291 |
| 713 | 3300048919 | Ga0496116_0142693 | Ga0496116_0142693_159_1121 | 291 |
| 714 | 3300048920 | Ga0496117_0047000 | Ga0496117_0047000_1012_2037 | 291 |
| 715 | 3300048920 | Ga0496117_0050821 | Ga0496117_0050821_1760_2635 | 291 |
| 716 | 3300048920 | Ga0496117_0053566 | Ga0496117_0053566_615_1577 | 291 |
| 717 | 3300048920 | Ga0496117_0067336 | Ga0496117_0067336_1494_2369 | 291 |
| 718 | 3300048920 | Ga0496117_0086027 | Ga0496117_0086027_720_1682 | 291 |
| 719 | 3300048920 | Ga0496117_0091099 | Ga0496117_0091099_313_1188 | 291 |
| 720 | 3300048920 | Ga0496117_0094012 | Ga0496117_0094012_666_1553 | 291 |
| 721 | 3300048921 | Ga0496118_0044010 | Ga0496118_0044010_571_1533 | 291 |
| 722 | 3300048921 | Ga0496118_0071816 | Ga0496118_0071816_1539_2414 | 291 |
| 723 | 3300048921 | Ga0496118_0086981 | Ga0496118_0086981_256_1131 | 291 |
| 724 | 3300048921 | Ga0496118_0144446 | Ga0496118_0144446_52_1014 | 291 |
| 725 | 3300048921 | Ga0496118_0181456 | Ga0496118_0181456_40_1002 | 291 |
| 726 | 3300048923 | Ga0496120_0122213 | Ga0496120_0122213_91_978 | 291 |
| 727 | 3300048923 | Ga0496120_0142244 | Ga0496120_0142244_226_1101 | 291 |
| 728 | 3300048924 | Ga0496121_0002337 | Ga0496121_0002337_27762_28787 | 291 |
| 729 | 3300048924 | Ga0496121_0004179 | Ga0496121_0004179_12181_13143 | 291 |
| 730 | 3300048924 | Ga0496121_0038182 | Ga0496121_0038182_2199_3161 | 291 |
| 731 | 3300048924 | Ga0496121_0097272 | Ga0496121_0097272_175_1050 | 291 |
| 732 | 3300048925 | Ga0496122_0021670 | Ga0496122_0021670_4633_5595 | 291 |
| 733 | 3300048925 | Ga0496122_0026521 | Ga0496122_0026521_1629_2591 | 291 |
| 734 | 3300048925 | Ga0496122_0046468 | Ga0496122_0046468_1933_2808 | 291 |
| 735 | 3300048925 | Ga0496122_0072157 | Ga0496122_0072157_521_1546 | 291 |
| 736 | 3300048925 | Ga0496122_0077118 | Ga0496122_0077118_66_941 | 291 |
| 737 | 3300048925 | Ga0496122_0164504 | Ga0496122_0164504_271_1146 | 291 |
| 738 | 3300048926 | Ga0496123_0001511 | Ga0496123_0001511_1652_2614 | 291 |
| 739 | 3300048926 | Ga0496123_0041688 | Ga0496123_0041688_1790_2752 | 291 |
| 740 | 3300048926 | Ga0496123_0059724 | Ga0496123_0059724_1573_2448 | 291 |
| 741 | 3300048926 | Ga0496123_0104605 | Ga0496123_0104605_545_1507 | 291 |
| 742 | 3300048926 | Ga0496123_0105572 | Ga0496123_0105572_242_1117 | 291 |
| 743 | 3300048926 | Ga0496123_0109509 | Ga0496123_0109509_265_1152 | 291 |
| 744 | 3300048926 | Ga0496123_0118448 | Ga0496123_0118448_395_1420 | 291 |
| 745 | 3300048927 | Ga0496124_0001524 | Ga0496124_0001524_4387_5349 | 291 |
| 746 | 3300048927 | Ga0496124_0001773 | Ga0496124_0001773_1184_2209 | 291 |
| 747 | 3300048927 | Ga0496124_0033048 | Ga0496124_0033048_253_1128 | 291 |
| 748 | 3300048927 | Ga0496124_0054267 | Ga0496124_0054267_145_1107 | 291 |
| 749 | 3300048927 | Ga0496124_0062509 | Ga0496124_0062509_1589_2551 | 291 |
| 750 | 3300048927 | Ga0496124_0063450 | Ga0496124_0063450_1756_2631 | 291 |
| 751 | 3300048927 | Ga0496124_0075351 | Ga0496124_0075351_272_1147 | 291 |
| 752 | 3300048927 | Ga0496124_0239997 | Ga0496124_0239997_202_1077 | 291 |
| 753 | 3300048928 | Ga0496125_0091942 | Ga0496125_0091942_124_999 | 291 |
| 754 | 3300048928 | Ga0496125_0115071 | Ga0496125_0115071_976_1851 | 291 |
| 755 | 3300048928 | Ga0496125_0165927 | Ga0496125_0165927_520_1482 | 291 |
| 756 | 3300048928 | Ga0496125_0231127 | Ga0496125_0231127_218_1105 | 291 |
| 757 | 3300048929 | Ga0496126_0092027 | Ga0496126_0092027_130_1005 | 291 |
| 758 | 3300048929 | Ga0496126_0125710 | Ga0496126_0125710_264_1139 | 291 |
| 759 | 3300049459 | Ga0495678_000049 | Ga0495678_000049_96481_97443 | 291 |
| 760 | 3300049459 | Ga0495678_000918 | Ga0495678_000918_3126_4127 | 291 |
| 761 | 3300049459 | Ga0495678_001783 | Ga0495678_001783_7751_8713 | 291 |
| 762 | 3300049459 | Ga0495678_016655 | Ga0495678_016655_1857_2732 | 291 |
| 763 | 3300049459 | Ga0495678_016849 | Ga0495678_016849_20_982 | 291 |
| 764 | 3300049459 | Ga0495678_017909 | Ga0495678_017909_2206_3081 | 291 |
| 765 | 3300049459 | Ga0495678_019253 | Ga0495678_019253_195_1070 | 291 |
| 766 | 3300049459 | Ga0495678_032576 | Ga0495678_032576_734_1609 | 291 |
| 767 | 3300049459 | Ga0495678_042946 | Ga0495678_042946_402_1277 | 291 |
| 768 | 3300049459 | Ga0495678_062025 | Ga0495678_062025_337_1224 | 291 |
| 769 | 3300049459 | Ga0495678_074266 | Ga0495678_074266_168_1043 | 291 |
| 770 | 3300049459 | Ga0495678_080216 | Ga0495678_080216_60_935 | 291 |
| 771 | 3300049460 | Ga0495682_0000153 | Ga0495682_0000153_13769_14656 | 291 |
| 772 | 3300049460 | Ga0495682_0004151 | Ga0495682_0004151_1456_2481 | 291 |
| 773 | 3300049460 | Ga0495682_0020304 | Ga0495682_0020304_1332_2207 | 291 |
| 774 | 3300049460 | Ga0495682_0042657 | Ga0495682_0042657_439_1314 | 291 |
| 775 | 3300049460 | Ga0495682_0065185 | Ga0495682_0065185_86_961 | 291 |
| 776 | 3300049460 | Ga0495682_0086038 | Ga0495682_0086038_221_1096 | 291 |
| 777 | 3300049568 | Ga0501031_0111953 | Ga0501031_0111953_459_1421 | 291 |
| 778 | 3300049573 | Ga0501037_0302412 | Ga0501037_0302412_166_1098 | 291 |
| 779 | 3300049662 | Ga0501222_004172 | Ga0501222_004172_137_1012 | 291 |
| 780 | 3300049758 | Ga0501241_004405 | Ga0501241_004405_260_1135 | 291 |
| 781 | 3300049853 | Ga0501226_000017 | Ga0501226_000017_93368_94330 | 291 |
| 782 | 3300050491 | nmdc:mga00v17_117429_c1 | nmdc:mga00v17_117429_c1_112_987 | 291 |
| 783 | 3300053111 | Ga0500572_004688 | Ga0500572_004688_416_1291 | 291 |
| 784 | 3300053125 | Ga0500618_025028 | Ga0500618_025028_96_1058 | 291 |
| 785 | 3300053140 | Ga0500573_0040451 | Ga0500573_0040451_623_1585 | 291 |
| 786 | iso_pu_bacteria | 2510065053 | 2510285141 | 291 |
| 787 | iso_pu_bacteria | 2510065055 | 2510294022 | 291 |
| 788 | iso_pu_bacteria | 2510065058 | 2510313056 | 291 |
| 789 | iso_pu_bacteria | 2511231004 | 2511254580 | 291 |
| 790 | iso_pu_bacteria | 2511231006 | 2511266622 | 291 |
| 791 | iso_pu_bacteria | 2511231007 | 2511270760 | 291 |
| 792 | iso_pu_bacteria | 2511231008 | 2511276672 | 291 |
| 793 | iso_pu_bacteria | 2511231010 | 2511293035 | 291 |
| 794 | iso_pu_bacteria | 2511231011 | 2511296267 | 291 |
| 795 | iso_pu_bacteria | 2511231012 | 2511301895 | 291 |
| 796 | iso_pu_bacteria | 2511231015 | 2511321007 | 291 |
| 797 | iso_pu_bacteria | 2511231016 | 2511323983 | 291 |
| 798 | iso_pu_bacteria | 2511231017 | 2511331572 | 291 |
| 799 | iso_pu_bacteria | 2511231018 | 2511339038 | 291 |
| 800 | iso_pu_bacteria | 2511231019 | 2511345000 | 291 |
| 801 | iso_pu_bacteria | 2511231020 | 2511349346 | 291 |
| 802 | iso_pu_bacteria | 2511231021 | 2511356449 | 291 |
| 803 | iso_pu_bacteria | 2511231022 | 2511364427 | 291 |
| 804 | iso_pu_bacteria | 2511231023 | 2511370195 | 291 |
| 805 | iso_pu_bacteria | 2511231031 | 2511414636 | 291 |
| 806 | iso_pu_bacteria | 2511231156 | 2511826349 | 291 |
| 807 | iso_pu_bacteria | 2512047018 | 2512324148 | 291 |
| 808 | iso_pu_bacteria | 2554235341 | 2555671408 | 291 |
| 809 | iso_pu_bacteria | 2582580891 | 2583793818 | 291 |
| 810 | iso_pu_bacteria | 2597489887 | 2597859492 | 291 |
| 811 | iso_pu_bacteria | 2599185155 | 2599328589 | 291 |
| 812 | iso_pu_bacteria | 2599185160 | 2599354435 | 291 |
| 813 | iso_pu_bacteria | 2599185161 | 2599359851 | 291 |
| 814 | iso_pu_bacteria | 2599185162 | 2599366173 | 291 |
| 815 | iso_pu_bacteria | 2599185163 | 2599372963 | 291 |
| 816 | iso_pu_bacteria | 2599185164 | 2599379543 | 291 |
| 817 | iso_pu_bacteria | 2599185165 | 2599385479 | 291 |
| 818 | iso_pu_bacteria | 2599185166 | 2599391822 | 291 |
| 819 | iso_pu_bacteria | 2599185167 | 2599401751 | 291 |
| 820 | iso_pu_bacteria | 2599185168 | 2599403588 | 291 |
| 821 | iso_pu_bacteria | 2599185179 | 2599451604 | 291 |
| 822 | iso_pu_bacteria | 2599185181 | 2599461269 | 291 |
| 823 | iso_pu_bacteria | 2599185182 | 2599469813 | 291 |
| 824 | iso_pu_bacteria | 2599185185 | 2599482322 | 291 |
| 825 | iso_pu_bacteria | 2599185186 | 2599490289 | 291 |
| 826 | iso_pu_bacteria | 2599185188 | 2599504152 | 291 |
| 827 | iso_pu_bacteria | 2599185190 | 2599514995 | 291 |
| 828 | iso_pu_bacteria | 2599185191 | 2599521096 | 291 |
| 829 | iso_pu_bacteria | 2599185212 | 2599613438 | 291 |
| 830 | iso_pu_bacteria | 2599185248 | 2599772342 | 291 |
| 831 | iso_pu_bacteria | 2599185257 | 2599803959 | 291 |
| 832 | iso_pu_bacteria | 2599185288 | 2599882322 | 291 |
| 833 | iso_pu_bacteria | 2599185289 | 2599888936 | 291 |
| 834 | iso_pu_bacteria | 2599185290 | 2599894204 | 291 |
| 835 | iso_pu_bacteria | 2599185291 | 2599900565 | 291 |
| 836 | iso_pu_bacteria | 2599185300 | 2599935183 | 291 |
| 837 | iso_pu_bacteria | 2599185302 | 2599943961 | 291 |
| 838 | iso_pu_bacteria | 2599185303 | 2599952269 | 291 |
| 839 | iso_pu_bacteria | 2599185304 | 2599955827 | 291 |
| 840 | iso_pu_bacteria | 2599185305 | 2599961461 | 291 |
| 841 | iso_pu_bacteria | 2599185306 | 2599969861 | 291 |
| 842 | iso_pu_bacteria | 2599185307 | 2599974282 | 291 |
| 843 | iso_pu_bacteria | 2599185308 | 2599981469 | 291 |
| 844 | iso_pu_bacteria | 2599185309 | 2599985628 | 291 |
| 845 | iso_pu_bacteria | 2599185310 | 2599989551 | 291 |
| 846 | iso_pu_bacteria | 2599185311 | 2599994422 | 291 |
| 847 | iso_pu_bacteria | 2599185312 | 2600000103 | 291 |
| 848 | iso_pu_bacteria | 2599185313 | 2600009082 | 291 |
| 849 | iso_pu_bacteria | 2599185314 | 2600015290 | 291 |
| 850 | iso_pu_bacteria | 2599185315 | 2600019597 | 291 |
| 851 | iso_pu_bacteria | 2599185316 | 2600023716 | 291 |
| 852 | iso_pu_bacteria | 2599185317 | 2600032362 | 291 |
| 853 | iso_pu_bacteria | 2599185318 | 2600038805 | 291 |
| 854 | iso_pu_bacteria | 2599185319 | 2600044152 | 291 |
| 855 | iso_pu_bacteria | 2599185320 | 2600048358 | 291 |
| 856 | iso_pu_bacteria | 2599185321 | 2600054107 | 291 |
| 857 | iso_pu_bacteria | 2599185322 | 2600060327 | 291 |
| 858 | iso_pu_bacteria | 2599185323 | 2600066583 | 291 |
| 859 | iso_pu_bacteria | 2599185324 | 2600074366 | 291 |
| 860 | iso_pu_bacteria | 2599185325 | 2600078109 | 291 |
| 861 | iso_pu_bacteria | 2599185356 | 2600213885 | 291 |
| 862 | iso_pu_bacteria | 2600254930 | 2600361924 | 291 |
| 863 | iso_pu_bacteria | 2600254931 | 2600364396 | 291 |
| 864 | iso_pu_bacteria | 2600254954 | 2600443128 | 291 |
| 865 | iso_pu_bacteria | 2600255283 | 2601626575 | 291 |
| 866 | iso_pu_bacteria | 2600255313 | 2601774051 | 291 |
| 867 | iso_pu_bacteria | 2600255318 | 2601795595 | 291 |
| 868 | iso_pu_bacteria | 2600255389 | 2602009383 | 291 |
| 869 | iso_pu_bacteria | 2603880185 | 2606075664 | 291 |
| 870 | iso_pu_bacteria | 2603880199 | 2606128423 | 291 |
| 871 | iso_pu_bacteria | 2606217733 | 2608384633 | 291 |
| 872 | iso_pu_bacteria | 2619619299 | 2621300746 | 291 |
| 873 | iso_pu_bacteria | 2623620443 | 2624479533 | 291 |
| 874 | iso_pu_bacteria | 2623620446 | 2624493456 | 291 |
| 875 | iso_pu_bacteria | 2643221565 | 2643842742 | 291 |
| 876 | iso_pu_bacteria | 2643221589 | 2643952665 | 291 |
| 877 | iso_pu_bacteria | 2643221602 | 2644022427 | 291 |
| 878 | iso_pu_bacteria | 2643221633 | 2644187451 | 291 |
| 879 | iso_pu_bacteria | 2643221650 | 2644281828 | 291 |
| 880 | iso_pu_bacteria | 2651869719 | 2652544525 | 291 |
| 881 | iso_pu_bacteria | 2667528170 | 2671093226 | 291 |
| 882 | iso_pu_bacteria | 2667528171 | 2671097016 | 291 |
| 883 | iso_pu_bacteria | 2667528176 | 2671128910 | 291 |
| 884 | iso_pu_bacteria | 2671180172 | 2671770473 | 291 |
| 885 | iso_pu_bacteria | 2675903515 | 2678264698 | 291 |
| 886 | iso_pu_bacteria | 2713897148 | 2715753934 | 291 |
| 887 | iso_pu_bacteria | 2713897149 | 2715757799 | 291 |
| 888 | iso_pu_bacteria | 2718217725 | 2718633362 | 291 |
| 889 | iso_pu_bacteria | 2738541265 | 2738670636 | 291 |
| 890 | iso_pu_bacteria | 2738541271 | 2738691390 | 291 |
| 891 | iso_pu_bacteria | 2738541282 | 2738749029 | 291 |
| 892 | iso_pu_bacteria | 2738541294 | 2738812224 | 291 |
| 893 | iso_pu_bacteria | 2738541303 | 2738858071 | 291 |
| 894 | iso_pu_bacteria | 2738541309 | 2738899584 | 291 |
| 895 | iso_pu_bacteria | 2738543004 | 2739201234 | 291 |
| 896 | iso_pu_bacteria | 2738543015 | 2739262423 | 291 |
| 897 | iso_pu_bacteria | 2738543016 | 2739267165 | 291 |
| 898 | iso_pu_bacteria | 2738543020 | 2739286272 | 291 |
| 899 | iso_pu_bacteria | 2738543021 | 2739291585 | 291 |
| 900 | iso_pu_bacteria | 2738543025 | 2739316194 | 291 |
| 901 | iso_pu_bacteria | 2740892503 | 2743739022 | 291 |
| 902 | iso_pu_bacteria | 2744054620 | 2745005152 | 291 |
| 903 | iso_pu_bacteria | 2773857670 | 2774123429 | 291 |
| 904 | iso_pu_bacteria | 2773857672 | 2774128233 | 291 |
| 905 | iso_pu_bacteria | 2773857673 | 2774138423 | 291 |
| 906 | iso_pu_bacteria | 2784132072 | 2784316029 | 291 |
| 907 | iso_pu_bacteria | 2791355520 | 2794595040 | 291 |
| 908 | iso_pu_bacteria | 2808606361 | 2808857098 | 291 |
| 909 | iso_pu_bacteria | 2808606373 | 2808907254 | 291 |
| 910 | iso_pu_bacteria | 2808606376 | 2808926676 | 291 |
| 911 | iso_pu_bacteria | 2808606377 | 2808927462 | 291 |
| 912 | iso_pu_bacteria | 2808606378 | 2808937170 | 291 |
| 913 | iso_pu_bacteria | 2808606379 | 2808940647 | 291 |
| 914 | iso_pu_bacteria | 2808606380 | 2808948837 | 291 |
| 915 | iso_pu_bacteria | 2808606381 | 2808949999 | 291 |
| 916 | iso_pu_bacteria | 2808606382 | 2808957284 | 291 |
| 917 | iso_pu_bacteria | 2808606383 | 2808965486 | 291 |
| 918 | iso_pu_bacteria | 2808606385 | 2808980914 | 291 |
| 919 | iso_pu_bacteria | 2808606388 | 2808996638 | 291 |
| 920 | iso_pu_bacteria | 2808606389 | 2809000273 | 291 |
| 921 | iso_pu_bacteria | 2808606445 | 2809216476 | 291 |
| 922 | iso_pu_bacteria | 2811994881 | 2812368079 | 291 |
| 923 | iso_pu_bacteria | 2816332298 | 2817490014 | 291 |
| 924 | iso_pu_bacteria | 2818991456 | 2819654697 | 291 |
| 925 | iso_pu_bacteria | 2818991464 | 2819702110 | 291 |
| 926 | iso_pu_bacteria | 2823421272 | 2823424758 | 291 |
| 927 | iso_pu_bacteria | 2825651385 | 2825656415 | 291 |
| 928 | iso_pu_bacteria | 2826581358 | 2826584501 | 291 |
| 929 | iso_pu_bacteria | 2834028612 | 2834029819 | 291 |
| 930 | iso_pu_bacteria | 2842805378 | 2842805561 | 291 |
| 931 | iso_pu_bacteria | 2842815866 | 2842818055 | 291 |
| 932 | iso_pu_bacteria | 2842832357 | 2842832596 | 291 |
| 933 | iso_pu_bacteria | 2842849001 | 2842849309 | 291 |
| 934 | iso_pu_bacteria | 2842854478 | 2842856800 | 291 |
| 935 | iso_pu_bacteria | 2844665904 | 2844671928 | 291 |
| 936 | iso_pu_bacteria | 2852612431 | 2852617639 | 291 |
| 937 | iso_pu_bacteria | 2852657418 | 2852659019 | 291 |
| 938 | iso_pu_bacteria | 2852667396 | 2852672997 | 291 |
| 939 | iso_pu_bacteria | 2860339153 | 2860339918 | 291 |
| 940 | iso_pu_bacteria | 2880230671 | 2880232409 | 291 |
| 941 | iso_pu_bacteria | 2904518522 | 2904523900 | 291 |
| 942 | iso_pu_bacteria | 2908446538 | 2908448768 | 291 |
| 943 | iso_pu_bacteria | 2913036834 | 2913041172 | 291 |
| 944 | iso_pu_bacteria | 2917070673 | 2917075274 | 291 |
| 945 | iso_pu_bacteria | 2917832318 | 2917835417 | 291 |
| 946 | iso_pu_bacteria | 2919125081 | 2919129251 | 291 |
| 947 | iso_pu_bacteria | 2919385768 | 2919386500 | 291 |
| 948 | iso_pu_bacteria | 2919456309 | 2919457013 | 291 |
| 949 | iso_pu_bacteria | 2919481497 | 2919486066 | 291 |
| 950 | iso_pu_bacteria | 2919487758 | 2919491217 | 291 |
| 951 | iso_pu_bacteria | 2919501602 | 2919504484 | 291 |
| 952 | iso_pu_bacteria | 2923519811 | 2923522132 | 291 |
| 953 | iso_pu_bacteria | 2923586266 | 2923590156 | 291 |
| 954 | iso_pu_bacteria | 2926063275 | 2926064943 | 291 |
| 955 | iso_pu_bacteria | 2929144301 | 2929148625 | 291 |
| 956 | iso_pu_bacteria | 2931369376 | 2931373936 | 291 |
| 957 | iso_pu_bacteria | 2931390751 | 2931392890 | 291 |
| 958 | iso_pu_bacteria | 2931396565 | 2931400188 | 291 |
| 959 | iso_pu_bacteria | 2935353572 | 2935356262 | 291 |
| 960 | iso_pu_bacteria | 2939636861 | 2939639645 | 291 |
| 961 | iso_pu_bacteria | 2939651529 | 2939655843 | 291 |
| 962 | iso_pu_bacteria | 2945961074 | 2945965022 | 291 |
| 963 | iso_pu_bacteria | 2946006987 | 2946010962 | 291 |
| 964 | iso_pu_bacteria | 2969304461 | 2969306321 | 291 |
| 965 | iso_pu_bacteria | 2974289157 | 2974292025 | 291 |
| 966 | iso_pu_bacteria | 2974298342 | 2974299610 | 291 |
| 967 | iso_pu_bacteria | 2984286254 | 2984288077 | 291 |
| 968 | iso_pu_bacteria | 2984499530 | 2984501967 | 291 |
| 969 | iso_pu_bacteria | 2984504281 | 2984504534 | 291 |
| 970 | iso_pu_bacteria | 2988728565 | 2988730214 | 291 |
| 971 | iso_pu_bacteria | 2990196909 | 2990200195 | 291 |
| 972 | iso_pu_bacteria | 2998139840 | 2998141716 | 291 |
| 973 | iso_pu_bacteria | 3007252601 | 3007253446 | 291 |
| 974 | iso_pu_bacteria | 3007315729 | 3007317747 | 291 |
| 975 | iso_pu_bacteria | 3007395558 | 3007397404 | 291 |
| 976 | iso_pu_bacteria | 3007419365 | 3007424563 | 291 |
| 977 | iso_pu_bacteria | 3007511990 | 3007515670 | 291 |
| 978 | iso_pu_bacteria | 3007614139 | 3007618761 | 291 |
| 979 | iso_pu_bacteria | 3007619802 | 3007625501 | 291 |
| 980 | iso_pu_bacteria | 3007718800 | 3007719387 | 291 |
| 981 | iso_pu_bacteria | 3007855910 | 3007856307 | 291 |
| 982 | iso_pu_bacteria | 3007861166 | 3007863046 | 291 |
| 983 | iso_pu_bacteria | 3007866637 | 3007870557 | 291 |
| 984 | iso_pu_bacteria | 637000220 | 637321730 | 291 |
| 985 | iso_pu_bacteria | 8011350971 | 8011353882 | 291 |
| 986 | iso_pu_bacteria | 8015687852 | 8015692197 | 291 |
| 987 | iso_pu_bacteria | 8016728285 | 8016733658 | 291 |
| 988 | iso_pu_bacteria | 8019775933 | 8019776451 | 291 |
| 989 | iso_pu_bacteria | 8034962539 | 8034962735 | 291 |
| 990 | iso_pu_bacteria | 8054285046 | 8054285616 | 291 |
| 991 | iso_pu_bacteria | 8054503363 | 8054505387 | 291 |
| 992 | iso_pu_bacteria | 8055770955 | 8055775406 | 291 |
| 993 | iso_pu_bacteria | 8055817908 | 8055819956 | 291 |
| 994 | iso_pu_bacteria | 8056125926 | 8056130090 | 291 |
| 995 | iso_pu_bacteria | 8056131705 | 8056133726 | 291 |
| 996 | iso_pu_bacteria | 8056143049 | 8056144757 | 291 |
| 997 | iso_pu_bacteria | 8056155041 | 8056156134 | 291 |
| 998 | iso_pu_bacteria | 8056166840 | 8056169277 | 291 |
| 999 | iso_pu_bacteria | 8056172158 | 8056175464 | 291 |
| 1000 | iso_pu_bacteria | 8056177738 | 8056181240 | 291 |
| 1001 | iso_pu_bacteria | 8056569372 | 8056571449 | 291 |
| 1002 | iso_pu_bacteria | 8057798959 | 8057804222 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oby-assembly2.cif.gz_C | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9741 | 1 | 285 |
| 2j8z-assembly1.cif.gz_A-2 | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9713 | 1 | 285 |
| 4dup-assembly1.cif.gz_A | crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 | 0.9696 | 2 | 286 |
| 2oby-assembly2.cif.gz_C | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9511 | 1 | 285 |
| 4dup-assembly1.cif.gz_B | crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 | 0.9508 | 2 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6HNQ2_3_340_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9785 | 1 | 286 | 3.90.180.10 |
| af_C6TID4_1_124_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9759 | 4 | 89 | 3.90.180.10 |
| af_Q4DAS0_3_129_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9747 | 4 | 88 | 3.90.180.10 |
| af_A0A1D6HNQ2_126_296_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9678 | 89 | 242 | 3.40.50.720 |
| af_Q75JT6_1_334_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9634 | 1 | 285 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A803NY03-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9824 | 1 | 286 |
GO:0016651
GO:0034045 GO:0070402 |
| AF-A0A0S6UP13-F1-model_v4 | Quinone oxidoreductase | 0.9796 | 1 | 286 |
GO:0016651
GO:0070402 |
| AF-A0A445BBA4-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9789 | 1 | 287 |
GO:0008270
GO:0016651 GO:0070402 |
| AF-A0A7J6HSH9-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9786 | 1 | 289 |
GO:0016020
GO:0016651 GO:0070402 |
| AF-A0A1B1BLD5-F1-model_v4 | NADPH:quinone oxidoreductase | 0.978 | 1 | 286 |
GO:0016651
GO:0070402 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar