F487484

General Info

Members Datasets Scaffolds Average Seq Length
984 372 825 382

Family's Representative Sequence

Representative Sequence 3300047470|Ga0495681_0002728|Ga0495681_0002728_8290_9528
Length 412
Sequence MAPTTVELQASSLPAIFHQASFPSEKESCMLRKNLLATLCAGVLISATVPVLAAPAQTMKSEDGTLEVTSIVTGLEHPWALAFLPDSKNMLVTERPGNLRLVTADGKLSAPLNGVPTVWAKGQGGLLDVALSPDFKQDRMVYLSYAEGGGKGDKAGTAVGRGRLSDDMTALKDFQVILRQEPKLSVGNHFGSRLVFDRDGYLFVTLGENNDRPTAQDLDKLQGKVVRIYPDGTVPKDNPFVGQANVRPEIWSYGQRNPQGAALNPWNGTLWENEHGPLGGDEINIIERGKNYGWPLATHGINYSGQPIPEAKGETIEGAVAPNHVWEKSPGLSGMAFYDADRFKVWQRNVFIGALVSQELIRLEFDGDKVVHEERMLGELKKRIRDVRQGPDGYLYVLTDEENGGLYKVGLK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231017 Pseudomonas sp. GM55 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231020 Pseudomonas sp. GM74 Isolate Nodule
14 2511231021 Pseudomonas sp. GM78 Isolate Nodule
15 2511231023 Pseudomonas sp. GM80 Isolate Nodule
16 2511231031 Pseudomonas sp. GM16 Isolate Nodule
17 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
18 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
19 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
20 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
21 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
22 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
23 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
24 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
25 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
26 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
27 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
28 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
29 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
30 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
31 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
32 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
33 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
34 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
35 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
36 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
37 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
38 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
39 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
40 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
41 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
42 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
43 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
44 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
45 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
46 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
47 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
48 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
49 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
50 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
51 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
52 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
53 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
54 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
55 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
56 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
57 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
58 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
59 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
60 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
61 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
62 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
63 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
64 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
65 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
66 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
67 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
68 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
69 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
70 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
71 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
72 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
73 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
74 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
75 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
76 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
77 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
78 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
79 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
80 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
81 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
82 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
83 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
84 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
85 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
86 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
87 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
88 2773857673 Pseudomonas sp. 443 Isolate Unclassified
89 2784132063 Pseudomonas sp. 424 Isolate Unclassified
90 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
91 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
92 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
93 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
94 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
95 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
96 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
97 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
98 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
99 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
100 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
101 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
102 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
103 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
104 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
105 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
106 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
107 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
108 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
109 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
110 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
111 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
112 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
113 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
114 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
115 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
116 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
117 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
118 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
119 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
120 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
121 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
122 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
123 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
124 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
125 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
126 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
127 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
128 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
129 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
130 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
131 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
132 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
133 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
134 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
135 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
136 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
137 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
138 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
139 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
140 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
141 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
142 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
143 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
144 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
145 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
146 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
147 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
148 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
149 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
150 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
151 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
152 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
153 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
154 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
155 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
156 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
157 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
158 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
159 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
160 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
161 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
162 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
163 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
164 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
165 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
166 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
167 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
168 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
169 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
170 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
171 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
172 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
173 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
174 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
175 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
176 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
177 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
180 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
181 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
182 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
183 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
184 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
185 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
186 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
187 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
188 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
189 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
190 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
191 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
192 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
199 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
231 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
232 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
233 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
237 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
238 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
239 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
240 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
241 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
242 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
243 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
244 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
245 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
246 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
247 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
248 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
251 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
254 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
255 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
256 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
257 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
261 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
272 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
273 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
281 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
282 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
291 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
305 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
324 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
325 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
326 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
327 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
328 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
329 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
342 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
343 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
344 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
345 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
353 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
354 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
357 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
358 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
359 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
360 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
361 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
362 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
363 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
364 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
365 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
366 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
367 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
368 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
369 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
370 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
371 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
372 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.84
Metatranscriptomes 0
Isolates 16.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 2.03
Rhizoplane 5.28
Rhizosphere 79.07
Stem 0
Stem Tuber 0
Unclassified 10.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6993 2124908027 Bacteria 5600
2 MRS2a_Contig_731 2124908027 Bacteria 6715
3 SwRhRL2b_contig_1875304 2162886007 Bacteria 8741
4 MRS1b_contig_5847325 2162886011 Bacteria 6155
5 Ga0055539_1000011 3300003752 Bacteria 399747
6 Ga0055533_1000014 3300003756 Bacteria 399747
7 Ga0055532_1000009 3300003758 Bacteria 399537
8 Ga0055525_1000016 3300003759 Bacteria 399724
9 Ga0055536_1000352 3300003781 Bacteria 34235
10 Ga0055530_10000019 3300003791 Bacteria 140299
11 Ga0055530_10002917 3300003791 Bacteria 10359
12 Ga0055540_1000006 3300003792 Bacteria 372018
13 Ga0055540_1000055 3300003792 Bacteria 140299
14 Ga0055531_10000126 3300003794 Bacteria 85918
15 Ga0055541_1000008 3300003841 Bacteria 399724
16 Ga0065714_10000255 3300005288 Bacteria 6634
17 Ga0065714_10002219 3300005288 Bacteria 48487
18 Ga0065714_10003565 3300005288 Bacteria 9246
19 Ga0065714_10009982 3300005288 Bacteria 2919
20 Ga0065714_10012859 3300005288 Bacteria 2408
21 Ga0065714_10023451 3300005288 Bacteria 1325
22 Ga0065714_10068323 3300005288 Bacteria 4813
23 Ga0065714_10075816 3300005288 Bacteria 2853
24 Ga0065714_10082916 3300005288 Bacteria 2280
25 Ga0065704_10070628 3300005289 Bacteria 18936
26 Ga0065704_10099151 3300005289 Bacteria 2323
27 Ga0065704_10136757 3300005289 Bacteria 1562
28 Ga0065712_10069901 3300005290 Bacteria 6539
29 Ga0065715_10013805 3300005293 Bacteria 2439
30 Ga0070670_100000495 3300005331 Bacteria 31488
31 Ga0070670_100002291 3300005331 Bacteria 15770
32 Ga0070669_100010476 3300005353 Bacteria 6585
33 Ga0070662_100003888 3300005457 Bacteria 9362
34 Ga0070662_100037132 3300005457 Bacteria 3452
35 Ga0070664_100000064 3300005564 Bacteria 65571
36 Ga0068851_10000165 3300005834 Bacteria 34440
37 Ga0075432_10000990 3300006058 Bacteria 8989
38 Ga0075432_10003031 3300006058 Bacteria 5668
39 Ga0075362_10118062 3300006177 Bacteria 1254
40 Ga0075436_100015966 3300006914 Bacteria 5140
41 Ga0075436_100022524 3300006914 Bacteria 4326
42 Ga0079104_1000235 3300006946 Bacteria 74576
43 Ga0079104_1000873 3300006946 Bacteria 24899
44 Ga0099826_10010909 3300006948 Bacteria 6824
45 Ga0105251_10000456 3300009011 Bacteria 39260
46 Ga0105251_10001310 3300009011 Bacteria 21494
47 Ga0105251_10014230 3300009011 Bacteria 4412
48 Ga0105251_10019713 3300009011 Bacteria 3555
49 Ga0105251_10025751 3300009011 Bacteria 3004
50 Ga0105251_10029890 3300009011 Bacteria 2741
51 Ga0105251_10034266 3300009011 Bacteria 2514
52 Ga0105251_10100078 3300009011 Bacteria 1325
53 Ga0105244_10002575 3300009036 Bacteria 13612
54 Ga0105244_10003967 3300009036 Bacteria 10376
55 Ga0105244_10004549 3300009036 Bacteria 9500
56 Ga0105244_10006056 3300009036 Bacteria 7920
57 Ga0105244_10009002 3300009036 Bacteria 6178
58 Ga0105244_10015172 3300009036 Bacteria 4425
59 Ga0105244_10027913 3300009036 Bacteria 3035
60 Ga0105250_10000145 3300009092 Bacteria 62334
61 Ga0105250_10000256 3300009092 Bacteria 44131
62 Ga0105250_10000757 3300009092 Bacteria 19646
63 Ga0105250_10011541 3300009092 Bacteria 3663
64 Ga0105250_10015734 3300009092 Bacteria 3095
65 Ga0105243_10013488 3300009148 Bacteria 6180
66 Ga0105243_10022501 3300009148 Bacteria 4792
67 Ga0105242_10004868 3300009176 Bacteria 10395
68 Ga0105237_10000426 3300009545 Bacteria 59965
69 Ga0105246_10000009 3300011119 Bacteria 79055
70 Ga0105246_10011996 3300011119 Bacteria 5396
71 Ga0105246_10086860 3300011119 Bacteria 2243
72 Ga0157345_1000181 3300012498 Bacteria 9989
73 Ga0157373_10002099 3300013100 Bacteria 15088
74 Ga0157373_10002260 3300013100 Bacteria 14599
75 Ga0157373_10002438 3300013100 Bacteria 14153
76 Ga0157373_10004688 3300013100 Bacteria 10279
77 Ga0157373_10016012 3300013100 Bacteria 5473
78 Ga0157373_10025264 3300013100 Bacteria 4298
79 Ga0157373_10134310 3300013100 Bacteria 1740
80 Ga0157373_10164962 3300013100 Bacteria 1559
81 Ga0157371_10000189 3300013102 Bacteria 91155
82 Ga0157371_10017892 3300013102 Bacteria 5255
83 Ga0157370_10066712 3300013104 Bacteria 3402
84 Ga0157370_10086648 3300013104 Bacteria 2942
85 Ga0157370_10103178 3300013104 Bacteria 2670
86 Ga0157370_10191776 3300013104 Bacteria 1897
87 Ga0157369_10005447 3300013105 Bacteria 14804
88 Ga0157369_10007726 3300013105 Bacteria 12369
89 Ga0157369_10012736 3300013105 Bacteria 9536
90 Ga0157369_10036133 3300013105 Bacteria 5414
91 Ga0157369_10045733 3300013105 Bacteria 4759
92 Ga0157369_10100516 3300013105 Bacteria 3083
93 Ga0163162_10000169 3300013306 Bacteria 60285
94 Ga0157375_10003950 3300013308 Bacteria 12858
95 Ga0157375_10215829 3300013308 Bacteria 2076
96 Ga0182008_10000404 3300014497 Bacteria 33433
97 Ga0182008_10000942 3300014497 Bacteria 20251
98 Ga0182008_10007227 3300014497 Bacteria 6143
99 Ga0182008_10044238 3300014497 Bacteria 2214
100 Ga0182008_10055744 3300014497 Bacteria 1954
101 Ga0182008_10085377 3300014497 Bacteria 1555
102 Ga0182006_1000452 3300015261 Bacteria 32460
103 Ga0182006_1000704 3300015261 Bacteria 23177
104 Ga0182006_1004026 3300015261 Bacteria 7334
105 Ga0182006_1011474 3300015261 Bacteria 3895
106 Ga0182006_1016570 3300015261 Bacteria 3142
107 Ga0182006_1030283 3300015261 Bacteria 2187
108 Ga0182007_10000083 3300015262 Bacteria 71163
109 Ga0182007_10001288 3300015262 Bacteria 13564
110 Ga0182007_10004715 3300015262 Bacteria 6134
111 Ga0182005_1001844 3300015265 Bacteria 8061
112 Ga0182005_1008383 3300015265 Bacteria 3050
113 Ga0182005_1008813 3300015265 Bacteria 2961
114 Ga0182005_1009216 3300015265 Bacteria 2881
115 Ga0182005_1040602 3300015265 Bacteria 1265
116 Ga0163161_10000440 3300017792 Bacteria 34643
117 Ga0163161_10001602 3300017792 Bacteria 16690
118 Ga0163161_10004328 3300017792 Bacteria 9895
119 Ga0163161_10009073 3300017792 Bacteria 6878
120 Ga0163161_10048643 3300017792 Bacteria 3063
121 Ga0163161_10097373 3300017792 Bacteria 2185
122 Ga0163161_10161309 3300017792 Bacteria 1710
123 Ga0209435_101164 3300025206 Bacteria 3595
124 Ga0209784_100023 3300025224 Bacteria 399841
125 Ga0209566_100019 3300025225 Bacteria 414836
126 Ga0209674_100034 3300025226 Bacteria 414903
127 Ga0209147_100027 3300025229 Bacteria 414610
128 Ga0209563_100037 3300025230 Bacteria 414903
129 Ga0209563_100908 3300025230 Bacteria 8742
130 Ga0209258_100268 3300025242 Bacteria 89701
131 Ga0209646_1000323 3300025246 Bacteria 36796
132 Ga0209677_100021 3300025253 Bacteria 414954
133 Ga0209675_1004176 3300025291 Bacteria 6539
134 Ga0209676_1000002 3300025292 Bacteria 1732948
135 Ga0209676_1000158 3300025292 Bacteria 162469
136 Ga0209676_1002612 3300025292 Bacteria 12321
137 Ga0209676_1004504 3300025292 Bacteria 7733
138 Ga0209050_1000006 3300025298 Bacteria 1359702
139 Ga0209050_1000013 3300025298 Bacteria 811408
140 Ga0209050_1000321 3300025298 Bacteria 96465
141 Ga0209051_1000001 3300025303 Bacteria 1732974
142 Ga0209051_1000007 3300025303 Bacteria 811408
143 Ga0209051_1017169 3300025303 Bacteria 3243
144 Ga0209257_1000029 3300025304 Bacteria 695617
145 Ga0207656_10002984 3300025321 Bacteria 5782
146 Ga0207696_1000002 3300025711 Bacteria 1098043
147 Ga0207696_1000011 3300025711 Bacteria 530614
148 Ga0207696_1000186 3300025711 Bacteria 96544
149 Ga0207696_1002373 3300025711 Bacteria 9305
150 Ga0207696_1004244 3300025711 Bacteria 6221
151 Ga0207696_1039914 3300025711 Bacteria 1377
152 Ga0207655_1000022 3300025728 Bacteria 483933
153 Ga0207655_1000207 3300025728 Bacteria 102951
154 Ga0207655_1000379 3300025728 Bacteria 62077
155 Ga0207655_1001659 3300025728 Bacteria 19713
156 Ga0207655_1004289 3300025728 Bacteria 10202
157 Ga0207655_1005715 3300025728 Bacteria 8399
158 Ga0207655_1008836 3300025728 Bacteria 6334
159 Ga0207655_1015187 3300025728 Bacteria 4298
160 Ga0207655_1018714 3300025728 Bacteria 3658
161 Ga0207655_1027367 3300025728 Bacteria 2717
162 Ga0207655_1028945 3300025728 Bacteria 2603
163 Ga0207655_1047020 3300025728 Bacteria 1785
164 Ga0207713_1000162 3300025735 Bacteria 98630
165 Ga0207713_1000326 3300025735 Bacteria 53850
166 Ga0207713_1000447 3300025735 Bacteria 43462
167 Ga0207713_1000552 3300025735 Bacteria 37422
168 Ga0207713_1006733 3300025735 Bacteria 6943
169 Ga0207713_1008776 3300025735 Bacteria 5762
170 Ga0207713_1011581 3300025735 Bacteria 4780
171 Ga0207713_1029694 3300025735 Bacteria 2444
172 Ga0207713_1029696 3300025735 Bacteria 2444
173 Ga0207713_1056082 3300025735 Bacteria 1533
174 Ga0207671_10000743 3300025914 Bacteria 41315
175 Ga0207649_10000116 3300025920 Bacteria 67931
176 Ga0207650_10000750 3300025925 Bacteria 24996
177 Ga0207686_10002731 3300025934 Bacteria 9567
178 Ga0207709_10000004 3300025935 Bacteria 825156
179 Ga0207679_10000054 3300025945 Bacteria 108733
180 Ga0207639_10118851 3300026041 Bacteria 2168
181 Ga0209281_1000009 3300027111 Bacteria 771717
182 Ga0209281_1000046 3300027111 Bacteria 327042
183 Ga0209281_1013568 3300027111 Bacteria 1754
184 Ga0207428_10007691 3300027907 Bacteria 9809
185 Ga0207428_10022356 3300027907 Bacteria 5338
186 Ga0307511_10144701 3300030521 Bacteria 1384
187 Ga0307408_100007588 3300031548 Bacteria 7171
188 Ga0307405_10000328 3300031731 Bacteria 17621
189 Ga0307405_10050641 3300031731 Bacteria 2572
190 Ga0307413_10044281 3300031824 Bacteria 2629
191 Ga0307413_10072835 3300031824 Bacteria 2170
192 Ga0307406_10016525 3300031901 Bacteria 4290
193 Ga0307407_10058849 3300031903 Bacteria 2235
194 Ga0307412_10001489 3300031911 Bacteria 13016
195 Ga0307412_10004125 3300031911 Bacteria 8096
196 Ga0307412_10005227 3300031911 Bacteria 7278
197 Ga0307412_10014820 3300031911 Bacteria 4607
198 Ga0307412_10193721 3300031911 Bacteria 1538
199 Ga0307409_100211491 3300031995 Bacteria 1743
200 Ga0307409_100271065 3300031995 Bacteria 1563
201 Ga0307416_100012044 3300032002 Bacteria 5805
202 Ga0307414_10265513 3300032004 Bacteria 1434
203 Ga0307414_10296114 3300032004 Bacteria 1366
204 Ga0307411_10012125 3300032005 Bacteria 4685
205 Ga0307411_10065922 3300032005 Bacteria 2430
206 Ga0307510_10014347 3300033180 Bacteria 9379
207 Ga0439438_000875 3300041405 Bacteria 13434
208 Ga0439438_000998 3300041405 Bacteria 12668
209 Ga0439438_001021 3300041405 Bacteria 12472
210 Ga0439438_001408 3300041405 Bacteria 10611
211 Ga0439438_001812 3300041405 Bacteria 9372
212 Ga0439438_003024 3300041405 Bacteria 6932
213 Ga0439438_003764 3300041405 Bacteria 5993
214 Ga0439438_004188 3300041405 Bacteria 5608
215 Ga0439438_005138 3300041405 Bacteria 4871
216 Ga0439447_001833 3300041407 Bacteria 7785
217 Ga0439447_002314 3300041407 Bacteria 6974
218 Ga0439447_003667 3300041407 Bacteria 5414
219 Ga0439447_003840 3300041407 Bacteria 5271
220 Ga0439447_005155 3300041407 Bacteria 4378
221 Ga0439447_014969 3300041407 Bacteria 2162
222 Ga0439466_0001055 3300041411 Bacteria 10631
223 Ga0439466_0001400 3300041411 Bacteria 9407
224 Ga0439466_0003160 3300041411 Bacteria 6409
225 Ga0439466_0010386 3300041411 Bacteria 3460
226 Ga0439466_0018033 3300041411 Bacteria 2536
227 Ga0451793_1073897 3300041452 Bacteria 2307
228 Ga0451807_1051409 3300041486 Bacteria 1826
229 Ga0439431_0006087 3300041997 Bacteria 2664
230 Ga0439445_0002580 3300042004 Bacteria 4031
231 Ga0439432_000031 3300042006 Bacteria 45793
232 Ga0439432_001202 3300042006 Bacteria 9801
233 Ga0439432_001230 3300042006 Bacteria 9678
234 Ga0439432_001672 3300042006 Bacteria 8305
235 Ga0439432_003431 3300042006 Bacteria 5883
236 Ga0439451_000310 3300042009 Bacteria 9433
237 Ga0439451_001779 3300042009 Bacteria 4303
238 Ga0439451_009077 3300042009 Bacteria 2014
239 Ga0439452_000317 3300042010 Bacteria 30475
240 Ga0439452_001132 3300042010 Bacteria 11656
241 Ga0439452_001430 3300042010 Bacteria 9795
242 Ga0439452_017043 3300042010 Bacteria 1962
243 Ga0439456_004229 3300042013 Bacteria 2911
244 Ga0439463_018138 3300042016 Bacteria 1750
245 Ga0450911_000076 3300042115 Bacteria 40401
246 Ga0450911_001437 3300042115 Bacteria 5488
247 Ga0450920_001078 3300042122 Bacteria 4467
248 Ga0450902_001808 3300042137 Bacteria 2963
249 Ga0450903_001550 3300042138 Bacteria 4281
250 Ga0450903_007363 3300042138 Bacteria 1812
251 Ga0450903_009157 3300042138 Bacteria 1616
252 Ga0450904_001002 3300042139 Bacteria 4387
253 Ga0450906_004556 3300042145 Bacteria 2892
254 Ga0450907_000269 3300042146 Bacteria 17496
255 Ga0450907_002262 3300042146 Bacteria 3742
256 Ga0439446_0005630 3300042156 Bacteria 3227
257 Ga0450908_001729 3300042184 Bacteria 4256
258 Ga0450909_001472 3300042185 Bacteria 3287
259 Ga0439434_0001842 3300042435 Bacteria 6160
260 Ga0439460_0003382 3300042461 Bacteria 3859
261 Ga0439460_0003508 3300042461 Bacteria 3794
262 Ga0450901_001417 3300042533 Bacteria 2739
263 Ga0439440_0000822 3300042993 Bacteria 5388
264 Ga0495617_000097 3300046452 Bacteria 62559
265 Ga0495617_001247 3300046452 Bacteria 11427
266 Ga0495617_001668 3300046452 Bacteria 9541
267 Ga0495617_005076 3300046452 Bacteria 4712
268 Ga0495617_005125 3300046452 Bacteria 4681
269 Ga0495617_005357 3300046452 Bacteria 4556
270 Ga0495617_017035 3300046452 Bacteria 2455
271 Ga0495617_026955 3300046452 Bacteria 1934
272 Ga0495617_034199 3300046452 Bacteria 1706
273 Ga0495627_000517 3300046453 Bacteria 31910
274 Ga0495627_000526 3300046453 Bacteria 31735
275 Ga0495627_001863 3300046453 Bacteria 11138
276 Ga0495627_004951 3300046453 Bacteria 5474
277 Ga0495627_015889 3300046453 Bacteria 2590
278 Ga0495592_0017072 3300046454 Bacteria 5510
279 Ga0495603_0011368 3300046455 Bacteria 5390
280 Ga0495603_0027710 3300046455 Bacteria 3418
281 Ga0495603_0037608 3300046455 Bacteria 2904
282 Ga0495590_0000708 3300046457 Bacteria 15249
283 Ga0495590_0008745 3300046457 Bacteria 3852
284 Ga0495590_0019869 3300046457 Bacteria 2389
285 Ga0495590_0021644 3300046457 Bacteria 2277
286 Ga0495591_000060 3300046458 Bacteria 129321
287 Ga0495591_000221 3300046458 Bacteria 56635
288 Ga0495591_000354 3300046458 Bacteria 40651
289 Ga0495591_002731 3300046458 Bacteria 9556
290 Ga0495591_002853 3300046458 Bacteria 9286
291 Ga0495591_006357 3300046458 Bacteria 5241
292 Ga0495591_006811 3300046458 Bacteria 4973
293 Ga0495591_007623 3300046458 Bacteria 4569
294 Ga0495591_007952 3300046458 Bacteria 4415
295 Ga0495591_008212 3300046458 Bacteria 4302
296 Ga0495591_015788 3300046458 Bacteria 2655
297 Ga0495638_0000298 3300046460 Bacteria 64005
298 Ga0495638_0001565 3300046460 Bacteria 20511
299 Ga0495638_0002480 3300046460 Bacteria 15021
300 Ga0495638_0002560 3300046460 Bacteria 14734
301 Ga0495638_0003323 3300046460 Bacteria 12686
302 Ga0495638_0012218 3300046460 Bacteria 5895
303 Ga0495638_0013298 3300046460 Bacteria 5611
304 Ga0495638_0015951 3300046460 Bacteria 5035
305 Ga0495638_0022972 3300046460 Bacteria 4086
306 Ga0495638_0030695 3300046460 Bacteria 3457
307 Ga0495638_0035221 3300046460 Bacteria 3192
308 Ga0495638_0035682 3300046460 Bacteria 3169
309 Ga0495638_0043170 3300046460 Bacteria 2846
310 Ga0495638_0066691 3300046460 Bacteria 2211
311 Ga0495638_0095059 3300046460 Bacteria 1790
312 Ga0495638_0147148 3300046460 Bacteria 1369
313 Ga0495653_0000844 3300046463 Bacteria 23601
314 Ga0495653_0002370 3300046463 Bacteria 14975
315 Ga0495653_0006664 3300046463 Bacteria 9478
316 Ga0495653_0045650 3300046463 Bacteria 3396
317 Ga0495650_0001297 3300046471 Bacteria 25392
318 Ga0495650_0002090 3300046471 Bacteria 17198
319 Ga0495650_0015181 3300046471 Bacteria 3963
320 Ga0495650_0022221 3300046471 Bacteria 3046
321 Ga0495650_0026452 3300046471 Bacteria 2698
322 Ga0495650_0046317 3300046471 Bacteria 1825
323 Ga0495650_0071139 3300046471 Bacteria 1364
324 Ga0495580_0144905 3300046472 Bacteria 1646
325 Ga0495605_0000197 3300046474 Bacteria 75351
326 Ga0495605_0000789 3300046474 Bacteria 22739
327 Ga0495605_0002861 3300046474 Bacteria 10491
328 Ga0495605_0007042 3300046474 Bacteria 6411
329 Ga0495605_0008045 3300046474 Bacteria 5969
330 Ga0495605_0011728 3300046474 Bacteria 4878
331 Ga0495605_0015578 3300046474 Bacteria 4130
332 Ga0495605_0024112 3300046474 Bacteria 3188
333 Ga0495605_0030899 3300046474 Bacteria 2740
334 Ga0495605_0041097 3300046474 Bacteria 2304
335 Ga0495605_0057215 3300046474 Bacteria 1877
336 Ga0495639_0000038 3300046475 Bacteria 57641
337 Ga0495639_0016334 3300046475 Bacteria 3222
338 Ga0495639_0034347 3300046475 Bacteria 2268
339 Ga0495584_0001813 3300046491 Bacteria 12395
340 Ga0495584_0002046 3300046491 Bacteria 11595
341 Ga0495584_0003710 3300046491 Bacteria 8327
342 Ga0495584_0004982 3300046491 Bacteria 7073
343 Ga0495584_0005128 3300046491 Bacteria 6953
344 Ga0495584_0005630 3300046491 Bacteria 6621
345 Ga0495584_0005823 3300046491 Bacteria 6494
346 Ga0495584_0007364 3300046491 Bacteria 5740
347 Ga0495584_0012567 3300046491 Bacteria 4322
348 Ga0495584_0033562 3300046491 Bacteria 2596
349 Ga0495584_0052008 3300046491 Bacteria 2061
350 Ga0495585_0000124 3300046492 Bacteria 83121
351 Ga0495585_0000581 3300046492 Bacteria 34377
352 Ga0495585_0001763 3300046492 Bacteria 16437
353 Ga0495585_0002723 3300046492 Bacteria 12354
354 Ga0495585_0005945 3300046492 Bacteria 7636
355 Ga0495585_0011083 3300046492 Bacteria 5350
356 Ga0495585_0012080 3300046492 Bacteria 5095
357 Ga0495585_0019325 3300046492 Bacteria 3928
358 Ga0495585_0019756 3300046492 Bacteria 3881
359 Ga0495585_0061378 3300046492 Bacteria 2067
360 Ga0495594_0002774 3300046499 Bacteria 9088
361 Ga0495594_0005166 3300046499 Bacteria 6713
362 Ga0495594_0013928 3300046499 Bacteria 4208
363 Ga0495594_0065612 3300046499 Bacteria 2013
364 Ga0495596_0000014 3300046500 Bacteria 121944
365 Ga0495596_0017459 3300046500 Bacteria 2969
366 Ga0495607_0000014 3300046501 Bacteria 186627
367 Ga0495607_0000575 3300046501 Bacteria 35761
368 Ga0495607_0002301 3300046501 Bacteria 15698
369 Ga0495607_0002457 3300046501 Bacteria 15062
370 Ga0495607_0003228 3300046501 Bacteria 12569
371 Ga0495607_0004200 3300046501 Bacteria 10691
372 Ga0495607_0004809 3300046501 Bacteria 9851
373 Ga0495607_0005102 3300046501 Bacteria 9502
374 Ga0495607_0007112 3300046501 Bacteria 7778
375 Ga0495607_0007458 3300046501 Bacteria 7568
376 Ga0495607_0013226 3300046501 Bacteria 5418
377 Ga0495607_0015525 3300046501 Bacteria 4934
378 Ga0495607_0022955 3300046501 Bacteria 3910
379 Ga0495607_0035320 3300046501 Bacteria 3025
380 Ga0495607_0057886 3300046501 Bacteria 2219
381 Ga0495607_0061043 3300046501 Bacteria 2143
382 Ga0495583_0000283 3300046506 Bacteria 81166
383 Ga0495583_0001409 3300046506 Bacteria 24503
384 Ga0495583_0002906 3300046506 Bacteria 13850
385 Ga0495583_0003128 3300046506 Bacteria 13068
386 Ga0495583_0011563 3300046506 Bacteria 5060
387 Ga0495583_0014447 3300046506 Bacteria 4356
388 Ga0495583_0015939 3300046506 Bacteria 4063
389 Ga0495606_0000508 3300046507 Bacteria 63146
390 Ga0495606_0001003 3300046507 Bacteria 41160
391 Ga0495606_0003198 3300046507 Bacteria 17665
392 Ga0495606_0003510 3300046507 Bacteria 16582
393 Ga0495606_0007251 3300046507 Bacteria 9991
394 Ga0495606_0009606 3300046507 Bacteria 8150
395 Ga0495606_0023792 3300046507 Bacteria 4429
396 Ga0495606_0028570 3300046507 Bacteria 3931
397 Ga0495606_0031522 3300046507 Bacteria 3684
398 Ga0495606_0033671 3300046507 Bacteria 3531
399 Ga0495606_0047199 3300046507 Bacteria 2840
400 Ga0495606_0084789 3300046507 Bacteria 1961
401 Ga0495610_0000143 3300046512 Bacteria 78495
402 Ga0495610_0001762 3300046512 Bacteria 18950
403 Ga0495610_0002906 3300046512 Bacteria 13866
404 Ga0495610_0006950 3300046512 Bacteria 7657
405 Ga0495610_0011661 3300046512 Bacteria 5351
406 Ga0495610_0013584 3300046512 Bacteria 4832
407 Ga0495610_0015991 3300046512 Bacteria 4339
408 Ga0495610_0017194 3300046512 Bacteria 4129
409 Ga0495610_0034611 3300046512 Bacteria 2600
410 Ga0495610_0038006 3300046512 Bacteria 2445
411 Ga0495610_0058676 3300046512 Bacteria 1840
412 Ga0495610_0071069 3300046512 Bacteria 1623
413 Ga0495610_0097298 3300046512 Bacteria 1324
414 Ga0495616_0001207 3300046513 Bacteria 18220
415 Ga0495616_0002614 3300046513 Bacteria 11862
416 Ga0495616_0003642 3300046513 Bacteria 9840
417 Ga0495616_0003841 3300046513 Bacteria 9575
418 Ga0495616_0006614 3300046513 Bacteria 7001
419 Ga0495616_0007845 3300046513 Bacteria 6366
420 Ga0495616_0009899 3300046513 Bacteria 5543
421 Ga0495616_0023433 3300046513 Bacteria 3320
422 Ga0495616_0026244 3300046513 Bacteria 3103
423 Ga0495616_0047436 3300046513 Bacteria 2163
424 Ga0495620_0000137 3300046515 Bacteria 59671
425 Ga0495620_0000821 3300046515 Bacteria 19140
426 Ga0495620_0002752 3300046515 Bacteria 10121
427 Ga0495620_0003278 3300046515 Bacteria 9278
428 Ga0495620_0004732 3300046515 Bacteria 7651
429 Ga0495620_0007616 3300046515 Bacteria 5865
430 Ga0495620_0012237 3300046515 Bacteria 4443
431 Ga0495620_0017251 3300046515 Bacteria 3605
432 Ga0495620_0055877 3300046515 Bacteria 1662
433 Ga0495628_0069275 3300046516 Bacteria 2751
434 Ga0495630_0011572 3300046517 Bacteria 6389
435 Ga0495631_0000549 3300046518 Bacteria 25271
436 Ga0495631_0005780 3300046518 Bacteria 6452
437 Ga0495631_0009697 3300046518 Bacteria 4800
438 Ga0495631_0013894 3300046518 Bacteria 3896
439 Ga0495631_0027458 3300046518 Bacteria 2604
440 Ga0495631_0036244 3300046518 Bacteria 2203
441 Ga0495631_0053730 3300046518 Bacteria 1758
442 Ga0495632_0000343 3300046519 Bacteria 44184
443 Ga0495632_0000424 3300046519 Bacteria 40109
444 Ga0495632_0001203 3300046519 Bacteria 21962
445 Ga0495632_0001891 3300046519 Bacteria 16786
446 Ga0495632_0004152 3300046519 Bacteria 9938
447 Ga0495632_0004771 3300046519 Bacteria 9131
448 Ga0495632_0011200 3300046519 Bacteria 5250
449 Ga0495632_0012377 3300046519 Bacteria 4924
450 Ga0495632_0013467 3300046519 Bacteria 4667
451 Ga0495632_0016829 3300046519 Bacteria 4054
452 Ga0495632_0057298 3300046519 Bacteria 1902
453 Ga0495637_0001107 3300046520 Bacteria 16544
454 Ga0495637_0001358 3300046520 Bacteria 14693
455 Ga0495637_0001433 3300046520 Bacteria 14062
456 Ga0495637_0002336 3300046520 Bacteria 10503
457 Ga0495637_0002746 3300046520 Bacteria 9577
458 Ga0495637_0003626 3300046520 Bacteria 8179
459 Ga0495637_0007030 3300046520 Bacteria 5604
460 Ga0495637_0008349 3300046520 Bacteria 5091
461 Ga0495637_0012988 3300046520 Bacteria 3967
462 Ga0495637_0015660 3300046520 Bacteria 3556
463 Ga0495637_0017417 3300046520 Bacteria 3348
464 Ga0495637_0018945 3300046520 Bacteria 3188
465 Ga0495637_0025447 3300046520 Bacteria 2666
466 Ga0495637_0028380 3300046520 Bacteria 2500
467 Ga0495637_0032251 3300046520 Bacteria 2309
468 Ga0495637_0035951 3300046520 Bacteria 2161
469 Ga0495643_0005784 3300046522 Bacteria 8275
470 Ga0495643_0010944 3300046522 Bacteria 5553
471 Ga0495643_0012619 3300046522 Bacteria 5089
472 Ga0495643_0028326 3300046522 Bacteria 3141
473 Ga0495643_0030954 3300046522 Bacteria 2983
474 Ga0495643_0083795 3300046522 Bacteria 1655
475 Ga0495644_0000462 3300046523 Bacteria 17616
476 Ga0495644_0000922 3300046523 Bacteria 12223
477 Ga0495644_0004200 3300046523 Bacteria 5660
478 Ga0495644_0006368 3300046523 Bacteria 4579
479 Ga0495644_0019354 3300046523 Bacteria 2600
480 Ga0495644_0060544 3300046523 Bacteria 1423
481 Ga0495648_0003483 3300046524 Bacteria 13806
482 Ga0495648_0003589 3300046524 Bacteria 13570
483 Ga0495648_0006435 3300046524 Bacteria 9589
484 Ga0495648_0010044 3300046524 Bacteria 7254
485 Ga0495648_0011482 3300046524 Bacteria 6665
486 Ga0495648_0012334 3300046524 Bacteria 6383
487 Ga0495648_0012644 3300046524 Bacteria 6277
488 Ga0495648_0031337 3300046524 Bacteria 3502
489 Ga0495648_0043924 3300046524 Bacteria 2794
490 Ga0495648_0046995 3300046524 Bacteria 2671
491 Ga0495666_0000655 3300046526 Bacteria 15584
492 Ga0495666_0020763 3300046526 Bacteria 3252
493 Ga0495642_0000479 3300046528 Bacteria 20493
494 Ga0495642_0000918 3300046528 Bacteria 13832
495 Ga0495642_0001912 3300046528 Bacteria 8853
496 Ga0495654_0000461 3300046530 Bacteria 33935
497 Ga0495654_0000968 3300046530 Bacteria 21179
498 Ga0495654_0000998 3300046530 Bacteria 20842
499 Ga0495654_0001138 3300046530 Bacteria 19070
500 Ga0495654_0002727 3300046530 Bacteria 11146
501 Ga0495654_0002967 3300046530 Bacteria 10616
502 Ga0495654_0005013 3300046530 Bacteria 7772
503 Ga0495654_0010285 3300046530 Bacteria 5093
504 Ga0495654_0014876 3300046530 Bacteria 4135
505 Ga0495654_0020910 3300046530 Bacteria 3408
506 Ga0495654_0023729 3300046530 Bacteria 3175
507 Ga0495654_0028323 3300046530 Bacteria 2865
508 Ga0495654_0032437 3300046530 Bacteria 2648
509 Ga0495654_0037453 3300046530 Bacteria 2431
510 Ga0495654_0054186 3300046530 Bacteria 1946
511 Ga0495654_0069695 3300046530 Bacteria 1669
512 Ga0495654_0070423 3300046530 Bacteria 1658
513 Ga0495587_0113083 3300046536 Bacteria 1558
514 Ga0495609_0000222 3300046538 Bacteria 55849
515 Ga0495609_0000534 3300046538 Bacteria 30280
516 Ga0495609_0002790 3300046538 Bacteria 10505
517 Ga0495609_0012717 3300046538 Bacteria 3989
518 Ga0495609_0017034 3300046538 Bacteria 3380
519 Ga0495609_0063214 3300046538 Bacteria 1633
520 Ga0495609_0071714 3300046538 Bacteria 1521
521 Ga0495609_0076608 3300046538 Bacteria 1465
522 Ga0495597_0003745 3300046542 Bacteria 8672
523 Ga0495597_0004251 3300046542 Bacteria 7921
524 Ga0495597_0008255 3300046542 Bacteria 5226
525 Ga0495597_0012456 3300046542 Bacteria 4104
526 Ga0495597_0014295 3300046542 Bacteria 3781
527 Ga0495597_0024067 3300046542 Bacteria 2812
528 Ga0495597_0025445 3300046542 Bacteria 2724
529 Ga0495597_0051033 3300046542 Bacteria 1824
530 Ga0495597_0059360 3300046542 Bacteria 1670
531 Ga0495597_0061770 3300046542 Bacteria 1631
532 Ga0495645_0036187 3300046543 Bacteria 3599
533 Ga0495622_0000070 3300046557 Bacteria 89579
534 Ga0495622_0003221 3300046557 Bacteria 7734
535 Ga0495622_0005941 3300046557 Bacteria 5672
536 Ga0495622_0019825 3300046557 Bacteria 3130
537 Ga0495622_0047678 3300046557 Bacteria 1990
538 Ga0495622_0050602 3300046557 Bacteria 1927
539 Ga0495633_0005332 3300046558 Bacteria 7885
540 Ga0495633_0010062 3300046558 Bacteria 5184
541 Ga0495656_0082405 3300046615 Bacteria 1454
542 Ga0495668_0002243 3300046616 Bacteria 16320
543 Ga0495668_0002296 3300046616 Bacteria 16057
544 Ga0495668_0008915 3300046616 Bacteria 6204
545 Ga0495634_0002704 3300046642 Bacteria 14590
546 Ga0495611_0000279 3300046648 Bacteria 34844
547 Ga0495611_0003070 3300046648 Bacteria 7419
548 Ga0495611_0004084 3300046648 Bacteria 6355
549 Ga0495611_0030037 3300046648 Bacteria 2387
550 Ga0495625_0003800 3300046660 Bacteria 14617
551 Ga0495625_0006173 3300046660 Bacteria 10732
552 Ga0495625_0015419 3300046660 Bacteria 6053
553 Ga0495625_0025708 3300046660 Bacteria 4461
554 Ga0495625_0027633 3300046660 Bacteria 4266
555 Ga0495625_0051136 3300046660 Bacteria 2963
556 Ga0495625_0055990 3300046660 Bacteria 2809
557 Ga0495625_0067149 3300046660 Bacteria 2524
558 Ga0495625_0119647 3300046660 Bacteria 1793
559 Ga0495625_0150703 3300046660 Bacteria 1563
560 Ga0495635_0001198 3300046663 Bacteria 17284
561 Ga0495659_0000305 3300046664 Bacteria 19486
562 Ga0495659_0003767 3300046664 Bacteria 4818
563 Ga0495659_0008860 3300046664 Bacteria 3204
564 Ga0495661_0000116 3300046665 Bacteria 95285
565 Ga0495661_0000501 3300046665 Bacteria 40800
566 Ga0495661_0002639 3300046665 Bacteria 13720
567 Ga0495661_0006788 3300046665 Bacteria 8025
568 Ga0495661_0018225 3300046665 Bacteria 4621
569 Ga0495661_0018542 3300046665 Bacteria 4574
570 Ga0495661_0020589 3300046665 Bacteria 4304
571 Ga0495661_0021497 3300046665 Bacteria 4206
572 Ga0495661_0036388 3300046665 Bacteria 3083
573 Ga0495661_0081584 3300046665 Bacteria 1863
574 Ga0495661_0084568 3300046665 Bacteria 1820
575 Ga0495661_0116845 3300046665 Bacteria 1479
576 Ga0495661_0122528 3300046665 Bacteria 1434
577 Ga0495661_0124791 3300046665 Bacteria 1418
578 Ga0495588_0007522 3300046674 Bacteria 4961
579 Ga0495588_0030856 3300046674 Bacteria 2695
580 Ga0495623_0003673 3300046679 Bacteria 10133
581 Ga0495623_0005137 3300046679 Bacteria 8591
582 Ga0495646_0058620 3300046680 Bacteria 2301
583 Ga0495669_0023467 3300046684 Bacteria 2685
584 Ga0495613_0021198 3300046689 Bacteria 4846
585 Ga0495613_0059247 3300046689 Bacteria 2807
586 Ga0495613_0088248 3300046689 Bacteria 2247
587 Ga0495624_0001306 3300046690 Bacteria 19565
588 Ga0495624_0038574 3300046690 Bacteria 3069
589 Ga0495670_0000341 3300046691 Bacteria 22294
590 Ga0495670_0000788 3300046691 Bacteria 15221
591 Ga0495670_0002069 3300046691 Bacteria 9893
592 Ga0495670_0002573 3300046691 Bacteria 8962
593 Ga0495670_0010332 3300046691 Bacteria 4585
594 Ga0495670_0012726 3300046691 Bacteria 4138
595 Ga0495670_0013384 3300046691 Bacteria 4036
596 Ga0495670_0093923 3300046691 Bacteria 1537
597 Ga0495670_0094839 3300046691 Bacteria 1530
598 Ga0495671_0000397 3300046692 Bacteria 35515
599 Ga0495671_0002310 3300046692 Bacteria 12114
600 Ga0495671_0006217 3300046692 Bacteria 6923
601 Ga0495671_0006266 3300046692 Bacteria 6892
602 Ga0495671_0007157 3300046692 Bacteria 6387
603 Ga0495671_0011310 3300046692 Bacteria 4918
604 Ga0495671_0012858 3300046692 Bacteria 4556
605 Ga0495671_0016732 3300046692 Bacteria 3910
606 Ga0495671_0035923 3300046692 Bacteria 2513
607 Ga0495671_0044049 3300046692 Bacteria 2238
608 Ga0495649_0000104 3300046694 Bacteria 74938
609 Ga0495649_0001289 3300046694 Bacteria 19188
610 Ga0495649_0002799 3300046694 Bacteria 12148
611 Ga0495649_0006751 3300046694 Bacteria 7110
612 Ga0495649_0007473 3300046694 Bacteria 6655
613 Ga0495649_0008877 3300046694 Bacteria 6017
614 Ga0495649_0012100 3300046694 Bacteria 5035
615 Ga0495649_0012430 3300046694 Bacteria 4949
616 Ga0495649_0016024 3300046694 Bacteria 4254
617 Ga0495649_0017986 3300046694 Bacteria 3983
618 Ga0495649_0023960 3300046694 Bacteria 3407
619 Ga0495649_0160156 3300046694 Bacteria 1180
620 Ga0495589_0002546 3300046794 Bacteria 10146
621 Ga0495589_0007918 3300046794 Bacteria 5565
622 Ga0495589_0008025 3300046794 Bacteria 5523
623 Ga0495589_0008427 3300046794 Bacteria 5386
624 Ga0495589_0009776 3300046794 Bacteria 4980
625 Ga0495589_0011638 3300046794 Bacteria 4567
626 Ga0495589_0013865 3300046794 Bacteria 4155
627 Ga0495589_0019208 3300046794 Bacteria 3506
628 Ga0495589_0021297 3300046794 Bacteria 3312
629 Ga0495600_0020119 3300046809 Bacteria 4269
630 Ga0495660_0001225 3300046810 Bacteria 17883
631 Ga0495660_0003166 3300046810 Bacteria 10247
632 Ga0495660_0005235 3300046810 Bacteria 7781
633 Ga0495660_0006799 3300046810 Bacteria 6743
634 Ga0495660_0007040 3300046810 Bacteria 6629
635 Ga0495660_0010097 3300046810 Bacteria 5490
636 Ga0495660_0010374 3300046810 Bacteria 5419
637 Ga0495660_0010525 3300046810 Bacteria 5381
638 Ga0495660_0015419 3300046810 Bacteria 4415
639 Ga0495660_0018142 3300046810 Bacteria 4046
640 Ga0495660_0023450 3300046810 Bacteria 3519
641 Ga0495660_0041413 3300046810 Bacteria 2550
642 Ga0495660_0046397 3300046810 Bacteria 2382
643 Ga0495660_0062832 3300046810 Bacteria 1989
644 Ga0495660_0067238 3300046810 Bacteria 1909
645 Ga0495660_0070263 3300046810 Bacteria 1859
646 Ga0495581_0003578 3300047315 Bacteria 8928
647 Ga0495604_0002652 3300047317 Bacteria 14362
648 Ga0495604_0013567 3300047317 Bacteria 6499
649 Ga0495604_0076280 3300047317 Bacteria 2521
650 Ga0495636_0005637 3300047318 Bacteria 4910
651 Ga0495636_0059735 3300047318 Bacteria 1610
652 Ga0495674_0046201 3300047319 Bacteria 3865
653 Ga0495672_0000331 3300047320 Bacteria 62021
654 Ga0495672_0002113 3300047320 Bacteria 18623
655 Ga0495672_0003018 3300047320 Bacteria 14803
656 Ga0495672_0004451 3300047320 Bacteria 11472
657 Ga0495672_0007558 3300047320 Bacteria 8156
658 Ga0495672_0012721 3300047320 Bacteria 5850
659 Ga0495672_0019327 3300047320 Bacteria 4496
660 Ga0495672_0031812 3300047320 Bacteria 3290
661 Ga0495672_0048335 3300047320 Bacteria 2522
662 Ga0495672_0066852 3300047320 Bacteria 2049
663 Ga0495672_0094122 3300047320 Bacteria 1639
664 Ga0495676_0001611 3300047321 Bacteria 19632
665 Ga0495676_0012710 3300047321 Bacteria 7571
666 Ga0495676_0034799 3300047321 Bacteria 4222
667 Ga0495680_0032117 3300047322 Bacteria 4265
668 Ga0495680_0077959 3300047322 Bacteria 2508
669 Ga0495683_0000185 3300047323 Bacteria 61212
670 Ga0495683_0000920 3300047323 Bacteria 20759
671 Ga0495683_0001071 3300047323 Bacteria 18950
672 Ga0495683_0001701 3300047323 Bacteria 13985
673 Ga0495683_0002732 3300047323 Bacteria 10513
674 Ga0495683_0018033 3300047323 Bacteria 3653
675 Ga0495683_0030608 3300047323 Bacteria 2746
676 Ga0495683_0051323 3300047323 Bacteria 2062
677 Ga0495683_0064014 3300047323 Bacteria 1816
678 Ga0495683_0071177 3300047323 Bacteria 1706
679 Ga0495687_001896 3300047443 Bacteria 18021
680 Ga0495687_002012 3300047443 Bacteria 17233
681 Ga0495687_003051 3300047443 Bacteria 12564
682 Ga0495687_003319 3300047443 Bacteria 11800
683 Ga0495675_0085201 3300047444 Bacteria 1987
684 Ga0495677_0002044 3300047445 Bacteria 8049
685 Ga0495679_000727 3300047446 Bacteria 21158
686 Ga0495679_000875 3300047446 Bacteria 18952
687 Ga0495679_001754 3300047446 Bacteria 11907
688 Ga0495679_002192 3300047446 Bacteria 10213
689 Ga0495679_003911 3300047446 Bacteria 7041
690 Ga0495679_004726 3300047446 Bacteria 6184
691 Ga0495679_008670 3300047446 Bacteria 4116
692 Ga0495679_023295 3300047446 Bacteria 2102
693 Ga0495685_025982 3300047447 Bacteria 2015
694 Ga0495673_0001043 3300047469 Bacteria 24417
695 Ga0495673_0001505 3300047469 Bacteria 18401
696 Ga0495673_0002263 3300047469 Bacteria 13812
697 Ga0495673_0002289 3300047469 Bacteria 13723
698 Ga0495673_0003406 3300047469 Bacteria 10500
699 Ga0495673_0004020 3300047469 Bacteria 9382
700 Ga0495673_0004197 3300047469 Bacteria 9091
701 Ga0495673_0004554 3300047469 Bacteria 8653
702 Ga0495673_0005403 3300047469 Bacteria 7734
703 Ga0495673_0005775 3300047469 Bacteria 7414
704 Ga0495673_0009682 3300047469 Bacteria 5310
705 Ga0495673_0014932 3300047469 Bacteria 4021
706 Ga0495673_0022317 3300047469 Bacteria 3105
707 Ga0495673_0029359 3300047469 Bacteria 2595
708 Ga0495673_0035676 3300047469 Bacteria 2288
709 Ga0495673_0048213 3300047469 Bacteria 1879
710 Ga0495681_0000399 3300047470 Bacteria 33808
711 Ga0495681_0000804 3300047470 Bacteria 24176
712 Ga0495681_0001014 3300047470 Bacteria 21549
713 Ga0495681_0002079 3300047470 Bacteria 14550
714 Ga0495681_0002728 3300047470 Bacteria 12495
715 Ga0495681_0003785 3300047470 Bacteria 10487
716 Ga0495681_0005868 3300047470 Bacteria 8151
717 Ga0495681_0007243 3300047470 Bacteria 7131
718 Ga0495681_0009471 3300047470 Bacteria 5995
719 Ga0495681_0011105 3300047470 Bacteria 5397
720 Ga0495681_0017614 3300047470 Bacteria 3959
721 Ga0495681_0019031 3300047470 Bacteria 3763
722 Ga0495681_0032446 3300047470 Bacteria 2629
723 Ga0495681_0033687 3300047470 Bacteria 2561
724 Ga0495681_0035989 3300047470 Bacteria 2453
725 Ga0495681_0069668 3300047470 Bacteria 1597
726 Ga0495684_0029668 3300047471 Bacteria 4197
727 Ga0495684_0101291 3300047471 Bacteria 2177
728 Ga0495686_0003471 3300047472 Bacteria 13634
729 Ga0495686_0008020 3300047472 Bacteria 7828
730 Ga0495686_0009315 3300047472 Bacteria 7085
731 Ga0495686_0018000 3300047472 Bacteria 4750
732 Ga0495686_0029995 3300047472 Bacteria 3534
733 Ga0495593_0007442 3300047673 Bacteria 6406
734 Ga0495593_0008928 3300047673 Bacteria 5818
735 Ga0495602_0002686 3300048088 Bacteria 18185
736 Ga0495626_0000203 3300048091 Bacteria 71731
737 Ga0495626_0000456 3300048091 Bacteria 41667
738 Ga0495626_0001599 3300048091 Bacteria 17651
739 Ga0495626_0001772 3300048091 Bacteria 16401
740 Ga0495626_0002511 3300048091 Bacteria 12651
741 Ga0495626_0003174 3300048091 Bacteria 10707
742 Ga0495626_0006388 3300048091 Bacteria 6712
743 Ga0495626_0008350 3300048091 Bacteria 5688
744 Ga0495626_0014487 3300048091 Bacteria 4064
745 Ga0495626_0027701 3300048091 Bacteria 2753
746 Ga0495626_0048175 3300048091 Bacteria 1978
747 Ga0496102_0001019 3300048905 Bacteria 26110
748 Ga0496103_0005170 3300048906 Bacteria 7853
749 Ga0496105_0078700 3300048908 Bacteria 2722
750 Ga0496106_0075915 3300048909 Bacteria 2575
751 Ga0496107_0143940 3300048910 Bacteria 1762
752 Ga0496113_0102919 3300048916 Bacteria 2215
753 Ga0496116_0001790 3300048919 Bacteria 23362
754 Ga0496116_0001797 3300048919 Bacteria 23299
755 Ga0496116_0003072 3300048919 Bacteria 16842
756 Ga0496116_0003590 3300048919 Bacteria 15259
757 Ga0496117_0000720 3300048920 Bacteria 52184
758 Ga0496117_0006016 3300048920 Bacteria 12483
759 Ga0496117_0015516 3300048920 Bacteria 6489
760 Ga0496117_0023681 3300048920 Bacteria 4882
761 Ga0496117_0070727 3300048920 Bacteria 2342
762 Ga0496118_0008420 3300048921 Bacteria 10663
763 Ga0496118_0008627 3300048921 Bacteria 10487
764 Ga0496118_0009584 3300048921 Bacteria 9748
765 Ga0496118_0016534 3300048921 Bacteria 6764
766 Ga0496118_0017192 3300048921 Bacteria 6596
767 Ga0496118_0022489 3300048921 Bacteria 5509
768 Ga0496118_0094905 3300048921 Bacteria 2038
769 Ga0496119_0016404 3300048922 Bacteria 5639
770 Ga0496120_0007042 3300048923 Bacteria 8444
771 Ga0496120_0015856 3300048923 Bacteria 4949
772 Ga0496120_0033702 3300048923 Bacteria 3075
773 Ga0496120_0050548 3300048923 Bacteria 2379
774 Ga0496121_0013896 3300048924 Bacteria 8608
775 Ga0496121_0022233 3300048924 Bacteria 6167
776 Ga0496121_0032478 3300048924 Bacteria 4743
777 Ga0496121_0071912 3300048924 Bacteria 2780
778 Ga0496122_0004285 3300048925 Bacteria 17875
779 Ga0496122_0011812 3300048925 Bacteria 8782
780 Ga0496122_0018619 3300048925 Bacteria 6399
781 Ga0496122_0052361 3300048925 Bacteria 3090
782 Ga0496122_0062736 3300048925 Bacteria 2718
783 Ga0496123_0003416 3300048926 Bacteria 17871
784 Ga0496123_0011560 3300048926 Bacteria 7637
785 Ga0496123_0014910 3300048926 Bacteria 6407
786 Ga0496124_0000816 3300048927 Bacteria 50663
787 Ga0496124_0006096 3300048927 Bacteria 13264
788 Ga0496124_0010907 3300048927 Bacteria 9142
789 Ga0496124_0027067 3300048927 Bacteria 5157
790 Ga0496124_0052203 3300048927 Bacteria 3474
791 Ga0496124_0167582 3300048927 Bacteria 1705
792 Ga0496125_0000822 3300048928 Bacteria 50288
793 Ga0496125_0003780 3300048928 Bacteria 17999
794 Ga0496125_0004344 3300048928 Bacteria 16443
795 Ga0496125_0008974 3300048928 Bacteria 10365
796 Ga0496125_0033195 3300048928 Bacteria 4572
797 Ga0496125_0036046 3300048928 Bacteria 4326
798 Ga0496125_0038878 3300048928 Bacteria 4108
799 Ga0496125_0050653 3300048928 Bacteria 3435
800 Ga0496125_0057874 3300048928 Bacteria 3135
801 Ga0496125_0058225 3300048928 Bacteria 3122
802 Ga0496126_0005995 3300048929 Bacteria 13652
803 Ga0496126_0007640 3300048929 Bacteria 11801
804 Ga0495678_002361 3300049459 Bacteria 12956
805 Ga0495678_003607 3300049459 Bacteria 9440
806 Ga0495678_004892 3300049459 Bacteria 7571
807 Ga0495678_005865 3300049459 Bacteria 6649
808 Ga0495678_008259 3300049459 Bacteria 5276
809 Ga0495678_008485 3300049459 Bacteria 5177
810 Ga0495678_010183 3300049459 Bacteria 4583
811 Ga0495678_013970 3300049459 Bacteria 3749
812 Ga0495678_022851 3300049459 Bacteria 2728
813 Ga0495678_025920 3300049459 Bacteria 2510
814 Ga0495678_026257 3300049459 Bacteria 2489
815 Ga0495678_035309 3300049459 Bacteria 2050
816 Ga0495682_0000905 3300049460 Bacteria 18206
817 Ga0495682_0002057 3300049460 Bacteria 9853
818 Ga0495682_0005159 3300049460 Bacteria 5463
819 Ga0495682_0020833 3300049460 Bacteria 2459
820 Ga0495682_0025014 3300049460 Bacteria 2223
821 Ga0501042_0174739 3300049578 Bacteria 1550
822 Ga0501073_0019911 3300049589 Bacteria 4840
823 Ga0501222_000598 3300049662 Bacteria 5291
824 Ga0500572_001735 3300053111 Bacteria 5658
825 Ga0500618_002697 3300053125 Bacteria 6485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0019911 Ga0501073_0019911_1439_2419 315
2 3300041486 Ga0451807_1051409 Ga0451807_1051409_393_1439 336
3 3300041407 Ga0439447_005155 Ga0439447_005155_11_1051 346
4 3300046530 Ga0495654_0070423 Ga0495654_0070423_553_1617 354
5 3300046615 Ga0495656_0082405 Ga0495656_0082405_360_1424 354
6 3300046691 Ga0495670_0093923 Ga0495670_0093923_442_1506 354
7 3300046694 Ga0495649_0160156 Ga0495649_0160156_31_1095 354
8 3300049578 Ga0501042_0174739 Ga0501042_0174739_66_1295 354
9 3300046474 Ga0495605_0002861 Ga0495605_0002861_51_1139 362
10 3300046536 Ga0495587_0113083 Ga0495587_0113083_193_1293 365
11 3300046810 Ga0495660_0003166 Ga0495660_0003166_7913_9016 365
12 3300046501 Ga0495607_0000575 Ga0495607_0000575_32096_33199 366
13 3300041411 Ga0439466_0018033 Ga0439466_0018033_193_1374 367
14 3300049662 Ga0501222_000598 Ga0501222_000598_665_1771 367
15 3300042115 Ga0450911_001437 Ga0450911_001437_2173_3282 368
16 3300046463 Ga0495653_0045650 Ga0495653_0045650_857_2008 370
17 3300046512 Ga0495610_0038006 Ga0495610_0038006_557_1675 370
18 3300046517 Ga0495630_0011572 Ga0495630_0011572_2892_4043 370
19 3300046530 Ga0495654_0032437 Ga0495654_0032437_484_1602 370
20 3300047471 Ga0495684_0101291 Ga0495684_0101291_857_2008 370
21 3300041452 Ga0451793_1073897 Ga0451793_1073897_371_1663 372
22 3300041405 Ga0439438_000875 Ga0439438_000875_9162_10343 373
23 3300046460 Ga0495638_0013298 Ga0495638_0013298_645_1796 373
24 3300047673 Ga0495593_0007442 Ga0495593_0007442_2212_3363 374
25 3300009011 Ga0105251_10000456 Ga0105251_1000045636 375
26 3300009092 Ga0105250_10000757 Ga0105250_1000075719 375
27 3300025711 Ga0207696_1000011 Ga0207696_1000011196 375
28 3300025735 Ga0207713_1000162 Ga0207713_10001623 375
29 3300031824 Ga0307413_10072835 Ga0307413_100728352 375
30 iso_pu_bacteria 2511231010 2511291575 376
31 iso_pu_bacteria 2511231011 2511295820 376
32 iso_pu_bacteria 2511231023 2511367663 376
33 iso_pu_bacteria 2511231031 2511413878 376
34 iso_pu_bacteria 2600255318 2601799226 376
35 iso_pu_bacteria 2603880185 2606078126 376
36 iso_pu_bacteria 2603880199 2606125997 376
37 iso_pu_bacteria 2623620443 2624480664 376
38 iso_pu_bacteria 2713897148 2715753236 376
39 iso_pu_bacteria 2713897149 2715756624 376
40 iso_pu_bacteria 2738543025 2739311859 376
41 iso_pu_bacteria 2773857673 2774133919 376
42 iso_pu_bacteria 2784132063 2784264313 376
43 iso_pu_bacteria 2818991456 2819659014 376
44 iso_pu_bacteria 2842832357 2842834633 376
45 iso_pu_bacteria 2842843487 2842843720 376
46 iso_pu_bacteria 2852657418 2852657606 376
47 iso_pu_bacteria 2878029506 2878032540 376
48 iso_pu_bacteria 2880230671 2880233605 376
49 iso_pu_bacteria 2904518522 2904520015 376
50 iso_pu_bacteria 2919063839 2919065083 376
51 iso_pu_bacteria 2919385768 2919387006 376
52 iso_pu_bacteria 2919487758 2919492304 376
53 iso_pu_bacteria 2974289157 2974290933 376
54 iso_pu_bacteria 2998139840 2998142887 376
55 iso_pu_bacteria 3007614139 3007614239 376
56 iso_pu_bacteria 3007718800 3007719159 376
57 iso_pu_bacteria 3007855910 3007856906 376
58 iso_pu_bacteria 8029995093 8029997907 376
59 iso_pu_bacteria 8054503363 8054506147 376
60 iso_pu_bacteria 8056131705 8056134596 376
61 iso_pu_bacteria 8056166840 8056168311 376
62 iso_pu_bacteria 8056569372 8056574390 376
63 3300005288 Ga0065714_10023451 Ga0065714_100234511 377
64 3300046452 Ga0495617_026955 Ga0495617_026955_723_1859 377
65 3300046460 Ga0495638_0147148 Ga0495638_0147148_76_1212 377
66 3300046463 Ga0495653_0000844 Ga0495653_0000844_20695_21831 377
67 3300046474 Ga0495605_0030899 Ga0495605_0030899_226_1362 377
68 3300046491 Ga0495584_0033562 Ga0495584_0033562_1369_2505 377
69 3300046492 Ga0495585_0000581 Ga0495585_0000581_12960_14096 377
70 3300046492 Ga0495585_0061378 Ga0495585_0061378_383_1519 377
71 3300046507 Ga0495606_0000508 Ga0495606_0000508_36785_37921 377
72 3300046507 Ga0495606_0003510 Ga0495606_0003510_12196_13332 377
73 3300046512 Ga0495610_0013584 Ga0495610_0013584_666_1802 377
74 3300046513 Ga0495616_0026244 Ga0495616_0026244_42_1178 377
75 3300046515 Ga0495620_0000821 Ga0495620_0000821_14436_15572 377
76 3300046518 Ga0495631_0053730 Ga0495631_0053730_24_1160 377
77 3300046520 Ga0495637_0012988 Ga0495637_0012988_1756_2892 377
78 3300046520 Ga0495637_0028380 Ga0495637_0028380_876_2012 377
79 3300046523 Ga0495644_0019354 Ga0495644_0019354_36_1172 377
80 3300046530 Ga0495654_0005013 Ga0495654_0005013_3590_4726 377
81 3300046542 Ga0495597_0061770 Ga0495597_0061770_433_1569 377
82 3300046660 Ga0495625_0150703 Ga0495625_0150703_407_1543 377
83 3300046665 Ga0495661_0000116 Ga0495661_0000116_47843_48979 377
84 3300046665 Ga0495661_0006788 Ga0495661_0006788_5208_6344 377
85 3300046810 Ga0495660_0046397 Ga0495660_0046397_524_1660 377
86 3300047446 Ga0495679_023295 Ga0495679_023295_869_2005 377
87 3300047469 Ga0495673_0009682 Ga0495673_0009682_615_1751 377
88 3300047470 Ga0495681_0035989 Ga0495681_0035989_1241_2377 377
89 3300048091 Ga0495626_0001772 Ga0495626_0001772_11686_12822 377
90 3300049459 Ga0495678_008485 Ga0495678_008485_1523_2659 377
91 iso_pu_bacteria 2511231156 2511824688 377
92 iso_pu_bacteria 2599185155 2599330281 377
93 iso_pu_bacteria 2599185188 2599500668 377
94 iso_pu_bacteria 2599185212 2599612906 377
95 iso_pu_bacteria 2599185248 2599771778 377
96 iso_pu_bacteria 2599185289 2599889144 377
97 iso_pu_bacteria 2599185291 2599901198 377
98 iso_pu_bacteria 2599185300 2599932331 377
99 iso_pu_bacteria 2599185302 2599943502 377
100 iso_pu_bacteria 2599185304 2599954613 377
101 iso_pu_bacteria 2599185305 2599962302 377
102 iso_pu_bacteria 2599185306 2599968092 377
103 iso_pu_bacteria 2599185308 2599977117 377
104 iso_pu_bacteria 2599185309 2599985168 377
105 iso_pu_bacteria 2599185310 2599988582 377
106 iso_pu_bacteria 2599185311 2599993417 377
107 iso_pu_bacteria 2599185312 2600002893 377
108 iso_pu_bacteria 2599185313 2600008203 377
109 iso_pu_bacteria 2599185314 2600011155 377
110 iso_pu_bacteria 2599185315 2600016190 377
111 iso_pu_bacteria 2599185316 2600022000 377
112 iso_pu_bacteria 2599185317 2600028486 377
113 iso_pu_bacteria 2599185318 2600038027 377
114 iso_pu_bacteria 2599185319 2600044368 377
115 iso_pu_bacteria 2599185320 2600049841 377
116 iso_pu_bacteria 2599185321 2600051396 377
117 iso_pu_bacteria 2599185322 2600060013 377
118 iso_pu_bacteria 2599185323 2600063235 377
119 iso_pu_bacteria 2599185324 2600070538 377
120 iso_pu_bacteria 2599185325 2600075274 377
121 iso_pu_bacteria 2600254930 2600357653 377
122 iso_pu_bacteria 2643221650 2644283683 377
123 iso_pu_bacteria 2651869719 2652546928 377
124 iso_pu_bacteria 2667528170 2671094278 377
125 iso_pu_bacteria 2667528176 2671126347 377
126 iso_pu_bacteria 2675903515 2678262050 377
127 iso_pu_bacteria 2744054620 2745008398 377
128 iso_pu_bacteria 2791355520 2794597200 377
129 iso_pu_bacteria 2808606376 2808922190 377
130 iso_pu_bacteria 2808606378 2808933641 377
131 iso_pu_bacteria 2808606380 2808944827 377
132 iso_pu_bacteria 2808606383 2808962115 377
133 iso_pu_bacteria 2808606389 2808997128 377
134 iso_pu_bacteria 2825651385 2825651477 377
135 iso_pu_bacteria 2842854478 2842859100 377
136 iso_pu_bacteria 2919481497 2919487381 377
137 iso_pu_bacteria 2923586266 2923588803 377
138 iso_pu_bacteria 2929144301 2929147509 377
139 iso_pu_bacteria 3007419365 3007422941 377
140 iso_pu_bacteria 3007866637 3007869352 377
141 iso_pu_bacteria 8056143049 8056145845 377
142 3300009011 Ga0105251_10025751 Ga0105251_100257514 378
143 3300025728 Ga0207655_1047020 Ga0207655_10470202 378
144 3300047323 Ga0495683_0064014 Ga0495683_0064014_638_1780 378
145 iso_pu_bacteria 2511231007 2511272345 378
146 iso_pu_bacteria 2511231008 2511280800 378
147 iso_pu_bacteria 2511231012 2511299046 378
148 iso_pu_bacteria 2511231014 2511312357 378
149 iso_pu_bacteria 2511231017 2511335087 378
150 iso_pu_bacteria 2511231018 2511337137 378
151 iso_pu_bacteria 2511231019 2511344711 378
152 iso_pu_bacteria 2511231020 2511352917 378
153 iso_pu_bacteria 2511231021 2511357550 378
154 iso_pu_bacteria 2623620446 2624492435 378
155 iso_pu_bacteria 2643221565 2643844507 378
156 iso_pu_bacteria 2643221589 2643954365 378
157 iso_pu_bacteria 2643221602 2644023174 378
158 iso_pu_bacteria 2643221633 2644185302 378
159 iso_pu_bacteria 2738543004 2739199494 378
160 iso_pu_bacteria 2738543015 2739257239 378
161 iso_pu_bacteria 2808606377 2808929608 378
162 iso_pu_bacteria 2808606381 2808951813 378
163 iso_pu_bacteria 2808606382 2808959486 378
164 iso_pu_bacteria 2808606445 2809214907 378
165 iso_pu_bacteria 2826581358 2826586032 378
166 iso_pu_bacteria 2842815866 2842819069 378
167 iso_pu_bacteria 2842849001 2842853395 378
168 iso_pu_bacteria 2860339153 2860344712 378
169 iso_pu_bacteria 2904550169 2904550279 378
170 iso_pu_bacteria 2919456309 2919458767 378
171 iso_pu_bacteria 2919697872 2919698602 378
172 iso_pu_bacteria 2931396565 2931402231 378
173 iso_pu_bacteria 2939636861 2939638890 378
174 iso_pu_bacteria 2946006987 2946010063 378
175 iso_pu_bacteria 3007511990 3007514184 378
176 iso_pu_bacteria 3007619802 3007621616 378
177 iso_pu_bacteria 8019775933 8019778930 378
178 iso_pu_bacteria 8056125926 8056128748 378
179 iso_pu_bacteria 8056177738 8056178327 378
180 3300005331 Ga0070670_100002291 Ga0070670_1000022916 379
181 3300017792 Ga0163161_10001602 Ga0163161_100016026 379
182 3300031731 Ga0307405_10000328 Ga0307405_100003287 379
183 3300046512 Ga0495610_0000143 Ga0495610_0000143_62519_63667 379
184 3300046530 Ga0495654_0037453 Ga0495654_0037453_392_1540 379
185 3300046542 Ga0495597_0008255 Ga0495597_0008255_855_1997 379
186 3300046810 Ga0495660_0067238 Ga0495660_0067238_740_1882 379
187 3300047469 Ga0495673_0001505 Ga0495673_0001505_3304_4446 379
188 iso_pu_bacteria 2597489888 2597863815 379
189 iso_pu_bacteria 2597489889 2597869964 379
190 iso_pu_bacteria 2599185167 2599398228 379
191 iso_pu_bacteria 2599185179 2599450238 379
192 iso_pu_bacteria 2599185189 2599510411 379
193 iso_pu_bacteria 2599185190 2599516085 379
194 iso_pu_bacteria 2599185191 2599521186 379
195 iso_pu_bacteria 2599185288 2599883605 379
196 iso_pu_bacteria 2599185290 2599895616 379
197 iso_pu_bacteria 2599185303 2599950367 379
198 iso_pu_bacteria 2600255296 2601691771 379
199 iso_pu_bacteria 2619619299 2621299460 379
200 iso_pu_bacteria 2643221571 2643869899 379
201 iso_pu_bacteria 2643221713 2644621131 379
202 iso_pu_bacteria 2675903420 2677896325 379
203 iso_pu_bacteria 2721755607 2723248601 379
204 iso_pu_bacteria 2738541282 2738747868 379
205 iso_pu_bacteria 2738541294 2738810741 379
206 iso_pu_bacteria 2738541303 2738856911 379
207 iso_pu_bacteria 2738541309 2738898101 379
208 iso_pu_bacteria 2808606385 2808980624 379
209 iso_pu_bacteria 2808606388 2808996345 379
210 iso_pu_bacteria 2816332298 2817490822 379
211 iso_pu_bacteria 2834028612 2834029982 379
212 iso_pu_bacteria 2842826826 2842826849 379
213 iso_pu_bacteria 2842837860 2842839416 379
214 iso_pu_bacteria 2852612431 2852614714 379
215 iso_pu_bacteria 2852667396 2852667548 379
216 iso_pu_bacteria 2908446538 2908449885 379
217 iso_pu_bacteria 2929189879 2929192396 379
218 iso_pu_bacteria 2931390751 2931394107 379
219 iso_pu_bacteria 2945928738 2945933672 379
220 iso_pu_bacteria 2945961074 2945963886 379
221 iso_pu_bacteria 2946027586 2946031076 379
222 iso_pu_bacteria 2947233263 2947237659 379
223 iso_pu_bacteria 8054285046 8054288496 379
224 iso_pu_bacteria 8054347763 8054348089 379
225 iso_pu_bacteria 8055817908 8055820748 379
226 iso_pu_bacteria 8056148874 8056154648 379
227 iso_pu_bacteria 8056161164 8056165874 379
228 3300003781 Ga0055536_1000352 Ga0055536_10003525 380
229 3300003791 Ga0055530_10002917 Ga0055530_100029175 380
230 3300003792 Ga0055540_1000006 Ga0055540_1000006214 380
231 3300003794 Ga0055531_10000126 Ga0055531_1000012663 380
232 3300005457 Ga0070662_100037132 Ga0070662_1000371321 380
233 3300009011 Ga0105251_10019713 Ga0105251_100197132 380
234 3300009011 Ga0105251_10029890 Ga0105251_100298902 380
235 3300009036 Ga0105244_10004549 Ga0105244_100045496 380
236 3300009036 Ga0105244_10015172 Ga0105244_100151725 380
237 3300009092 Ga0105250_10000145 Ga0105250_1000014548 380
238 3300009092 Ga0105250_10011541 Ga0105250_100115414 380
239 3300009092 Ga0105250_10015734 Ga0105250_100157341 380
240 3300009148 Ga0105243_10013488 Ga0105243_100134886 380
241 3300011119 Ga0105246_10000009 Ga0105246_1000000961 380
242 3300012498 Ga0157345_1000181 Ga0157345_10001817 380
243 3300013100 Ga0157373_10004688 Ga0157373_100046885 380
244 3300013100 Ga0157373_10016012 Ga0157373_100160125 380
245 3300013100 Ga0157373_10134310 Ga0157373_101343102 380
246 3300013100 Ga0157373_10164962 Ga0157373_101649621 380
247 3300013105 Ga0157369_10012736 Ga0157369_100127365 380
248 3300013105 Ga0157369_10036133 Ga0157369_100361334 380
249 3300013105 Ga0157369_10100516 Ga0157369_101005162 380
250 3300013306 Ga0163162_10000169 Ga0163162_1000016951 380
251 3300013308 Ga0157375_10215829 Ga0157375_102158293 380
252 3300014497 Ga0182008_10000404 Ga0182008_100004047 380
253 3300015261 Ga0182006_1000452 Ga0182006_10004523 380
254 3300015261 Ga0182006_1016570 Ga0182006_10165703 380
255 3300015265 Ga0182005_1009216 Ga0182005_10092162 380
256 3300017792 Ga0163161_10004328 Ga0163161_100043286 380
257 3300017792 Ga0163161_10097373 Ga0163161_100973731 380
258 3300025230 Ga0209563_100908 Ga0209563_1009085 380
259 3300025291 Ga0209675_1004176 Ga0209675_10041763 380
260 3300025292 Ga0209676_1000002 Ga0209676_10000021178 380
261 3300025292 Ga0209676_1000158 Ga0209676_100015887 380
262 3300025298 Ga0209050_1000006 Ga0209050_1000006392 380
263 3300025303 Ga0209051_1000001 Ga0209051_10000011178 380
264 3300025304 Ga0209257_1000029 Ga0209257_1000029392 380
265 3300025711 Ga0207696_1000002 Ga0207696_1000002716 380
266 3300025711 Ga0207696_1004244 Ga0207696_10042445 380
267 3300025711 Ga0207696_1039914 Ga0207696_10399141 380
268 3300025728 Ga0207655_1000379 Ga0207655_100037919 380
269 3300025728 Ga0207655_1008836 Ga0207655_10088365 380
270 3300025728 Ga0207655_1015187 Ga0207655_10151874 380
271 3300025728 Ga0207655_1027367 Ga0207655_10273672 380
272 3300025735 Ga0207713_1000447 Ga0207713_100044733 380
273 3300025735 Ga0207713_1000552 Ga0207713_100055232 380
274 3300025735 Ga0207713_1006733 Ga0207713_10067333 380
275 3300025735 Ga0207713_1011581 Ga0207713_10115812 380
276 3300025935 Ga0207709_10000004 Ga0207709_10000004321 380
277 3300027111 Ga0209281_1013568 Ga0209281_10135682 380
278 3300031911 Ga0307412_10014820 Ga0307412_100148204 380
279 3300031995 Ga0307409_100271065 Ga0307409_1002710651 380
280 3300032002 Ga0307416_100012044 Ga0307416_1000120446 380
281 3300032005 Ga0307411_10065922 Ga0307411_100659221 380
282 3300033180 Ga0307510_10014347 Ga0307510_100143474 380
283 3300041405 Ga0439438_001408 Ga0439438_001408_1759_2904 380
284 3300041405 Ga0439438_003024 Ga0439438_003024_701_1846 380
285 3300041407 Ga0439447_014969 Ga0439447_014969_360_1505 380
286 3300042006 Ga0439432_001202 Ga0439432_001202_162_1307 380
287 3300042009 Ga0439451_009077 Ga0439451_009077_692_1837 380
288 3300042010 Ga0439452_000317 Ga0439452_000317_27000_28145 380
289 3300042010 Ga0439452_017043 Ga0439452_017043_701_1846 380
290 3300042013 Ga0439456_004229 Ga0439456_004229_1653_2798 380
291 3300042115 Ga0450911_000076 Ga0450911_000076_8977_10122 380
292 3300042137 Ga0450902_001808 Ga0450902_001808_888_2033 380
293 3300042138 Ga0450903_001550 Ga0450903_001550_1803_2948 380
294 3300042145 Ga0450906_004556 Ga0450906_004556_513_1658 380
295 3300046452 Ga0495617_005125 Ga0495617_005125_2343_3497 380
296 3300046452 Ga0495617_017035 Ga0495617_017035_312_1466 380
297 3300046452 Ga0495617_034199 Ga0495617_034199_462_1607 380
298 3300046453 Ga0495627_000526 Ga0495627_000526_29178_30332 380
299 3300046453 Ga0495627_004951 Ga0495627_004951_1260_2414 380
300 3300046454 Ga0495592_0017072 Ga0495592_0017072_1211_2356 380
301 3300046458 Ga0495591_000221 Ga0495591_000221_27799_28953 380
302 3300046458 Ga0495591_002731 Ga0495591_002731_4210_5364 380
303 3300046458 Ga0495591_002853 Ga0495591_002853_4630_5775 380
304 3300046458 Ga0495591_006357 Ga0495591_006357_1678_2823 380
305 3300046458 Ga0495591_007952 Ga0495591_007952_2065_3219 380
306 3300046458 Ga0495591_008212 Ga0495591_008212_1865_3019 380
307 3300046458 Ga0495591_015788 Ga0495591_015788_485_1630 380
308 3300046460 Ga0495638_0000298 Ga0495638_0000298_46820_47965 380
309 3300046460 Ga0495638_0022972 Ga0495638_0022972_1429_2574 380
310 3300046460 Ga0495638_0095059 Ga0495638_0095059_322_1476 380
311 3300046463 Ga0495653_0002370 Ga0495653_0002370_12596_13741 380
312 3300046471 Ga0495650_0071139 Ga0495650_0071139_145_1299 380
313 3300046472 Ga0495580_0144905 Ga0495580_0144905_15_1160 380
314 3300046474 Ga0495605_0000789 Ga0495605_0000789_18407_19561 380
315 3300046474 Ga0495605_0007042 Ga0495605_0007042_2128_3273 380
316 3300046491 Ga0495584_0004982 Ga0495584_0004982_2395_3549 380
317 3300046491 Ga0495584_0007364 Ga0495584_0007364_2634_3788 380
318 3300046492 Ga0495585_0002723 Ga0495585_0002723_3840_4985 380
319 3300046492 Ga0495585_0005945 Ga0495585_0005945_3162_4307 380
320 3300046492 Ga0495585_0011083 Ga0495585_0011083_1255_2409 380
321 3300046492 Ga0495585_0019325 Ga0495585_0019325_1302_2456 380
322 3300046500 Ga0495596_0017459 Ga0495596_0017459_1260_2405 380
323 3300046501 Ga0495607_0007112 Ga0495607_0007112_3539_4693 380
324 3300046501 Ga0495607_0007458 Ga0495607_0007458_2958_4112 380
325 3300046501 Ga0495607_0015525 Ga0495607_0015525_945_2099 380
326 3300046501 Ga0495607_0035320 Ga0495607_0035320_627_1772 380
327 3300046506 Ga0495583_0011563 Ga0495583_0011563_1934_3088 380
328 3300046507 Ga0495606_0003198 Ga0495606_0003198_3695_4840 380
329 3300046507 Ga0495606_0007251 Ga0495606_0007251_3139_4293 380
330 3300046507 Ga0495606_0009606 Ga0495606_0009606_4042_5196 380
331 3300046507 Ga0495606_0047199 Ga0495606_0047199_337_1491 380
332 3300046512 Ga0495610_0001762 Ga0495610_0001762_13970_15115 380
333 3300046512 Ga0495610_0006950 Ga0495610_0006950_3402_4556 380
334 3300046512 Ga0495610_0011661 Ga0495610_0011661_3263_4417 380
335 3300046512 Ga0495610_0097298 Ga0495610_0097298_112_1269 380
336 3300046513 Ga0495616_0001207 Ga0495616_0001207_13468_14622 380
337 3300046513 Ga0495616_0003841 Ga0495616_0003841_4281_5435 380
338 3300046513 Ga0495616_0009899 Ga0495616_0009899_1409_2563 380
339 3300046515 Ga0495620_0000137 Ga0495620_0000137_4735_5889 380
340 3300046515 Ga0495620_0012237 Ga0495620_0012237_1432_2586 380
341 3300046515 Ga0495620_0017251 Ga0495620_0017251_793_1947 380
342 3300046515 Ga0495620_0055877 Ga0495620_0055877_506_1651 380
343 3300046518 Ga0495631_0005780 Ga0495631_0005780_3110_4264 380
344 3300046518 Ga0495631_0013894 Ga0495631_0013894_1551_2705 380
345 3300046518 Ga0495631_0027458 Ga0495631_0027458_1058_2209 380
346 3300046519 Ga0495632_0001203 Ga0495632_0001203_15295_16449 380
347 3300046519 Ga0495632_0011200 Ga0495632_0011200_1257_2411 380
348 3300046519 Ga0495632_0013467 Ga0495632_0013467_1390_2535 380
349 3300046520 Ga0495637_0001358 Ga0495637_0001358_4411_5565 380
350 3300046520 Ga0495637_0001433 Ga0495637_0001433_11711_12865 380
351 3300046520 Ga0495637_0007030 Ga0495637_0007030_1371_2516 380
352 3300046520 Ga0495637_0025447 Ga0495637_0025447_1382_2536 380
353 3300046522 Ga0495643_0005784 Ga0495643_0005784_3153_4307 380
354 3300046522 Ga0495643_0010944 Ga0495643_0010944_3093_4247 380
355 3300046522 Ga0495643_0083795 Ga0495643_0083795_431_1576 380
356 3300046523 Ga0495644_0004200 Ga0495644_0004200_294_1448 380
357 3300046524 Ga0495648_0006435 Ga0495648_0006435_3000_4145 380
358 3300046524 Ga0495648_0010044 Ga0495648_0010044_3135_4289 380
359 3300046524 Ga0495648_0011482 Ga0495648_0011482_2360_3505 380
360 3300046524 Ga0495648_0046995 Ga0495648_0046995_111_1265 380
361 3300046530 Ga0495654_0001138 Ga0495654_0001138_4264_5418 380
362 3300046530 Ga0495654_0054186 Ga0495654_0054186_550_1704 380
363 3300046538 Ga0495609_0000534 Ga0495609_0000534_4717_5871 380
364 3300046538 Ga0495609_0002790 Ga0495609_0002790_86_1240 380
365 3300046538 Ga0495609_0012717 Ga0495609_0012717_1592_2746 380
366 3300046538 Ga0495609_0017034 Ga0495609_0017034_764_1909 380
367 3300046542 Ga0495597_0004251 Ga0495597_0004251_4221_5375 380
368 3300046543 Ga0495645_0036187 Ga0495645_0036187_590_1735 380
369 3300046557 Ga0495622_0003221 Ga0495622_0003221_2364_3518 380
370 3300046558 Ga0495633_0010062 Ga0495633_0010062_2196_3350 380
371 3300046616 Ga0495668_0002243 Ga0495668_0002243_3784_4929 380
372 3300046616 Ga0495668_0008915 Ga0495668_0008915_2470_3624 380
373 3300046648 Ga0495611_0000279 Ga0495611_0000279_28203_29357 380
374 3300046648 Ga0495611_0030037 Ga0495611_0030037_18_1163 380
375 3300046660 Ga0495625_0006173 Ga0495625_0006173_6643_7797 380
376 3300046660 Ga0495625_0015419 Ga0495625_0015419_1063_2217 380
377 3300046660 Ga0495625_0027633 Ga0495625_0027633_113_1258 380
378 3300046660 Ga0495625_0051136 Ga0495625_0051136_341_1486 380
379 3300046660 Ga0495625_0055990 Ga0495625_0055990_598_1752 380
380 3300046665 Ga0495661_0002639 Ga0495661_0002639_9633_10778 380
381 3300046665 Ga0495661_0018225 Ga0495661_0018225_1210_2364 380
382 3300046665 Ga0495661_0021497 Ga0495661_0021497_1908_3062 380
383 3300046680 Ga0495646_0058620 Ga0495646_0058620_978_2123 380
384 3300046689 Ga0495613_0021198 Ga0495613_0021198_1355_2500 380
385 3300046689 Ga0495613_0088248 Ga0495613_0088248_132_1277 380
386 3300046690 Ga0495624_0001306 Ga0495624_0001306_3615_4760 380
387 3300046690 Ga0495624_0038574 Ga0495624_0038574_1342_2496 380
388 3300046691 Ga0495670_0000341 Ga0495670_0000341_16748_17902 380
389 3300046692 Ga0495671_0000397 Ga0495671_0000397_33075_34229 380
390 3300046692 Ga0495671_0035923 Ga0495671_0035923_744_1889 380
391 3300046694 Ga0495649_0002799 Ga0495649_0002799_2982_4136 380
392 3300046694 Ga0495649_0016024 Ga0495649_0016024_1377_2531 380
393 3300046794 Ga0495589_0002546 Ga0495589_0002546_4730_5884 380
394 3300046794 Ga0495589_0009776 Ga0495589_0009776_2368_3522 380
395 3300046794 Ga0495589_0011638 Ga0495589_0011638_1838_2983 380
396 3300046809 Ga0495600_0020119 Ga0495600_0020119_2714_3859 380
397 3300046810 Ga0495660_0001225 Ga0495660_0001225_13271_14416 380
398 3300046810 Ga0495660_0010097 Ga0495660_0010097_3045_4199 380
399 3300046810 Ga0495660_0010374 Ga0495660_0010374_3051_4205 380
400 3300046810 Ga0495660_0010525 Ga0495660_0010525_3013_4167 380
401 3300046810 Ga0495660_0062832 Ga0495660_0062832_651_1796 380
402 3300047317 Ga0495604_0076280 Ga0495604_0076280_240_1385 380
403 3300047320 Ga0495672_0007558 Ga0495672_0007558_2925_4070 380
404 3300047321 Ga0495676_0012710 Ga0495676_0012710_3113_4267 380
405 3300047321 Ga0495676_0034799 Ga0495676_0034799_1288_2433 380
406 3300047322 Ga0495680_0032117 Ga0495680_0032117_3040_4185 380
407 3300047323 Ga0495683_0018033 Ga0495683_0018033_1232_2386 380
408 3300047323 Ga0495683_0051323 Ga0495683_0051323_846_2000 380
409 3300047444 Ga0495675_0085201 Ga0495675_0085201_648_1793 380
410 3300047446 Ga0495679_000727 Ga0495679_000727_12418_13578 380
411 3300047446 Ga0495679_000875 Ga0495679_000875_9513_10664 380
412 3300047446 Ga0495679_001754 Ga0495679_001754_4174_5328 380
413 3300047446 Ga0495679_003911 Ga0495679_003911_3584_4738 380
414 3300047446 Ga0495679_008670 Ga0495679_008670_1661_2806 380
415 3300047469 Ga0495673_0001043 Ga0495673_0001043_19808_20962 380
416 3300047469 Ga0495673_0003406 Ga0495673_0003406_2905_4059 380
417 3300047470 Ga0495681_0005868 Ga0495681_0005868_1298_2452 380
418 3300047470 Ga0495681_0009471 Ga0495681_0009471_3602_4756 380
419 3300047470 Ga0495681_0033687 Ga0495681_0033687_190_1344 380
420 3300047471 Ga0495684_0029668 Ga0495684_0029668_1752_2897 380
421 3300047472 Ga0495686_0009315 Ga0495686_0009315_3212_4366 380
422 3300047472 Ga0495686_0029995 Ga0495686_0029995_1110_2264 380
423 3300047673 Ga0495593_0008928 Ga0495593_0008928_3600_4745 380
424 3300048088 Ga0495602_0002686 Ga0495602_0002686_3601_4746 380
425 3300048091 Ga0495626_0001599 Ga0495626_0001599_13651_14805 380
426 3300048091 Ga0495626_0008350 Ga0495626_0008350_3170_4315 380
427 3300048091 Ga0495626_0014487 Ga0495626_0014487_1521_2666 380
428 3300048091 Ga0495626_0027701 Ga0495626_0027701_699_1853 380
429 3300048919 Ga0496116_0001797 Ga0496116_0001797_4792_5946 380
430 3300048919 Ga0496116_0003072 Ga0496116_0003072_11575_12720 380
431 3300048921 Ga0496118_0008627 Ga0496118_0008627_5209_6354 380
432 3300048923 Ga0496120_0050548 Ga0496120_0050548_537_1682 380
433 3300048924 Ga0496121_0013896 Ga0496121_0013896_4153_5298 380
434 3300048925 Ga0496122_0052361 Ga0496122_0052361_488_1633 380
435 3300048927 Ga0496124_0027067 Ga0496124_0027067_3026_4171 380
436 3300048927 Ga0496124_0052203 Ga0496124_0052203_1690_2838 380
437 3300048927 Ga0496124_0167582 Ga0496124_0167582_242_1387 380
438 3300048928 Ga0496125_0057874 Ga0496125_0057874_1917_3062 380
439 3300049459 Ga0495678_003607 Ga0495678_003607_4229_5383 380
440 3300049459 Ga0495678_004892 Ga0495678_004892_2849_4003 380
441 3300049459 Ga0495678_008259 Ga0495678_008259_4056_5210 380
442 3300049459 Ga0495678_022851 Ga0495678_022851_435_1580 380
443 3300049459 Ga0495678_026257 Ga0495678_026257_722_1867 380
444 3300049460 Ga0495682_0005159 Ga0495682_0005159_139_1293 380
445 3300053111 Ga0500572_001735 Ga0500572_001735_2495_3649 380
446 2162886007 SwRhRL2b_contig_1875304 SwRhRL2b_0630.00005030 381
447 3300003791 Ga0055530_10000019 Ga0055530_1000001981 381
448 3300003792 Ga0055540_1000055 Ga0055540_100005540 381
449 3300005288 Ga0065714_10002219 Ga0065714_100022196 381
450 3300005288 Ga0065714_10003565 Ga0065714_100035658 381
451 3300005289 Ga0065704_10070628 Ga0065704_100706286 381
452 3300006058 Ga0075432_10000990 Ga0075432_100009904 381
453 3300006914 Ga0075436_100022524 Ga0075436_1000225242 381
454 3300006946 Ga0079104_1000873 Ga0079104_10008736 381
455 3300006948 Ga0099826_10010909 Ga0099826_100109096 381
456 3300009036 Ga0105244_10009002 Ga0105244_100090022 381
457 3300009148 Ga0105243_10022501 Ga0105243_100225012 381
458 3300011119 Ga0105246_10086860 Ga0105246_100868602 381
459 3300014497 Ga0182008_10007227 Ga0182008_100072271 381
460 3300015261 Ga0182006_1004026 Ga0182006_10040264 381
461 3300015261 Ga0182006_1011474 Ga0182006_10114741 381
462 3300015262 Ga0182007_10004715 Ga0182007_100047156 381
463 3300025292 Ga0209676_1002612 Ga0209676_10026127 381
464 3300025298 Ga0209050_1000013 Ga0209050_100001382 381
465 3300025303 Ga0209051_1000007 Ga0209051_100000782 381
466 3300025728 Ga0207655_1000022 Ga0207655_1000022120 381
467 3300025728 Ga0207655_1005715 Ga0207655_10057152 381
468 3300027111 Ga0209281_1000009 Ga0209281_1000009392 381
469 3300031548 Ga0307408_100007588 Ga0307408_1000075882 381
470 3300031731 Ga0307405_10050641 Ga0307405_100506411 381
471 3300031824 Ga0307413_10044281 Ga0307413_100442812 381
472 3300031901 Ga0307406_10016525 Ga0307406_100165252 381
473 3300031903 Ga0307407_10058849 Ga0307407_100588493 381
474 3300031911 Ga0307412_10001489 Ga0307412_100014897 381
475 3300031911 Ga0307412_10004125 Ga0307412_100041256 381
476 3300031911 Ga0307412_10005227 Ga0307412_100052276 381
477 3300031911 Ga0307412_10193721 Ga0307412_101937212 381
478 3300031995 Ga0307409_100211491 Ga0307409_1002114911 381
479 3300032004 Ga0307414_10265513 Ga0307414_102655131 381
480 3300032004 Ga0307414_10296114 Ga0307414_102961141 381
481 3300032005 Ga0307411_10012125 Ga0307411_100121253 381
482 3300041405 Ga0439438_001021 Ga0439438_001021_6444_7595 381
483 3300041405 Ga0439438_001812 Ga0439438_001812_4875_6026 381
484 3300041997 Ga0439431_0006087 Ga0439431_0006087_632_1780 381
485 3300042004 Ga0439445_0002580 Ga0439445_0002580_428_1576 381
486 3300042006 Ga0439432_001230 Ga0439432_001230_5406_6557 381
487 3300042006 Ga0439432_001672 Ga0439432_001672_3230_4378 381
488 3300042016 Ga0439463_018138 Ga0439463_018138_532_1680 381
489 3300046453 Ga0495627_001863 Ga0495627_001863_7527_8675 381
490 3300046458 Ga0495591_007623 Ga0495591_007623_171_1319 381
491 3300046471 Ga0495650_0046317 Ga0495650_0046317_524_1672 381
492 3300046474 Ga0495605_0000197 Ga0495605_0000197_224_1372 381
493 3300046474 Ga0495605_0024112 Ga0495605_0024112_1400_2548 381
494 3300046492 Ga0495585_0012080 Ga0495585_0012080_1197_2345 381
495 3300046499 Ga0495594_0065612 Ga0495594_0065612_174_1322 381
496 3300046506 Ga0495583_0000283 Ga0495583_0000283_48446_49594 381
497 3300046506 Ga0495583_0002906 Ga0495583_0002906_9550_10698 381
498 3300046507 Ga0495606_0033671 Ga0495606_0033671_1742_2896 381
499 3300046512 Ga0495610_0002906 Ga0495610_0002906_9605_10753 381
500 3300046512 Ga0495610_0034611 Ga0495610_0034611_796_1944 381
501 3300046512 Ga0495610_0058676 Ga0495610_0058676_316_1464 381
502 3300046513 Ga0495616_0007845 Ga0495616_0007845_2215_3363 381
503 3300046518 Ga0495631_0036244 Ga0495631_0036244_125_1273 381
504 3300046519 Ga0495632_0016829 Ga0495632_0016829_1961_3109 381
505 3300046523 Ga0495644_0000462 Ga0495644_0000462_3567_4715 381
506 3300046524 Ga0495648_0003589 Ga0495648_0003589_244_1392 381
507 3300046530 Ga0495654_0000461 Ga0495654_0000461_21991_23139 381
508 3300046530 Ga0495654_0002967 Ga0495654_0002967_6439_7587 381
509 3300046538 Ga0495609_0000222 Ga0495609_0000222_6237_7385 381
510 3300046542 Ga0495597_0024067 Ga0495597_0024067_1201_2349 381
511 3300046557 Ga0495622_0019825 Ga0495622_0019825_424_1572 381
512 3300046660 Ga0495625_0025708 Ga0495625_0025708_2982_4130 381
513 3300046665 Ga0495661_0084568 Ga0495661_0084568_495_1643 381
514 3300046674 Ga0495588_0007522 Ga0495588_0007522_605_1753 381
515 3300046694 Ga0495649_0008877 Ga0495649_0008877_3024_4172 381
516 3300046794 Ga0495589_0008025 Ga0495589_0008025_3970_5118 381
517 3300046810 Ga0495660_0005235 Ga0495660_0005235_4620_5768 381
518 3300047320 Ga0495672_0003018 Ga0495672_0003018_3569_4717 381
519 3300047320 Ga0495672_0066852 Ga0495672_0066852_812_1966 381
520 3300047323 Ga0495683_0000185 Ga0495683_0000185_37931_39079 381
521 3300047469 Ga0495673_0002289 Ga0495673_0002289_3016_4164 381
522 3300047469 Ga0495673_0022317 Ga0495673_0022317_1593_2741 381
523 3300047470 Ga0495681_0000804 Ga0495681_0000804_3757_4905 381
524 3300048091 Ga0495626_0002511 Ga0495626_0002511_3254_4402 381
525 3300049459 Ga0495678_010183 Ga0495678_010183_1990_3138 381
526 2124908027 MRS2a_Contig_6993 MRS2a_00825800 382
527 2124908027 MRS2a_Contig_731 MRS2a_00589290 382
528 2162886011 MRS1b_contig_5847325 MRS1b_0801.00002440 382
529 3300003752 Ga0055539_1000011 Ga0055539_100001163 382
530 3300003756 Ga0055533_1000014 Ga0055533_100001463 382
531 3300003758 Ga0055532_1000009 Ga0055532_100000963 382
532 3300003759 Ga0055525_1000016 Ga0055525_100001663 382
533 3300003841 Ga0055541_1000008 Ga0055541_100000863 382
534 3300005288 Ga0065714_10000255 Ga0065714_100002553 382
535 3300005288 Ga0065714_10009982 Ga0065714_100099823 382
536 3300005288 Ga0065714_10012859 Ga0065714_100128591 382
537 3300005288 Ga0065714_10068323 Ga0065714_100683231 382
538 3300005288 Ga0065714_10075816 Ga0065714_100758161 382
539 3300005288 Ga0065714_10082916 Ga0065714_100829163 382
540 3300005289 Ga0065704_10099151 Ga0065704_100991512 382
541 3300005289 Ga0065704_10136757 Ga0065704_101367571 382
542 3300005290 Ga0065712_10069901 Ga0065712_100699015 382
543 3300005293 Ga0065715_10013805 Ga0065715_100138053 382
544 3300005331 Ga0070670_100000495 Ga0070670_10000049532 382
545 3300005353 Ga0070669_100010476 Ga0070669_1000104765 382
546 3300005457 Ga0070662_100003888 Ga0070662_1000038884 382
547 3300005564 Ga0070664_100000064 Ga0070664_10000006445 382
548 3300005834 Ga0068851_10000165 Ga0068851_1000016527 382
549 3300006058 Ga0075432_10003031 Ga0075432_100030312 382
550 3300006177 Ga0075362_10118062 Ga0075362_101180621 382
551 3300006914 Ga0075436_100015966 Ga0075436_1000159664 382
552 3300006946 Ga0079104_1000235 Ga0079104_100023514 382
553 3300009011 Ga0105251_10001310 Ga0105251_100013105 382
554 3300009011 Ga0105251_10014230 Ga0105251_100142304 382
555 3300009011 Ga0105251_10034266 Ga0105251_100342663 382
556 3300009011 Ga0105251_10100078 Ga0105251_101000781 382
557 3300009036 Ga0105244_10002575 Ga0105244_100025756 382
558 3300009036 Ga0105244_10003967 Ga0105244_100039678 382
559 3300009036 Ga0105244_10006056 Ga0105244_100060568 382
560 3300009036 Ga0105244_10027913 Ga0105244_100279133 382
561 3300009092 Ga0105250_10000256 Ga0105250_1000025624 382
562 3300009176 Ga0105242_10004868 Ga0105242_100048686 382
563 3300009545 Ga0105237_10000426 Ga0105237_1000042645 382
564 3300011119 Ga0105246_10011996 Ga0105246_100119963 382
565 3300013100 Ga0157373_10002099 Ga0157373_100020994 382
566 3300013100 Ga0157373_10002260 Ga0157373_100022606 382
567 3300013100 Ga0157373_10002438 Ga0157373_100024386 382
568 3300013100 Ga0157373_10025264 Ga0157373_100252643 382
569 3300013102 Ga0157371_10000189 Ga0157371_100001895 382
570 3300013102 Ga0157371_10017892 Ga0157371_100178924 382
571 3300013104 Ga0157370_10066712 Ga0157370_100667122 382
572 3300013104 Ga0157370_10086648 Ga0157370_100866482 382
573 3300013104 Ga0157370_10103178 Ga0157370_101031783 382
574 3300013104 Ga0157370_10191776 Ga0157370_101917762 382
575 3300013105 Ga0157369_10005447 Ga0157369_100054478 382
576 3300013105 Ga0157369_10007726 Ga0157369_100077264 382
577 3300013105 Ga0157369_10045733 Ga0157369_100457334 382
578 3300013308 Ga0157375_10003950 Ga0157375_100039506 382
579 3300014497 Ga0182008_10000942 Ga0182008_100009429 382
580 3300014497 Ga0182008_10044238 Ga0182008_100442382 382
581 3300014497 Ga0182008_10055744 Ga0182008_100557443 382
582 3300014497 Ga0182008_10085377 Ga0182008_100853772 382
583 3300015261 Ga0182006_1000704 Ga0182006_10007049 382
584 3300015261 Ga0182006_1030283 Ga0182006_10302831 382
585 3300015262 Ga0182007_10000083 Ga0182007_1000008350 382
586 3300015262 Ga0182007_10001288 Ga0182007_1000128810 382
587 3300015265 Ga0182005_1001844 Ga0182005_10018442 382
588 3300015265 Ga0182005_1008383 Ga0182005_10083833 382
589 3300015265 Ga0182005_1008813 Ga0182005_10088131 382
590 3300015265 Ga0182005_1040602 Ga0182005_10406021 382
591 3300017792 Ga0163161_10000440 Ga0163161_100004405 382
592 3300017792 Ga0163161_10009073 Ga0163161_100090738 382
593 3300017792 Ga0163161_10048643 Ga0163161_100486433 382
594 3300017792 Ga0163161_10161309 Ga0163161_101613091 382
595 3300025206 Ga0209435_101164 Ga0209435_1011644 382
596 3300025224 Ga0209784_100023 Ga0209784_10002362 382
597 3300025225 Ga0209566_100019 Ga0209566_10001975 382
598 3300025226 Ga0209674_100034 Ga0209674_10003475 382
599 3300025229 Ga0209147_100027 Ga0209147_10002777 382
600 3300025230 Ga0209563_100037 Ga0209563_10003775 382
601 3300025242 Ga0209258_100268 Ga0209258_10026862 382
602 3300025246 Ga0209646_1000323 Ga0209646_100032312 382
603 3300025253 Ga0209677_100021 Ga0209677_10002175 382
604 3300025292 Ga0209676_1004504 Ga0209676_10045046 382
605 3300025298 Ga0209050_1000321 Ga0209050_10003215 382
606 3300025303 Ga0209051_1017169 Ga0209051_10171691 382
607 3300025321 Ga0207656_10002984 Ga0207656_100029843 382
608 3300025711 Ga0207696_1000186 Ga0207696_100018625 382
609 3300025711 Ga0207696_1002373 Ga0207696_10023733 382
610 3300025728 Ga0207655_1000207 Ga0207655_100020746 382
611 3300025728 Ga0207655_1001659 Ga0207655_10016595 382
612 3300025728 Ga0207655_1004289 Ga0207655_10042892 382
613 3300025728 Ga0207655_1018714 Ga0207655_10187144 382
614 3300025728 Ga0207655_1028945 Ga0207655_10289452 382
615 3300025735 Ga0207713_1000326 Ga0207713_100032611 382
616 3300025735 Ga0207713_1008776 Ga0207713_10087765 382
617 3300025735 Ga0207713_1029694 Ga0207713_10296942 382
618 3300025735 Ga0207713_1029696 Ga0207713_10296962 382
619 3300025735 Ga0207713_1056082 Ga0207713_10560821 382
620 3300025914 Ga0207671_10000743 Ga0207671_1000074313 382
621 3300025920 Ga0207649_10000116 Ga0207649_1000011618 382
622 3300025925 Ga0207650_10000750 Ga0207650_100007505 382
623 3300025934 Ga0207686_10002731 Ga0207686_100027314 382
624 3300025945 Ga0207679_10000054 Ga0207679_1000005442 382
625 3300026041 Ga0207639_10118851 Ga0207639_101188512 382
626 3300027111 Ga0209281_1000046 Ga0209281_1000046237 382
627 3300027907 Ga0207428_10007691 Ga0207428_1000769112 382
628 3300027907 Ga0207428_10022356 Ga0207428_100223562 382
629 3300030521 Ga0307511_10144701 Ga0307511_101447011 382
630 3300041405 Ga0439438_000998 Ga0439438_000998_2116_3267 382
631 3300041405 Ga0439438_003764 Ga0439438_003764_1502_2653 382
632 3300041405 Ga0439438_004188 Ga0439438_004188_1377_2552 382
633 3300041405 Ga0439438_005138 Ga0439438_005138_1486_2637 382
634 3300041407 Ga0439447_001833 Ga0439447_001833_3188_4339 382
635 3300041407 Ga0439447_002314 Ga0439447_002314_3610_4761 382
636 3300041407 Ga0439447_003667 Ga0439447_003667_603_1754 382
637 3300041407 Ga0439447_003840 Ga0439447_003840_872_2035 382
638 3300041411 Ga0439466_0001055 Ga0439466_0001055_1836_2987 382
639 3300041411 Ga0439466_0001400 Ga0439466_0001400_2912_4063 382
640 3300041411 Ga0439466_0003160 Ga0439466_0003160_3344_4495 382
641 3300041411 Ga0439466_0010386 Ga0439466_0010386_1771_2922 382
642 3300042006 Ga0439432_000031 Ga0439432_000031_17454_18611 382
643 3300042006 Ga0439432_003431 Ga0439432_003431_1134_2285 382
644 3300042009 Ga0439451_000310 Ga0439451_000310_2947_4098 382
645 3300042009 Ga0439451_001779 Ga0439451_001779_642_1793 382
646 3300042010 Ga0439452_001132 Ga0439452_001132_3090_4241 382
647 3300042010 Ga0439452_001430 Ga0439452_001430_5304_6455 382
648 3300042122 Ga0450920_001078 Ga0450920_001078_134_1297 382
649 3300042138 Ga0450903_007363 Ga0450903_007363_585_1760 382
650 3300042138 Ga0450903_009157 Ga0450903_009157_89_1240 382
651 3300042139 Ga0450904_001002 Ga0450904_001002_2037_3188 382
652 3300042146 Ga0450907_000269 Ga0450907_000269_3603_4754 382
653 3300042146 Ga0450907_002262 Ga0450907_002262_1123_2286 382
654 3300042156 Ga0439446_0005630 Ga0439446_0005630_540_1691 382
655 3300042184 Ga0450908_001729 Ga0450908_001729_2468_3619 382
656 3300042185 Ga0450909_001472 Ga0450909_001472_502_1653 382
657 3300042435 Ga0439434_0001842 Ga0439434_0001842_1900_3051 382
658 3300042461 Ga0439460_0003382 Ga0439460_0003382_1150_2301 382
659 3300042461 Ga0439460_0003508 Ga0439460_0003508_369_1544 382
660 3300042533 Ga0450901_001417 Ga0450901_001417_1188_2339 382
661 3300042993 Ga0439440_0000822 Ga0439440_0000822_3521_4672 382
662 3300046452 Ga0495617_000097 Ga0495617_000097_58453_59604 382
663 3300046452 Ga0495617_001247 Ga0495617_001247_2304_3467 382
664 3300046452 Ga0495617_001668 Ga0495617_001668_1972_3135 382
665 3300046452 Ga0495617_005076 Ga0495617_005076_762_1913 382
666 3300046452 Ga0495617_005357 Ga0495617_005357_2037_3188 382
667 3300046453 Ga0495627_000517 Ga0495627_000517_29739_30899 382
668 3300046453 Ga0495627_015889 Ga0495627_015889_1226_2377 382
669 3300046455 Ga0495603_0011368 Ga0495603_0011368_3428_4579 382
670 3300046455 Ga0495603_0027710 Ga0495603_0027710_551_1720 382
671 3300046455 Ga0495603_0037608 Ga0495603_0037608_1688_2839 382
672 3300046457 Ga0495590_0000708 Ga0495590_0000708_4680_5831 382
673 3300046457 Ga0495590_0008745 Ga0495590_0008745_781_1932 382
674 3300046457 Ga0495590_0019869 Ga0495590_0019869_495_1646 382
675 3300046457 Ga0495590_0021644 Ga0495590_0021644_164_1315 382
676 3300046458 Ga0495591_000060 Ga0495591_000060_31675_32826 382
677 3300046458 Ga0495591_000354 Ga0495591_000354_9697_10857 382
678 3300046458 Ga0495591_006811 Ga0495591_006811_2425_3576 382
679 3300046460 Ga0495638_0001565 Ga0495638_0001565_3208_4362 382
680 3300046460 Ga0495638_0002480 Ga0495638_0002480_2008_3159 382
681 3300046460 Ga0495638_0002560 Ga0495638_0002560_10369_11520 382
682 3300046460 Ga0495638_0003323 Ga0495638_0003323_2934_4118 382
683 3300046460 Ga0495638_0012218 Ga0495638_0012218_3091_4242 382
684 3300046460 Ga0495638_0015951 Ga0495638_0015951_1357_2508 382
685 3300046460 Ga0495638_0030695 Ga0495638_0030695_1467_2615 382
686 3300046460 Ga0495638_0035221 Ga0495638_0035221_1047_2198 382
687 3300046460 Ga0495638_0035682 Ga0495638_0035682_725_1876 382
688 3300046460 Ga0495638_0043170 Ga0495638_0043170_1492_2643 382
689 3300046460 Ga0495638_0066691 Ga0495638_0066691_372_1523 382
690 3300046463 Ga0495653_0006664 Ga0495653_0006664_3318_4469 382
691 3300046471 Ga0495650_0001297 Ga0495650_0001297_16798_17949 382
692 3300046471 Ga0495650_0002090 Ga0495650_0002090_12913_14064 382
693 3300046471 Ga0495650_0015181 Ga0495650_0015181_1705_2859 382
694 3300046471 Ga0495650_0022221 Ga0495650_0022221_477_1628 382
695 3300046471 Ga0495650_0026452 Ga0495650_0026452_503_1654 382
696 3300046474 Ga0495605_0008045 Ga0495605_0008045_3423_4574 382
697 3300046474 Ga0495605_0011728 Ga0495605_0011728_3623_4774 382
698 3300046474 Ga0495605_0015578 Ga0495605_0015578_321_1469 382
699 3300046474 Ga0495605_0041097 Ga0495605_0041097_24_1175 382
700 3300046474 Ga0495605_0057215 Ga0495605_0057215_482_1633 382
701 3300046475 Ga0495639_0000038 Ga0495639_0000038_6621_7769 382
702 3300046475 Ga0495639_0016334 Ga0495639_0016334_1707_2858 382
703 3300046475 Ga0495639_0034347 Ga0495639_0034347_330_1481 382
704 3300046491 Ga0495584_0001813 Ga0495584_0001813_7690_8841 382
705 3300046491 Ga0495584_0002046 Ga0495584_0002046_1425_2576 382
706 3300046491 Ga0495584_0003710 Ga0495584_0003710_3181_4332 382
707 3300046491 Ga0495584_0005128 Ga0495584_0005128_2476_3627 382
708 3300046491 Ga0495584_0005630 Ga0495584_0005630_2825_3976 382
709 3300046491 Ga0495584_0005823 Ga0495584_0005823_2270_3421 382
710 3300046491 Ga0495584_0012567 Ga0495584_0012567_3074_4225 382
711 3300046491 Ga0495584_0052008 Ga0495584_0052008_658_1857 382
712 3300046492 Ga0495585_0000124 Ga0495585_0000124_2953_4104 382
713 3300046492 Ga0495585_0001763 Ga0495585_0001763_3194_4345 382
714 3300046492 Ga0495585_0019756 Ga0495585_0019756_1788_2951 382
715 3300046499 Ga0495594_0002774 Ga0495594_0002774_6147_7295 382
716 3300046499 Ga0495594_0005166 Ga0495594_0005166_904_2055 382
717 3300046499 Ga0495594_0013928 Ga0495594_0013928_2939_4090 382
718 3300046500 Ga0495596_0000014 Ga0495596_0000014_3453_4604 382
719 3300046501 Ga0495607_0000014 Ga0495607_0000014_126493_127644 382
720 3300046501 Ga0495607_0002301 Ga0495607_0002301_9573_10724 382
721 3300046501 Ga0495607_0002457 Ga0495607_0002457_9200_10369 382
722 3300046501 Ga0495607_0003228 Ga0495607_0003228_3989_5140 382
723 3300046501 Ga0495607_0004200 Ga0495607_0004200_2996_4147 382
724 3300046501 Ga0495607_0004809 Ga0495607_0004809_6911_8062 382
725 3300046501 Ga0495607_0005102 Ga0495607_0005102_367_1518 382
726 3300046501 Ga0495607_0013226 Ga0495607_0013226_2262_3413 382
727 3300046501 Ga0495607_0022955 Ga0495607_0022955_1287_2447 382
728 3300046501 Ga0495607_0057886 Ga0495607_0057886_939_2108 382
729 3300046501 Ga0495607_0061043 Ga0495607_0061043_218_1369 382
730 3300046506 Ga0495583_0001409 Ga0495583_0001409_13650_14807 382
731 3300046506 Ga0495583_0003128 Ga0495583_0003128_105_1256 382
732 3300046506 Ga0495583_0014447 Ga0495583_0014447_1050_2201 382
733 3300046506 Ga0495583_0015939 Ga0495583_0015939_2048_3196 382
734 3300046507 Ga0495606_0001003 Ga0495606_0001003_30574_31734 382
735 3300046507 Ga0495606_0023792 Ga0495606_0023792_29_1180 382
736 3300046507 Ga0495606_0028570 Ga0495606_0028570_2046_3203 382
737 3300046507 Ga0495606_0031522 Ga0495606_0031522_1577_2776 382
738 3300046507 Ga0495606_0084789 Ga0495606_0084789_91_1242 382
739 3300046512 Ga0495610_0015991 Ga0495610_0015991_1112_2263 382
740 3300046512 Ga0495610_0017194 Ga0495610_0017194_43_1206 382
741 3300046512 Ga0495610_0071069 Ga0495610_0071069_383_1534 382
742 3300046513 Ga0495616_0002614 Ga0495616_0002614_7322_8473 382
743 3300046513 Ga0495616_0003642 Ga0495616_0003642_3158_4309 382
744 3300046513 Ga0495616_0006614 Ga0495616_0006614_3038_4189 382
745 3300046513 Ga0495616_0023433 Ga0495616_0023433_2126_3277 382
746 3300046513 Ga0495616_0047436 Ga0495616_0047436_370_1521 382
747 3300046515 Ga0495620_0002752 Ga0495620_0002752_2782_3933 382
748 3300046515 Ga0495620_0003278 Ga0495620_0003278_7193_8350 382
749 3300046515 Ga0495620_0004732 Ga0495620_0004732_6164_7315 382
750 3300046515 Ga0495620_0007616 Ga0495620_0007616_3194_4393 382
751 3300046516 Ga0495628_0069275 Ga0495628_0069275_1186_2337 382
752 3300046518 Ga0495631_0000549 Ga0495631_0000549_20589_21788 382
753 3300046518 Ga0495631_0009697 Ga0495631_0009697_630_1781 382
754 3300046519 Ga0495632_0000343 Ga0495632_0000343_3159_4310 382
755 3300046519 Ga0495632_0000424 Ga0495632_0000424_9588_10748 382
756 3300046519 Ga0495632_0001891 Ga0495632_0001891_3303_4454 382
757 3300046519 Ga0495632_0004152 Ga0495632_0004152_5892_7043 382
758 3300046519 Ga0495632_0004771 Ga0495632_0004771_4941_6092 382
759 3300046519 Ga0495632_0012377 Ga0495632_0012377_1648_2799 382
760 3300046519 Ga0495632_0057298 Ga0495632_0057298_195_1358 382
761 3300046520 Ga0495637_0001107 Ga0495637_0001107_3045_4196 382
762 3300046520 Ga0495637_0002336 Ga0495637_0002336_3461_4612 382
763 3300046520 Ga0495637_0002746 Ga0495637_0002746_2255_3406 382
764 3300046520 Ga0495637_0003626 Ga0495637_0003626_42_1193 382
765 3300046520 Ga0495637_0008349 Ga0495637_0008349_1460_2659 382
766 3300046520 Ga0495637_0015660 Ga0495637_0015660_1738_2889 382
767 3300046520 Ga0495637_0017417 Ga0495637_0017417_233_1384 382
768 3300046520 Ga0495637_0018945 Ga0495637_0018945_156_1325 382
769 3300046520 Ga0495637_0032251 Ga0495637_0032251_238_1407 382
770 3300046520 Ga0495637_0035951 Ga0495637_0035951_412_1581 382
771 3300046522 Ga0495643_0012619 Ga0495643_0012619_702_1853 382
772 3300046522 Ga0495643_0028326 Ga0495643_0028326_76_1227 382
773 3300046522 Ga0495643_0030954 Ga0495643_0030954_767_1918 382
774 3300046523 Ga0495644_0000922 Ga0495644_0000922_3244_4395 382
775 3300046523 Ga0495644_0006368 Ga0495644_0006368_332_1483 382
776 3300046523 Ga0495644_0060544 Ga0495644_0060544_93_1244 382
777 3300046524 Ga0495648_0003483 Ga0495648_0003483_9848_10999 382
778 3300046524 Ga0495648_0012334 Ga0495648_0012334_2028_3191 382
779 3300046524 Ga0495648_0012644 Ga0495648_0012644_3160_4323 382
780 3300046524 Ga0495648_0031337 Ga0495648_0031337_21_1172 382
781 3300046524 Ga0495648_0043924 Ga0495648_0043924_1162_2313 382
782 3300046526 Ga0495666_0000655 Ga0495666_0000655_3045_4196 382
783 3300046526 Ga0495666_0020763 Ga0495666_0020763_1621_2769 382
784 3300046528 Ga0495642_0000479 Ga0495642_0000479_15699_16850 382
785 3300046528 Ga0495642_0000918 Ga0495642_0000918_9522_10673 382
786 3300046528 Ga0495642_0001912 Ga0495642_0001912_3412_4563 382
787 3300046530 Ga0495654_0000968 Ga0495654_0000968_5696_6844 382
788 3300046530 Ga0495654_0000998 Ga0495654_0000998_9990_11147 382
789 3300046530 Ga0495654_0002727 Ga0495654_0002727_2125_3288 382
790 3300046530 Ga0495654_0010285 Ga0495654_0010285_2064_3248 382
791 3300046530 Ga0495654_0014876 Ga0495654_0014876_2762_3961 382
792 3300046530 Ga0495654_0020910 Ga0495654_0020910_937_2088 382
793 3300046530 Ga0495654_0023729 Ga0495654_0023729_1986_3137 382
794 3300046530 Ga0495654_0028323 Ga0495654_0028323_1163_2314 382
795 3300046530 Ga0495654_0069695 Ga0495654_0069695_94_1254 382
796 3300046538 Ga0495609_0063214 Ga0495609_0063214_378_1529 382
797 3300046538 Ga0495609_0071714 Ga0495609_0071714_79_1230 382
798 3300046538 Ga0495609_0076608 Ga0495609_0076608_236_1387 382
799 3300046542 Ga0495597_0003745 Ga0495597_0003745_689_1840 382
800 3300046542 Ga0495597_0012456 Ga0495597_0012456_1200_2351 382
801 3300046542 Ga0495597_0014295 Ga0495597_0014295_2194_3345 382
802 3300046542 Ga0495597_0025445 Ga0495597_0025445_246_1397 382
803 3300046542 Ga0495597_0051033 Ga0495597_0051033_595_1746 382
804 3300046542 Ga0495597_0059360 Ga0495597_0059360_305_1456 382
805 3300046557 Ga0495622_0000070 Ga0495622_0000070_11801_12949 382
806 3300046557 Ga0495622_0005941 Ga0495622_0005941_1391_2542 382
807 3300046557 Ga0495622_0047678 Ga0495622_0047678_17_1168 382
808 3300046557 Ga0495622_0050602 Ga0495622_0050602_221_1372 382
809 3300046558 Ga0495633_0005332 Ga0495633_0005332_3483_4634 382
810 3300046616 Ga0495668_0002296 Ga0495668_0002296_3281_4432 382
811 3300046642 Ga0495634_0002704 Ga0495634_0002704_9858_11009 382
812 3300046648 Ga0495611_0003070 Ga0495611_0003070_2900_4051 382
813 3300046648 Ga0495611_0004084 Ga0495611_0004084_2132_3283 382
814 3300046660 Ga0495625_0003800 Ga0495625_0003800_10380_11531 382
815 3300046660 Ga0495625_0067149 Ga0495625_0067149_541_1692 382
816 3300046660 Ga0495625_0119647 Ga0495625_0119647_153_1304 382
817 3300046663 Ga0495635_0001198 Ga0495635_0001198_13186_14337 382
818 3300046664 Ga0495659_0000305 Ga0495659_0000305_6167_7315 382
819 3300046664 Ga0495659_0003767 Ga0495659_0003767_2729_3880 382
820 3300046664 Ga0495659_0008860 Ga0495659_0008860_76_1227 382
821 3300046665 Ga0495661_0000501 Ga0495661_0000501_9723_10883 382
822 3300046665 Ga0495661_0018542 Ga0495661_0018542_2239_3390 382
823 3300046665 Ga0495661_0020589 Ga0495661_0020589_274_1425 382
824 3300046665 Ga0495661_0036388 Ga0495661_0036388_638_1789 382
825 3300046665 Ga0495661_0081584 Ga0495661_0081584_80_1231 382
826 3300046665 Ga0495661_0116845 Ga0495661_0116845_216_1385 382
827 3300046665 Ga0495661_0122528 Ga0495661_0122528_115_1266 382
828 3300046665 Ga0495661_0124791 Ga0495661_0124791_77_1228 382
829 3300046674 Ga0495588_0030856 Ga0495588_0030856_1391_2542 382
830 3300046679 Ga0495623_0003673 Ga0495623_0003673_3010_4161 382
831 3300046679 Ga0495623_0005137 Ga0495623_0005137_4164_5315 382
832 3300046684 Ga0495669_0023467 Ga0495669_0023467_31_1182 382
833 3300046689 Ga0495613_0059247 Ga0495613_0059247_1020_2171 382
834 3300046691 Ga0495670_0000788 Ga0495670_0000788_9310_10461 382
835 3300046691 Ga0495670_0002069 Ga0495670_0002069_2270_3433 382
836 3300046691 Ga0495670_0002573 Ga0495670_0002573_4871_6022 382
837 3300046691 Ga0495670_0010332 Ga0495670_0010332_603_1754 382
838 3300046691 Ga0495670_0012726 Ga0495670_0012726_1515_2666 382
839 3300046691 Ga0495670_0013384 Ga0495670_0013384_248_1399 382
840 3300046691 Ga0495670_0094839 Ga0495670_0094839_29_1180 382
841 3300046692 Ga0495671_0002310 Ga0495671_0002310_1531_2682 382
842 3300046692 Ga0495671_0006217 Ga0495671_0006217_2308_3459 382
843 3300046692 Ga0495671_0006266 Ga0495671_0006266_2910_4061 382
844 3300046692 Ga0495671_0007157 Ga0495671_0007157_719_1870 382
845 3300046692 Ga0495671_0011310 Ga0495671_0011310_706_1857 382
846 3300046692 Ga0495671_0012858 Ga0495671_0012858_2191_3342 382
847 3300046692 Ga0495671_0016732 Ga0495671_0016732_1124_2299 382
848 3300046692 Ga0495671_0044049 Ga0495671_0044049_346_1497 382
849 3300046694 Ga0495649_0000104 Ga0495649_0000104_35195_36364 382
850 3300046694 Ga0495649_0001289 Ga0495649_0001289_5991_7139 382
851 3300046694 Ga0495649_0006751 Ga0495649_0006751_3843_5006 382
852 3300046694 Ga0495649_0007473 Ga0495649_0007473_3158_4309 382
853 3300046694 Ga0495649_0012100 Ga0495649_0012100_49_1200 382
854 3300046694 Ga0495649_0012430 Ga0495649_0012430_236_1387 382
855 3300046694 Ga0495649_0017986 Ga0495649_0017986_2144_3295 382
856 3300046694 Ga0495649_0023960 Ga0495649_0023960_1634_2791 382
857 3300046794 Ga0495589_0007918 Ga0495589_0007918_2911_4062 382
858 3300046794 Ga0495589_0008427 Ga0495589_0008427_3548_4699 382
859 3300046794 Ga0495589_0013865 Ga0495589_0013865_197_1360 382
860 3300046794 Ga0495589_0019208 Ga0495589_0019208_1241_2392 382
861 3300046794 Ga0495589_0021297 Ga0495589_0021297_622_1791 382
862 3300046810 Ga0495660_0006799 Ga0495660_0006799_2735_3886 382
863 3300046810 Ga0495660_0007040 Ga0495660_0007040_2388_3539 382
864 3300046810 Ga0495660_0015419 Ga0495660_0015419_456_1607 382
865 3300046810 Ga0495660_0018142 Ga0495660_0018142_258_1409 382
866 3300046810 Ga0495660_0023450 Ga0495660_0023450_1479_2630 382
867 3300046810 Ga0495660_0041413 Ga0495660_0041413_308_1459 382
868 3300046810 Ga0495660_0070263 Ga0495660_0070263_217_1368 382
869 3300047315 Ga0495581_0003578 Ga0495581_0003578_6608_7756 382
870 3300047317 Ga0495604_0002652 Ga0495604_0002652_3241_4392 382
871 3300047317 Ga0495604_0013567 Ga0495604_0013567_3076_4227 382
872 3300047318 Ga0495636_0005637 Ga0495636_0005637_1066_2217 382
873 3300047318 Ga0495636_0059735 Ga0495636_0059735_416_1567 382
874 3300047319 Ga0495674_0046201 Ga0495674_0046201_660_1811 382
875 3300047320 Ga0495672_0000331 Ga0495672_0000331_3064_4215 382
876 3300047320 Ga0495672_0002113 Ga0495672_0002113_12096_13244 382
877 3300047320 Ga0495672_0004451 Ga0495672_0004451_8148_9299 382
878 3300047320 Ga0495672_0012721 Ga0495672_0012721_3079_4230 382
879 3300047320 Ga0495672_0019327 Ga0495672_0019327_3172_4335 382
880 3300047320 Ga0495672_0031812 Ga0495672_0031812_165_1328 382
881 3300047320 Ga0495672_0048335 Ga0495672_0048335_522_1673 382
882 3300047320 Ga0495672_0094122 Ga0495672_0094122_152_1303 382
883 3300047321 Ga0495676_0001611 Ga0495676_0001611_7394_8563 382
884 3300047322 Ga0495680_0077959 Ga0495680_0077959_360_1511 382
885 3300047323 Ga0495683_0000920 Ga0495683_0000920_15232_16383 382
886 3300047323 Ga0495683_0001071 Ga0495683_0001071_14811_15962 382
887 3300047323 Ga0495683_0001701 Ga0495683_0001701_9619_10770 382
888 3300047323 Ga0495683_0002732 Ga0495683_0002732_6644_7795 382
889 3300047323 Ga0495683_0030608 Ga0495683_0030608_217_1368 382
890 3300047323 Ga0495683_0071177 Ga0495683_0071177_507_1655 382
891 3300047443 Ga0495687_001896 Ga0495687_001896_12205_13353 382
892 3300047443 Ga0495687_002012 Ga0495687_002012_12975_14126 382
893 3300047443 Ga0495687_003051 Ga0495687_003051_2211_3374 382
894 3300047443 Ga0495687_003319 Ga0495687_003319_2038_3201 382
895 3300047445 Ga0495677_0002044 Ga0495677_0002044_6210_7361 382
896 3300047446 Ga0495679_002192 Ga0495679_002192_6891_8051 382
897 3300047446 Ga0495679_004726 Ga0495679_004726_3483_4634 382
898 3300047447 Ga0495685_025982 Ga0495685_025982_249_1400 382
899 3300047469 Ga0495673_0002263 Ga0495673_0002263_9416_10567 382
900 3300047469 Ga0495673_0004020 Ga0495673_0004020_5497_6660 382
901 3300047469 Ga0495673_0004197 Ga0495673_0004197_3493_4692 382
902 3300047469 Ga0495673_0004554 Ga0495673_0004554_5696_6859 382
903 3300047469 Ga0495673_0005403 Ga0495673_0005403_3553_4704 382
904 3300047469 Ga0495673_0005775 Ga0495673_0005775_2848_3999 382
905 3300047469 Ga0495673_0014932 Ga0495673_0014932_803_1954 382
906 3300047469 Ga0495673_0029359 Ga0495673_0029359_963_2114 382
907 3300047469 Ga0495673_0035676 Ga0495673_0035676_577_1728 382
908 3300047469 Ga0495673_0048213 Ga0495673_0048213_111_1271 382
909 3300047470 Ga0495681_0000399 Ga0495681_0000399_25263_26414 382
910 3300047470 Ga0495681_0001014 Ga0495681_0001014_2301_3452 382
911 3300047470 Ga0495681_0002079 Ga0495681_0002079_3135_4289 382
912 3300047470 Ga0495681_0002728 Ga0495681_0002728_8290_9528 382
913 3300047470 Ga0495681_0003785 Ga0495681_0003785_5892_7043 382
914 3300047470 Ga0495681_0007243 Ga0495681_0007243_2640_3791 382
915 3300047470 Ga0495681_0011105 Ga0495681_0011105_2878_4029 382
916 3300047470 Ga0495681_0017614 Ga0495681_0017614_1272_2471 382
917 3300047470 Ga0495681_0019031 Ga0495681_0019031_1658_2809 382
918 3300047470 Ga0495681_0032446 Ga0495681_0032446_696_1856 382
919 3300047470 Ga0495681_0069668 Ga0495681_0069668_404_1555 382
920 3300047472 Ga0495686_0003471 Ga0495686_0003471_9379_10530 382
921 3300047472 Ga0495686_0008020 Ga0495686_0008020_248_1399 382
922 3300047472 Ga0495686_0018000 Ga0495686_0018000_581_1732 382
923 3300048091 Ga0495626_0000203 Ga0495626_0000203_63966_65114 382
924 3300048091 Ga0495626_0000456 Ga0495626_0000456_37398_38573 382
925 3300048091 Ga0495626_0003174 Ga0495626_0003174_3396_4547 382
926 3300048091 Ga0495626_0006388 Ga0495626_0006388_4619_5770 382
927 3300048091 Ga0495626_0048175 Ga0495626_0048175_84_1235 382
928 3300048905 Ga0496102_0001019 Ga0496102_0001019_21683_22834 382
929 3300048906 Ga0496103_0005170 Ga0496103_0005170_3439_4590 382
930 3300048908 Ga0496105_0078700 Ga0496105_0078700_1517_2665 382
931 3300048909 Ga0496106_0075915 Ga0496106_0075915_1234_2382 382
932 3300048910 Ga0496107_0143940 Ga0496107_0143940_506_1654 382
933 3300048916 Ga0496113_0102919 Ga0496113_0102919_705_1856 382
934 3300048919 Ga0496116_0001790 Ga0496116_0001790_5831_6979 382
935 3300048919 Ga0496116_0003590 Ga0496116_0003590_3677_4828 382
936 3300048920 Ga0496117_0000720 Ga0496117_0000720_10113_11273 382
937 3300048920 Ga0496117_0006016 Ga0496117_0006016_7579_8736 382
938 3300048920 Ga0496117_0015516 Ga0496117_0015516_3616_4767 382
939 3300048920 Ga0496117_0023681 Ga0496117_0023681_1305_2456 382
940 3300048920 Ga0496117_0070727 Ga0496117_0070727_691_1839 382
941 3300048921 Ga0496118_0008420 Ga0496118_0008420_2223_3380 382
942 3300048921 Ga0496118_0009584 Ga0496118_0009584_7284_8441 382
943 3300048921 Ga0496118_0016534 Ga0496118_0016534_3202_4362 382
944 3300048921 Ga0496118_0017192 Ga0496118_0017192_1737_2888 382
945 3300048921 Ga0496118_0022489 Ga0496118_0022489_3090_4241 382
946 3300048921 Ga0496118_0094905 Ga0496118_0094905_265_1413 382
947 3300048922 Ga0496119_0016404 Ga0496119_0016404_1605_2795 382
948 3300048923 Ga0496120_0007042 Ga0496120_0007042_6592_7749 382
949 3300048923 Ga0496120_0015856 Ga0496120_0015856_1939_3129 382
950 3300048923 Ga0496120_0033702 Ga0496120_0033702_900_2057 382
951 3300048924 Ga0496121_0022233 Ga0496121_0022233_52_1200 382
952 3300048924 Ga0496121_0032478 Ga0496121_0032478_2943_4100 382
953 3300048924 Ga0496121_0071912 Ga0496121_0071912_246_1397 382
954 3300048925 Ga0496122_0004285 Ga0496122_0004285_7681_8838 382
955 3300048925 Ga0496122_0011812 Ga0496122_0011812_1461_2609 382
956 3300048925 Ga0496122_0018619 Ga0496122_0018619_1596_2747 382
957 3300048925 Ga0496122_0062736 Ga0496122_0062736_966_2123 382
958 3300048926 Ga0496123_0003416 Ga0496123_0003416_7693_8850 382
959 3300048926 Ga0496123_0011560 Ga0496123_0011560_887_2035 382
960 3300048926 Ga0496123_0014910 Ga0496123_0014910_1537_2688 382
961 3300048927 Ga0496124_0000816 Ga0496124_0000816_10603_11793 382
962 3300048927 Ga0496124_0006096 Ga0496124_0006096_3129_4280 382
963 3300048927 Ga0496124_0010907 Ga0496124_0010907_7946_9103 382
964 3300048928 Ga0496125_0000822 Ga0496125_0000822_38482_39642 382
965 3300048928 Ga0496125_0003780 Ga0496125_0003780_9153_10310 382
966 3300048928 Ga0496125_0004344 Ga0496125_0004344_9439_10596 382
967 3300048928 Ga0496125_0008974 Ga0496125_0008974_7872_9029 382
968 3300048928 Ga0496125_0033195 Ga0496125_0033195_598_1755 382
969 3300048928 Ga0496125_0036046 Ga0496125_0036046_231_1388 382
970 3300048928 Ga0496125_0038878 Ga0496125_0038878_1518_2669 382
971 3300048928 Ga0496125_0050653 Ga0496125_0050653_683_1840 382
972 3300048928 Ga0496125_0058225 Ga0496125_0058225_370_1527 382
973 3300048929 Ga0496126_0005995 Ga0496126_0005995_6692_7849 382
974 3300048929 Ga0496126_0007640 Ga0496126_0007640_2101_3258 382
975 3300049459 Ga0495678_002361 Ga0495678_002361_8253_9404 382
976 3300049459 Ga0495678_005865 Ga0495678_005865_4832_5983 382
977 3300049459 Ga0495678_013970 Ga0495678_013970_1202_2353 382
978 3300049459 Ga0495678_025920 Ga0495678_025920_1168_2319 382
979 3300049459 Ga0495678_035309 Ga0495678_035309_680_1831 382
980 3300049460 Ga0495682_0000905 Ga0495682_0000905_6808_7959 382
981 3300049460 Ga0495682_0002057 Ga0495682_0002057_2120_3271 382
982 3300049460 Ga0495682_0020833 Ga0495682_0020833_90_1241 382
983 3300049460 Ga0495682_0025014 Ga0495682_0025014_905_2068 382
984 3300053125 Ga0500618_002697 Ga0500618_002697_2387_3538 382

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

75

408

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.962 38 382
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.9532 38 382
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.9302 38 382
7cdy-assembly2.cif.gz_B crystal structure of glucose dehydrogenase 0.9221 38 382
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.9196 38 382
ID Description Score Start End Superfamily
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9109 34 382 2.120.10.30
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8984 34 382 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8731 36 382 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8583 36 382 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.841 36 380 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A7X7PHR3-F1-model_v4 PQQ-dependent sugar dehydrogenase 0.9903 296 378
AF-A0A421DSI4-F1-model_v4 Glucose/Sorbosone dehydrogenase domain-containing protein 0.9888 295 382
AF-C2BE23-F1-model_v4 Glucose/Sorbosone dehydrogenase 0.9795 296 371
AF-A0A377W8K7-F1-model_v4 Soluble aldose sugar dehydrogenase, PQQ-dependent (EC 1.1.5.-) 0.9794 45 115 GO:0016491
AF-A0A4Q3TAK4-F1-model_v4 PQQ-dependent sugar dehydrogenase 0.9721 296 382

Feature Viewer

pLDDT pTM Quality
86.96 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map