F487256

General Info

Members Datasets Scaffolds Average Seq Length
976 257 1952 155

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10607550|Ga0307413_106075501
Length 182
Sequence MKHLIPEFDALRKRYPEGFTSSLVLPCLRRIQEDRGYIDEQDVDDLTAYLGVPRVQIEEVLTFYSQFRREPVGRWHVQTCRNVSCCMRGAERLMAHLEDRLGIATGETTPDGRITLGTVECLGSCGTAPVVMVNEAYHENMTLEKLDLLLDGFGATAAAEPARSVVRQAVSAQGIGQPAGDD

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
167 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
170 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
177 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
178 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
198 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
199 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
202 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 4.51
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10607550 3300031824 Bacteria 896
2 JGI24738J21930_10103678 3300002075 Bacteria 609
3 JGI24749J21850_1006390 3300002076 Bacteria 1643
4 JGI24035J26624_1025670 3300002126 Bacteria 633
5 JGI24751J29686_10031005 3300002459 Bacteria 1109
6 Ga0065712_10095366 3300005290 Bacteria 2221
7 Ga0065715_10179808 3300005293 Bacteria 1485
8 Ga0065715_10189271 3300005293 Bacteria 1425
9 Ga0065715_10211621 3300005293 Bacteria 1311
10 Ga0070658_10040962 3300005327 Bacteria 3736
11 Ga0070658_10394950 3300005327 Bacteria 1188
12 Ga0070676_10000344 3300005328 Bacteria 21271
13 Ga0070676_10011378 3300005328 Bacteria 4838
14 Ga0070676_10011883 3300005328 Bacteria 4744
15 Ga0070676_10015396 3300005328 Bacteria 4219
16 Ga0070676_10378270 3300005328 Bacteria 980
17 Ga0070676_10393378 3300005328 Bacteria 962
18 Ga0070676_10432721 3300005328 Bacteria 922
19 Ga0070676_10633045 3300005328 Bacteria 775
20 Ga0070676_10698425 3300005328 Bacteria 740
21 Ga0070683_100021801 3300005329 Bacteria 5719
22 Ga0070683_100056776 3300005329 Bacteria 3635
23 Ga0070683_100311516 3300005329 Bacteria 1498
24 Ga0070683_100651054 3300005329 Bacteria 1009
25 Ga0070690_100007726 3300005330 Bacteria 6166
26 Ga0070690_100063483 3300005330 Bacteria 2383
27 Ga0070690_100449162 3300005330 Bacteria 955
28 Ga0070690_100530400 3300005330 Bacteria 885
29 Ga0070670_100006654 3300005331 Bacteria 9795
30 Ga0070670_100021994 3300005331 Bacteria 5487
31 Ga0070670_100029123 3300005331 Bacteria 4752
32 Ga0070670_100034134 3300005331 Bacteria 4379
33 Ga0070670_100037797 3300005331 Bacteria 4152
34 Ga0070670_100069982 3300005331 Bacteria 3012
35 Ga0070670_100074674 3300005331 Bacteria 2913
36 Ga0070670_100167174 3300005331 Bacteria 1907
37 Ga0070670_100366326 3300005331 Bacteria 1268
38 Ga0070670_100417508 3300005331 Bacteria 1186
39 Ga0070670_100560872 3300005331 Bacteria 1019
40 Ga0070670_100669679 3300005331 Bacteria 932
41 Ga0070677_10008344 3300005333 Bacteria 3482
42 Ga0070677_10018254 3300005333 Bacteria 2524
43 Ga0070677_10063960 3300005333 Bacteria 1527
44 Ga0070677_10185686 3300005333 Bacteria 993
45 Ga0068869_100001390 3300005334 Bacteria 14289
46 Ga0068869_100018108 3300005334 Bacteria 4789
47 Ga0068869_100075381 3300005334 Bacteria 2506
48 Ga0068869_100124637 3300005334 Bacteria 1974
49 Ga0068869_100292991 3300005334 Bacteria 1312
50 Ga0068869_100568471 3300005334 Bacteria 954
51 Ga0070666_10001973 3300005335 Bacteria 12500
52 Ga0070666_10002757 3300005335 Bacteria 10618
53 Ga0070666_10002876 3300005335 Bacteria 10395
54 Ga0070666_10030567 3300005335 Bacteria 3550
55 Ga0070666_10043671 3300005335 Bacteria 3002
56 Ga0070666_10093233 3300005335 Bacteria 2070
57 Ga0070666_10129965 3300005335 Bacteria 1749
58 Ga0070666_10384623 3300005335 Bacteria 1007
59 Ga0070666_10947049 3300005335 Bacteria 638
60 Ga0068868_100014546 3300005338 Bacteria 5802
61 Ga0068868_100100730 3300005338 Bacteria 2337
62 Ga0068868_100169549 3300005338 Bacteria 1807
63 Ga0068868_100202193 3300005338 Bacteria 1656
64 Ga0068868_100245237 3300005338 Bacteria 1506
65 Ga0068868_100427650 3300005338 Bacteria 1148
66 Ga0068868_100852143 3300005338 Bacteria 825
67 Ga0070660_100152045 3300005339 Bacteria 1861
68 Ga0070660_100712724 3300005339 Bacteria 842
69 Ga0070660_101005601 3300005339 Bacteria 704
70 Ga0070689_100013194 3300005340 Bacteria 5974
71 Ga0070689_100023376 3300005340 Bacteria 4627
72 Ga0070689_100154521 3300005340 Bacteria 1852
73 Ga0070689_100291555 3300005340 Bacteria 1356
74 Ga0070689_100366891 3300005340 Bacteria 1211
75 Ga0070689_100561475 3300005340 Bacteria 984
76 Ga0070687_100191315 3300005343 Bacteria 1233
77 Ga0070661_100016322 3300005344 Bacteria 5249
78 Ga0070661_100029443 3300005344 Bacteria 3963
79 Ga0070661_100042476 3300005344 Bacteria 3318
80 Ga0070661_100487000 3300005344 Bacteria 986
81 Ga0070661_100666339 3300005344 Bacteria 846
82 Ga0070668_100003802 3300005347 Bacteria 11160
83 Ga0070668_100009616 3300005347 Bacteria 7174
84 Ga0070668_100026834 3300005347 Bacteria 4372
85 Ga0070668_100044719 3300005347 Bacteria 3397
86 Ga0070668_100088006 3300005347 Bacteria 2444
87 Ga0070668_100114902 3300005347 Bacteria 2145
88 Ga0070668_100183707 3300005347 Bacteria 1709
89 Ga0070668_100302940 3300005347 Bacteria 1341
90 Ga0070668_100322175 3300005347 Bacteria 1301
91 Ga0070668_100358608 3300005347 Bacteria 1236
92 Ga0070668_100703181 3300005347 Bacteria 892
93 Ga0070668_101046698 3300005347 Bacteria 735
94 Ga0070668_101240512 3300005347 Bacteria 676
95 Ga0070669_100004539 3300005353 Bacteria 10024
96 Ga0070669_100007773 3300005353 Bacteria 7659
97 Ga0070669_100015364 3300005353 Bacteria 5456
98 Ga0070669_100026847 3300005353 Bacteria 4143
99 Ga0070669_100069997 3300005353 Bacteria 2593
100 Ga0070669_100121497 3300005353 Bacteria 1993
101 Ga0070669_100147558 3300005353 Bacteria 1818
102 Ga0070669_100176604 3300005353 Bacteria 1668
103 Ga0070669_100699762 3300005353 Bacteria 856
104 Ga0070669_101308734 3300005353 Bacteria 628
105 Ga0070675_100000222 3300005354 Bacteria 36370
106 Ga0070675_100004675 3300005354 Bacteria 10452
107 Ga0070675_100036061 3300005354 Bacteria 4022
108 Ga0070675_100048541 3300005354 Bacteria 3481
109 Ga0070675_100052849 3300005354 Bacteria 3341
110 Ga0070675_100288248 3300005354 Bacteria 1444
111 Ga0070675_100298670 3300005354 Bacteria 1418
112 Ga0070675_100361178 3300005354 Bacteria 1289
113 Ga0070675_100684329 3300005354 Bacteria 933
114 Ga0070675_100959740 3300005354 Bacteria 784
115 Ga0070675_101318647 3300005354 Bacteria 665
116 Ga0070671_100007206 3300005355 Bacteria 8894
117 Ga0070671_100037823 3300005355 Bacteria 4004
118 Ga0070671_100042664 3300005355 Bacteria 3770
119 Ga0070671_100067537 3300005355 Bacteria 2981
120 Ga0070671_100109063 3300005355 Bacteria 2324
121 Ga0070671_100127233 3300005355 Bacteria 2145
122 Ga0070671_100149462 3300005355 Bacteria 1972
123 Ga0070671_100149651 3300005355 Bacteria 1971
124 Ga0070671_100356590 3300005355 Bacteria 1248
125 Ga0070671_100399669 3300005355 Bacteria 1175
126 Ga0070671_100576002 3300005355 Bacteria 972
127 Ga0070671_100828113 3300005355 Bacteria 806
128 Ga0070671_100953509 3300005355 Bacteria 750
129 Ga0070674_100021666 3300005356 Bacteria 4132
130 Ga0070674_100025179 3300005356 Bacteria 3871
131 Ga0070674_100056900 3300005356 Bacteria 2712
132 Ga0070674_100106081 3300005356 Bacteria 2055
133 Ga0070674_100344550 3300005356 Bacteria 1201
134 Ga0070674_100360123 3300005356 Bacteria 1177
135 Ga0070674_100409044 3300005356 Bacteria 1110
136 Ga0070674_100699246 3300005356 Bacteria 866
137 Ga0070674_100754421 3300005356 Bacteria 836
138 Ga0070673_100015730 3300005364 Bacteria 5325
139 Ga0070673_100018599 3300005364 Bacteria 4968
140 Ga0070673_100060946 3300005364 Bacteria 2992
141 Ga0070673_100178070 3300005364 Bacteria 1818
142 Ga0070673_100332085 3300005364 Bacteria 1345
143 Ga0070673_100531550 3300005364 Bacteria 1066
144 Ga0070673_101378627 3300005364 Bacteria 663
145 Ga0070673_101534675 3300005364 Bacteria 629
146 Ga0070688_100022065 3300005365 Bacteria 3725
147 Ga0070688_100677187 3300005365 Bacteria 797
148 Ga0070659_100015739 3300005366 Bacteria 5667
149 Ga0070659_100413528 3300005366 Bacteria 1140
150 Ga0070667_100000717 3300005367 Bacteria 31904
151 Ga0070667_100020471 3300005367 Bacteria 5492
152 Ga0070667_100040308 3300005367 Bacteria 3916
153 Ga0070667_100047648 3300005367 Bacteria 3606
154 Ga0070667_100136440 3300005367 Bacteria 2145
155 Ga0070667_100294009 3300005367 Bacteria 1461
156 Ga0070667_100473233 3300005367 Bacteria 1146
157 Ga0070667_100500459 3300005367 Bacteria 1114
158 Ga0070667_100617028 3300005367 Bacteria 1000
159 Ga0070667_100778854 3300005367 Bacteria 887
160 Ga0070667_100925990 3300005367 Bacteria 812
161 Ga0070667_101808450 3300005367 Bacteria 575
162 Ga0070701_10017392 3300005438 Bacteria 3359
163 Ga0070701_10312485 3300005438 Bacteria 970
164 Ga0070705_100069878 3300005440 Bacteria 2119
165 Ga0070700_100016961 3300005441 Bacteria 4157
166 Ga0070700_100171484 3300005441 Bacteria 1503
167 Ga0070700_100321824 3300005441 Bacteria 1136
168 Ga0070700_100825434 3300005441 Bacteria 749
169 Ga0070694_100980592 3300005444 Unclassified 701
170 Ga0070663_100029864 3300005455 Bacteria 3729
171 Ga0070663_100051857 3300005455 Bacteria 2924
172 Ga0070663_100075352 3300005455 Bacteria 2466
173 Ga0070663_100115035 3300005455 Bacteria 2026
174 Ga0070663_100405724 3300005455 Bacteria 1115
175 Ga0070663_100786696 3300005455 Bacteria 815
176 Ga0070663_101170490 3300005455 Bacteria 675
177 Ga0070663_101779341 3300005455 Bacteria 552
178 Ga0070678_100000448 3300005456 Bacteria 19555
179 Ga0070678_100020232 3300005456 Bacteria 4362
180 Ga0070678_100030703 3300005456 Bacteria 3697
181 Ga0070678_100031948 3300005456 Bacteria 3637
182 Ga0070678_100035584 3300005456 Bacteria 3478
183 Ga0070678_100080337 3300005456 Bacteria 2469
184 Ga0070678_100090623 3300005456 Bacteria 2344
185 Ga0070678_100090806 3300005456 Bacteria 2342
186 Ga0070678_100235734 3300005456 Bacteria 1527
187 Ga0070678_100284293 3300005456 Bacteria 1400
188 Ga0070678_100342797 3300005456 Bacteria 1282
189 Ga0070678_100669270 3300005456 Bacteria 933
190 Ga0070678_100767410 3300005456 Bacteria 873
191 Ga0070678_101141392 3300005456 Bacteria 721
192 Ga0070662_100012294 3300005457 Bacteria 5672
193 Ga0070662_100015058 3300005457 Bacteria 5173
194 Ga0070662_100102722 3300005457 Bacteria 2166
195 Ga0070662_100182686 3300005457 Bacteria 1654
196 Ga0070662_100269020 3300005457 Bacteria 1375
197 Ga0070681_10083766 3300005458 Bacteria 3142
198 Ga0068867_100006159 3300005459 Bacteria 8493
199 Ga0068867_100046038 3300005459 Bacteria 3202
200 Ga0068867_100073666 3300005459 Bacteria 2557
201 Ga0068867_100079799 3300005459 Bacteria 2463
202 Ga0068867_100084084 3300005459 Bacteria 2403
203 Ga0068867_100139378 3300005459 Bacteria 1894
204 Ga0068867_100278676 3300005459 Bacteria 1370
205 Ga0068867_100348193 3300005459 Bacteria 1235
206 Ga0068867_100909011 3300005459 Bacteria 793
207 Ga0068867_100929203 3300005459 Bacteria 784
208 Ga0070685_10023265 3300005466 Bacteria 3390
209 Ga0070685_10337387 3300005466 Bacteria 1027
210 Ga0070685_10711501 3300005466 Bacteria 733
211 Ga0070684_100078149 3300005535 Bacteria 2923
212 Ga0070684_100309877 3300005535 Bacteria 1449
213 Ga0068853_100142534 3300005539 Bacteria 2152
214 Ga0068853_100201664 3300005539 Bacteria 1811
215 Ga0068853_100322190 3300005539 Bacteria 1433
216 Ga0068853_100329870 3300005539 Bacteria 1416
217 Ga0068853_100378529 3300005539 Bacteria 1321
218 Ga0068853_100412424 3300005539 Bacteria 1266
219 Ga0070672_100006399 3300005543 Bacteria 7914
220 Ga0070672_100013828 3300005543 Bacteria 5707
221 Ga0070672_100014571 3300005543 Bacteria 5574
222 Ga0070672_100021293 3300005543 Bacteria 4742
223 Ga0070672_100024856 3300005543 Bacteria 4434
224 Ga0070672_100028103 3300005543 Bacteria 4204
225 Ga0070672_100044528 3300005543 Bacteria 3428
226 Ga0070672_100057207 3300005543 Bacteria 3060
227 Ga0070672_100062761 3300005543 Bacteria 2933
228 Ga0070672_100075317 3300005543 Bacteria 2694
229 Ga0070672_100104276 3300005543 Bacteria 2304
230 Ga0070672_100156825 3300005543 Bacteria 1886
231 Ga0070672_100593715 3300005543 Bacteria 964
232 Ga0070672_100923589 3300005543 Bacteria 771
233 Ga0070672_100949393 3300005543 Bacteria 761
234 Ga0070686_100080563 3300005544 Bacteria 2155
235 Ga0070686_100425191 3300005544 Bacteria 1016
236 Ga0070696_100760376 3300005546 Bacteria 795
237 Ga0070693_100055055 3300005547 Bacteria 2290
238 Ga0070693_101180317 3300005547 Unclassified 587
239 Ga0070665_100012487 3300005548 Bacteria 8561
240 Ga0070665_100158931 3300005548 Bacteria 2261
241 Ga0070665_100162771 3300005548 Bacteria 2233
242 Ga0070665_100721442 3300005548 Bacteria 1010
243 Ga0070665_101527928 3300005548 Bacteria 676
244 Ga0070665_102325989 3300005548 Bacteria 539
245 Ga0068855_100145744 3300005563 Bacteria 2696
246 Ga0070664_100025096 3300005564 Bacteria 4938
247 Ga0070664_100036108 3300005564 Bacteria 4151
248 Ga0070664_100039474 3300005564 Bacteria 3978
249 Ga0070664_100049889 3300005564 Bacteria 3540
250 Ga0070664_100532104 3300005564 Bacteria 1086
251 Ga0070664_100854606 3300005564 Bacteria 852
252 Ga0070664_100936976 3300005564 Bacteria 813
253 Ga0068857_100002093 3300005577 Bacteria 16222
254 Ga0068857_100028766 3300005577 Bacteria 4903
255 Ga0068857_100071116 3300005577 Bacteria 3100
256 Ga0068857_100072190 3300005577 Bacteria 3076
257 Ga0068857_100428773 3300005577 Bacteria 1234
258 Ga0068854_100113769 3300005578 Bacteria 2044
259 Ga0068854_100196599 3300005578 Bacteria 1583
260 Ga0068854_100442716 3300005578 Bacteria 1083
261 Ga0068854_100672901 3300005578 Bacteria 891
262 Ga0068856_100019767 3300005614 Bacteria 6536
263 Ga0068856_100380810 3300005614 Bacteria 1430
264 Ga0070702_100049400 3300005615 Bacteria 2399
265 Ga0070702_100282711 3300005615 Bacteria 1140
266 Ga0070702_100459403 3300005615 Bacteria 926
267 Ga0068852_100004459 3300005616 Bacteria 9897
268 Ga0068852_100046987 3300005616 Bacteria 3681
269 Ga0068852_100063222 3300005616 Bacteria 3222
270 Ga0068852_100135722 3300005616 Bacteria 2271
271 Ga0068852_100191456 3300005616 Bacteria 1930
272 Ga0068852_100294322 3300005616 Bacteria 1569
273 Ga0068852_100853026 3300005616 Bacteria 926
274 Ga0068859_100002411 3300005617 Bacteria 19038
275 Ga0068859_100004263 3300005617 Bacteria 14605
276 Ga0068859_100073622 3300005617 Bacteria 3454
277 Ga0068859_100115296 3300005617 Bacteria 2751
278 Ga0068859_100195405 3300005617 Bacteria 2107
279 Ga0068859_100218262 3300005617 Bacteria 1994
280 Ga0068859_100375867 3300005617 Bacteria 1516
281 Ga0068859_100560248 3300005617 Bacteria 1237
282 Ga0068864_100001390 3300005618 Bacteria 20058
283 Ga0068864_100004956 3300005618 Bacteria 10912
284 Ga0068864_100013391 3300005618 Bacteria 6797
285 Ga0068864_100081171 3300005618 Bacteria 2842
286 Ga0068864_100097227 3300005618 Bacteria 2606
287 Ga0068864_100120290 3300005618 Bacteria 2347
288 Ga0068864_100205660 3300005618 Bacteria 1810
289 Ga0068864_100803536 3300005618 Bacteria 924
290 Ga0068864_100817731 3300005618 Bacteria 917
291 Ga0068864_101289773 3300005618 Bacteria 730
292 Ga0068866_10004138 3300005718 Bacteria 5948
293 Ga0068866_10164465 3300005718 Bacteria 1297
294 Ga0068866_10771539 3300005718 Bacteria 666
295 Ga0068861_100001956 3300005719 Bacteria 13287
296 Ga0068861_100077438 3300005719 Bacteria 2594
297 Ga0068861_100145440 3300005719 Bacteria 1940
298 Ga0068861_100234185 3300005719 Bacteria 1559
299 Ga0068861_101298827 3300005719 Unclassified 707
300 Ga0068851_10051328 3300005834 Bacteria 2095
301 Ga0068851_10074816 3300005834 Bacteria 1759
302 Ga0068851_10115413 3300005834 Bacteria 1438
303 Ga0068851_10123494 3300005834 Bacteria 1394
304 Ga0068851_10145857 3300005834 Bacteria 1290
305 Ga0068851_10210522 3300005834 Bacteria 1088
306 Ga0068851_10226347 3300005834 Bacteria 1053
307 Ga0068851_10427656 3300005834 Bacteria 783
308 Ga0068870_10004955 3300005840 Bacteria 5770
309 Ga0068870_10054392 3300005840 Bacteria 2129
310 Ga0068870_10120527 3300005840 Bacteria 1510
311 Ga0068863_100008219 3300005841 Bacteria 10197
312 Ga0068863_100014500 3300005841 Bacteria 7590
313 Ga0068863_100020573 3300005841 Bacteria 6307
314 Ga0068863_100030547 3300005841 Bacteria 5144
315 Ga0068863_100035713 3300005841 Bacteria 4733
316 Ga0068863_100069953 3300005841 Bacteria 3318
317 Ga0068863_100263218 3300005841 Bacteria 1668
318 Ga0068863_100298479 3300005841 Bacteria 1562
319 Ga0068863_100495669 3300005841 Bacteria 1202
320 Ga0068863_100747884 3300005841 Bacteria 973
321 Ga0068863_101222455 3300005841 Bacteria 757
322 Ga0068863_101322153 3300005841 Bacteria 728
323 Ga0068858_100001430 3300005842 Bacteria 24550
324 Ga0068858_100003528 3300005842 Bacteria 15489
325 Ga0068858_100008761 3300005842 Bacteria 9705
326 Ga0068858_100009455 3300005842 Bacteria 9297
327 Ga0068858_100178656 3300005842 Bacteria 2003
328 Ga0068858_100471776 3300005842 Bacteria 1211
329 Ga0068858_100592031 3300005842 Bacteria 1075
330 Ga0068858_101362709 3300005842 Bacteria 698
331 Ga0068860_100004964 3300005843 Bacteria 13559
332 Ga0068860_100008639 3300005843 Bacteria 10152
333 Ga0068860_100027092 3300005843 Bacteria 5521
334 Ga0068860_100058219 3300005843 Bacteria 3673
335 Ga0068860_100138768 3300005843 Bacteria 2335
336 Ga0068860_100207486 3300005843 Bacteria 1900
337 Ga0068860_100952506 3300005843 Bacteria 875
338 Ga0068860_101258139 3300005843 Bacteria 760
339 Ga0068862_100013644 3300005844 Bacteria 6727
340 Ga0068862_100032313 3300005844 Bacteria 4421
341 Ga0068862_100044056 3300005844 Bacteria 3806
342 Ga0068862_100080012 3300005844 Bacteria 2833
343 Ga0068862_100091061 3300005844 Bacteria 2655
344 Ga0068862_100125742 3300005844 Bacteria 2263
345 Ga0068862_100933812 3300005844 Bacteria 855
346 Ga0075366_10053172 3300006195 Bacteria 2406
347 Ga0097621_100020220 3300006237 Bacteria 5128
348 Ga0097621_100050413 3300006237 Bacteria 3385
349 Ga0097621_100068707 3300006237 Bacteria 2923
350 Ga0097621_100102403 3300006237 Bacteria 2410
351 Ga0097621_100164487 3300006237 Bacteria 1909
352 Ga0097621_100415981 3300006237 Bacteria 1206
353 Ga0097621_100443213 3300006237 Bacteria 1169
354 Ga0097621_100589121 3300006237 Bacteria 1015
355 Ga0068871_100000813 3300006358 Bacteria 20955
356 Ga0068871_100050459 3300006358 Bacteria 3365
357 Ga0068871_100057770 3300006358 Bacteria 3157
358 Ga0068871_100062592 3300006358 Bacteria 3041
359 Ga0068871_100127811 3300006358 Bacteria 2152
360 Ga0068871_100205636 3300006358 Bacteria 1701
361 Ga0068871_100974037 3300006358 Bacteria 789
362 Ga0075434_100264493 3300006871 Bacteria 1739
363 Ga0068865_100001369 3300006881 Bacteria 14179
364 Ga0068865_100068242 3300006881 Bacteria 2513
365 Ga0068865_100078860 3300006881 Bacteria 2357
366 Ga0068865_100174027 3300006881 Bacteria 1653
367 Ga0068865_100432115 3300006881 Bacteria 1085
368 Ga0068865_100626781 3300006881 Bacteria 912
369 Ga0068865_100647625 3300006881 Bacteria 898
370 Ga0097620_100002411 3300006931 Bacteria 19038
371 Ga0097620_100004263 3300006931 Bacteria 14605
372 Ga0097620_100073621 3300006931 Bacteria 3454
373 Ga0097620_100115298 3300006931 Bacteria 2751
374 Ga0097620_100195411 3300006931 Bacteria 2107
375 Ga0097620_100218252 3300006931 Bacteria 1994
376 Ga0097620_100375859 3300006931 Bacteria 1516
377 Ga0097620_100560254 3300006931 Bacteria 1237
378 Ga0105240_10249210 3300009093 Bacteria 2055
379 Ga0111539_10009075 3300009094 Bacteria 12589
380 Ga0111539_10041362 3300009094 Bacteria 5541
381 Ga0111539_10314911 3300009094 Bacteria 1821
382 Ga0111539_10650099 3300009094 Bacteria 1228
383 Ga0105245_10285136 3300009098 Bacteria 1616
384 Ga0105245_10344241 3300009098 Bacteria 1475
385 Ga0105245_10380721 3300009098 Bacteria 1405
386 Ga0105245_10825668 3300009098 Bacteria 966
387 Ga0105245_11178390 3300009098 Bacteria 814
388 Ga0105247_10122160 3300009101 Bacteria 1689
389 Ga0105243_10019318 3300009148 Bacteria 5165
390 Ga0105243_10075847 3300009148 Bacteria 2730
391 Ga0105243_10076375 3300009148 Bacteria 2722
392 Ga0105243_10161352 3300009148 Bacteria 1933
393 Ga0105241_10533868 3300009174 Bacteria 1051
394 Ga0105241_11513017 3300009174 Bacteria 646
395 Ga0105242_10115581 3300009176 Bacteria 2294
396 Ga0105248_10004747 3300009177 Bacteria 15046
397 Ga0105248_10010148 3300009177 Bacteria 10374
398 Ga0105248_10056024 3300009177 Bacteria 4422
399 Ga0105248_10088897 3300009177 Bacteria 3477
400 Ga0105248_10105560 3300009177 Bacteria 3176
401 Ga0105248_10158445 3300009177 Bacteria 2554
402 Ga0105248_10177653 3300009177 Bacteria 2399
403 Ga0105248_10541380 3300009177 Bacteria 1313
404 Ga0105248_10609372 3300009177 Bacteria 1232
405 Ga0105237_10172313 3300009545 Bacteria 2164
406 Ga0105237_10507527 3300009545 Bacteria 1213
407 Ga0105249_10127804 3300009553 Bacteria 2422
408 Ga0105249_10342421 3300009553 Bacteria 1512
409 Ga0105249_10500761 3300009553 Bacteria 1260
410 Ga0105249_10513303 3300009553 Bacteria 1245
411 Ga0105239_10158413 3300010375 Bacteria 2529
412 Ga0105239_10447911 3300010375 Bacteria 1464
413 Ga0105239_11069577 3300010375 Bacteria 928
414 Ga0105246_10319171 3300011119 Bacteria 1262
415 Ga0105246_11080888 3300011119 Bacteria 731
416 Ga0157323_1004431 3300012495 Bacteria 897
417 Ga0157373_10121040 3300013100 Bacteria 1839
418 Ga0157371_10411347 3300013102 Bacteria 991
419 Ga0157369_10058543 3300013105 Bacteria 4156
420 Ga0157374_10013081 3300013296 Bacteria 7238
421 Ga0157374_10055448 3300013296 Bacteria 3699
422 Ga0157374_10154539 3300013296 Bacteria 2232
423 Ga0157374_10268032 3300013296 Bacteria 1683
424 Ga0157374_10346403 3300013296 Bacteria 1476
425 Ga0157374_10525563 3300013296 Bacteria 1189
426 Ga0157378_10113572 3300013297 Bacteria 2487
427 Ga0157378_10154450 3300013297 Bacteria 2141
428 Ga0157378_10192853 3300013297 Bacteria 1923
429 Ga0157378_10359779 3300013297 Bacteria 1424
430 Ga0157378_10920372 3300013297 Bacteria 906
431 Ga0157378_11281057 3300013297 Bacteria 774
432 Ga0163162_10024366 3300013306 Bacteria 5971
433 Ga0163162_10036721 3300013306 Bacteria 4885
434 Ga0163162_10037039 3300013306 Bacteria 4865
435 Ga0163162_10077834 3300013306 Bacteria 3381
436 Ga0163162_10586414 3300013306 Bacteria 1241
437 Ga0163162_10620143 3300013306 Bacteria 1207
438 Ga0163162_10778228 3300013306 Bacteria 1075
439 Ga0163162_11538501 3300013306 Bacteria 758
440 Ga0163162_12312881 3300013306 Bacteria 617
441 Ga0157372_10005474 3300013307 Bacteria 13491
442 Ga0157372_10388904 3300013307 Bacteria 1625
443 Ga0157372_11707567 3300013307 Bacteria 724
444 Ga0157375_10006101 3300013308 Bacteria 10506
445 Ga0157375_10046049 3300013308 Bacteria 4250
446 Ga0157375_10198089 3300013308 Bacteria 2164
447 Ga0157375_10246080 3300013308 Bacteria 1948
448 Ga0157375_10308611 3300013308 Bacteria 1746
449 Ga0157375_10314225 3300013308 Bacteria 1731
450 Ga0157375_10557014 3300013308 Bacteria 1308
451 Ga0157375_10661816 3300013308 Bacteria 1200
452 Ga0157375_11336229 3300013308 Bacteria 843
453 Ga0163163_10017919 3300014325 Bacteria 6615
454 Ga0163163_10047727 3300014325 Bacteria 4210
455 Ga0163163_10152450 3300014325 Bacteria 2355
456 Ga0163163_10336671 3300014325 Bacteria 1564
457 Ga0163163_10481744 3300014325 Bacteria 1302
458 Ga0157380_10104096 3300014326 Bacteria 2370
459 Ga0157380_10130702 3300014326 Bacteria 2142
460 Ga0157380_10491807 3300014326 Bacteria 1189
461 Ga0157380_10543199 3300014326 Bacteria 1138
462 Ga0157380_11965875 3300014326 Bacteria 646
463 Ga0157377_10026099 3300014745 Bacteria 3123
464 Ga0157377_10139827 3300014745 Bacteria 1487
465 Ga0157377_10377117 3300014745 Bacteria 959
466 Ga0157379_10001286 3300014968 Bacteria 20436
467 Ga0157379_10006766 3300014968 Bacteria 9908
468 Ga0157379_10008868 3300014968 Bacteria 8767
469 Ga0157379_10067397 3300014968 Bacteria 3199
470 Ga0157379_10323077 3300014968 Bacteria 1409
471 Ga0157379_10476665 3300014968 Bacteria 1154
472 Ga0157379_10717820 3300014968 Bacteria 939
473 Ga0157379_10873492 3300014968 Bacteria 852
474 Ga0157376_10005091 3300014969 Bacteria 9158
475 Ga0157376_10011918 3300014969 Bacteria 6430
476 Ga0157376_10113417 3300014969 Bacteria 2390
477 Ga0157376_10195711 3300014969 Bacteria 1857
478 Ga0157376_10202209 3300014969 Bacteria 1828
479 Ga0157376_10311350 3300014969 Bacteria 1494
480 Ga0157376_10673811 3300014969 Bacteria 1037
481 Ga0163161_10032859 3300017792 Bacteria 3706
482 Ga0163161_10052316 3300017792 Bacteria 2960
483 Ga0163161_10059517 3300017792 Bacteria 2778
484 Ga0163161_10126172 3300017792 Bacteria 1927
485 Ga0163161_10129907 3300017792 Bacteria 1899
486 Ga0163161_10997877 3300017792 Bacteria 715
487 Ga0207673_1000306 3300025290 Bacteria 4954
488 Ga0207697_10004410 3300025315 Bacteria 6728
489 Ga0207697_10006696 3300025315 Bacteria 5192
490 Ga0207697_10007949 3300025315 Bacteria 4687
491 Ga0207697_10023476 3300025315 Bacteria 2525
492 Ga0207697_10043552 3300025315 Bacteria 1846
493 Ga0207656_10028436 3300025321 Bacteria 2295
494 Ga0207656_10084064 3300025321 Bacteria 1435
495 Ga0207656_10088766 3300025321 Bacteria 1400
496 Ga0207656_10149513 3300025321 Bacteria 1105
497 Ga0207656_10278231 3300025321 Bacteria 825
498 Ga0207656_10279354 3300025321 Bacteria 823
499 Ga0207656_10314432 3300025321 Bacteria 777
500 Ga0207682_10002330 3300025893 Bacteria 8558
501 Ga0207682_10003599 3300025893 Bacteria 6695
502 Ga0207682_10023140 3300025893 Bacteria 2452
503 Ga0207682_10027820 3300025893 Bacteria 2253
504 Ga0207682_10061388 3300025893 Bacteria 1573
505 Ga0207642_10015761 3300025899 Bacteria 2827
506 Ga0207642_10164685 3300025899 Bacteria 1194
507 Ga0207642_10606593 3300025899 Bacteria 682
508 Ga0207710_10023078 3300025900 Bacteria 2672
509 Ga0207688_10049724 3300025901 Bacteria 2344
510 Ga0207688_10400808 3300025901 Bacteria 851
511 Ga0207688_10401533 3300025901 Bacteria 850
512 Ga0207680_10000460 3300025903 Bacteria 19207
513 Ga0207680_10003375 3300025903 Bacteria 7519
514 Ga0207680_10007709 3300025903 Bacteria 5262
515 Ga0207680_10023237 3300025903 Bacteria 3382
516 Ga0207680_10154774 3300025903 Bacteria 1532
517 Ga0207680_10378210 3300025903 Bacteria 998
518 Ga0207680_10477983 3300025903 Bacteria 886
519 Ga0207685_10011257 3300025905 Bacteria 2681
520 Ga0207645_10000286 3300025907 Bacteria 42134
521 Ga0207645_10007203 3300025907 Bacteria 7883
522 Ga0207645_10017166 3300025907 Bacteria 4779
523 Ga0207645_10075750 3300025907 Bacteria 2154
524 Ga0207645_10084974 3300025907 Bacteria 2031
525 Ga0207645_10114941 3300025907 Bacteria 1744
526 Ga0207645_10139560 3300025907 Bacteria 1579
527 Ga0207645_10179633 3300025907 Bacteria 1388
528 Ga0207645_10680995 3300025907 Bacteria 699
529 Ga0207645_10732150 3300025907 Bacteria 672
530 Ga0207643_10001339 3300025908 Bacteria 14249
531 Ga0207643_10003357 3300025908 Bacteria 8625
532 Ga0207643_10102273 3300025908 Bacteria 1681
533 Ga0207643_10300344 3300025908 Bacteria 999
534 Ga0207643_10641336 3300025908 Bacteria 685
535 Ga0207705_10023604 3300025909 Bacteria 4387
536 Ga0207654_10292454 3300025911 Bacteria 1105
537 Ga0207707_10143522 3300025912 Bacteria 2087
538 Ga0207695_10370610 3300025913 Bacteria 1318
539 Ga0207671_10543420 3300025914 Bacteria 926
540 Ga0207662_10066328 3300025918 Bacteria 2175
541 Ga0207662_10070276 3300025918 Bacteria 2118
542 Ga0207657_10022097 3300025919 Bacteria 5970
543 Ga0207657_10104684 3300025919 Bacteria 2343
544 Ga0207657_10243866 3300025919 Bacteria 1434
545 Ga0207657_10421905 3300025919 Bacteria 1048
546 Ga0207657_10738146 3300025919 Bacteria 763
547 Ga0207649_10003717 3300025920 Bacteria 8319
548 Ga0207649_10022991 3300025920 Bacteria 3606
549 Ga0207649_10143271 3300025920 Bacteria 1638
550 Ga0207649_10196353 3300025920 Bacteria 1422
551 Ga0207649_10309630 3300025920 Bacteria 1157
552 Ga0207681_10003352 3300025923 Bacteria 10030
553 Ga0207681_10004963 3300025923 Bacteria 8174
554 Ga0207681_10008968 3300025923 Bacteria 6108
555 Ga0207681_10022382 3300025923 Bacteria 4031
556 Ga0207681_10190303 3300025923 Bacteria 1569
557 Ga0207681_10237011 3300025923 Bacteria 1418
558 Ga0207681_10250598 3300025923 Bacteria 1382
559 Ga0207681_10331834 3300025923 Bacteria 1212
560 Ga0207681_10397548 3300025923 Bacteria 1112
561 Ga0207681_10796853 3300025923 Bacteria 789
562 Ga0207694_10083149 3300025924 Bacteria 2517
563 Ga0207694_10177423 3300025924 Bacteria 1726
564 Ga0207650_10000961 3300025925 Bacteria 21689
565 Ga0207650_10009622 3300025925 Bacteria 6609
566 Ga0207650_10026267 3300025925 Bacteria 4152
567 Ga0207650_10033258 3300025925 Bacteria 3733
568 Ga0207650_10046291 3300025925 Bacteria 3203
569 Ga0207650_10050267 3300025925 Bacteria 3082
570 Ga0207650_10163516 3300025925 Bacteria 1765
571 Ga0207650_10696807 3300025925 Bacteria 858
572 Ga0207659_10000564 3300025926 Bacteria 22269
573 Ga0207659_10000743 3300025926 Bacteria 19294
574 Ga0207659_10031675 3300025926 Bacteria 3623
575 Ga0207659_10034469 3300025926 Bacteria 3491
576 Ga0207659_10087961 3300025926 Bacteria 2313
577 Ga0207659_10122289 3300025926 Bacteria 1996
578 Ga0207659_10176619 3300025926 Bacteria 1688
579 Ga0207659_10380191 3300025926 Bacteria 1177
580 Ga0207659_10660106 3300025926 Bacteria 894
581 Ga0207659_10665132 3300025926 Bacteria 891
582 Ga0207659_11268593 3300025926 Bacteria 633
583 Ga0207687_10188128 3300025927 Bacteria 1605
584 Ga0207687_10242917 3300025927 Bacteria 1428
585 Ga0207687_10257728 3300025927 Bacteria 1389
586 Ga0207687_10938204 3300025927 Bacteria 741
587 Ga0207644_10002908 3300025931 Bacteria 11033
588 Ga0207644_10004624 3300025931 Bacteria 8954
589 Ga0207644_10021809 3300025931 Bacteria 4367
590 Ga0207644_10115831 3300025931 Bacteria 2033
591 Ga0207644_10138652 3300025931 Bacteria 1870
592 Ga0207644_10151963 3300025931 Bacteria 1792
593 Ga0207644_10305927 3300025931 Bacteria 1282
594 Ga0207644_10365809 3300025931 Bacteria 1174
595 Ga0207644_10455459 3300025931 Bacteria 1051
596 Ga0207644_10804180 3300025931 Bacteria 786
597 Ga0207644_10927893 3300025931 Bacteria 730
598 Ga0207690_10018444 3300025932 Bacteria 4280
599 Ga0207690_10197465 3300025932 Bacteria 1525
600 Ga0207690_10418420 3300025932 Bacteria 1072
601 Ga0207706_10017710 3300025933 Bacteria 6417
602 Ga0207706_10032610 3300025933 Bacteria 4638
603 Ga0207706_10071392 3300025933 Bacteria 3053
604 Ga0207706_10089891 3300025933 Bacteria 2700
605 Ga0207706_10112140 3300025933 Bacteria 2399
606 Ga0207706_10430568 3300025933 Bacteria 1142
607 Ga0207686_10011394 3300025934 Bacteria 4869
608 Ga0207709_10025665 3300025935 Bacteria 3375
609 Ga0207709_10044981 3300025935 Bacteria 2671
610 Ga0207709_10373945 3300025935 Bacteria 1082
611 Ga0207709_10519417 3300025935 Bacteria 932
612 Ga0207709_10858954 3300025935 Bacteria 736
613 Ga0207670_10010466 3300025936 Bacteria 5348
614 Ga0207670_10135451 3300025936 Bacteria 1810
615 Ga0207670_10165060 3300025936 Bacteria 1656
616 Ga0207670_10549245 3300025936 Bacteria 943
617 Ga0207669_10021886 3300025937 Bacteria 3385
618 Ga0207669_10085710 3300025937 Bacteria 2034
619 Ga0207669_10098616 3300025937 Bacteria 1924
620 Ga0207669_10106809 3300025937 Bacteria 1865
621 Ga0207669_10200026 3300025937 Bacteria 1449
622 Ga0207669_10390411 3300025937 Bacteria 1087
623 Ga0207704_10001991 3300025938 Bacteria 9158
624 Ga0207704_10118773 3300025938 Bacteria 1804
625 Ga0207704_10156370 3300025938 Bacteria 1617
626 Ga0207704_10264830 3300025938 Bacteria 1298
627 Ga0207704_10903634 3300025938 Bacteria 743
628 Ga0207704_11126483 3300025938 Bacteria 667
629 Ga0207691_10008331 3300025940 Bacteria 9957
630 Ga0207691_10009059 3300025940 Bacteria 9550
631 Ga0207691_10014823 3300025940 Bacteria 7428
632 Ga0207691_10024448 3300025940 Bacteria 5681
633 Ga0207691_10028760 3300025940 Bacteria 5202
634 Ga0207691_10046562 3300025940 Bacteria 3984
635 Ga0207691_10058847 3300025940 Bacteria 3495
636 Ga0207691_10061234 3300025940 Bacteria 3419
637 Ga0207691_10062707 3300025940 Bacteria 3372
638 Ga0207691_10079471 3300025940 Bacteria 2952
639 Ga0207691_10096539 3300025940 Bacteria 2642
640 Ga0207691_10177037 3300025940 Bacteria 1865
641 Ga0207691_10517348 3300025940 Bacteria 1013
642 Ga0207691_10859719 3300025940 Bacteria 760
643 Ga0207711_10004787 3300025941 Bacteria 11490
644 Ga0207711_10005414 3300025941 Bacteria 10793
645 Ga0207711_10090593 3300025941 Bacteria 2688
646 Ga0207711_10096225 3300025941 Bacteria 2613
647 Ga0207711_10134112 3300025941 Bacteria 2223
648 Ga0207711_10191264 3300025941 Bacteria 1865
649 Ga0207711_10364076 3300025941 Bacteria 1340
650 Ga0207689_10002442 3300025942 Bacteria 17314
651 Ga0207689_10029515 3300025942 Bacteria 4579
652 Ga0207689_10036183 3300025942 Bacteria 4099
653 Ga0207689_10074735 3300025942 Bacteria 2784
654 Ga0207689_10453005 3300025942 Bacteria 1073
655 Ga0207661_10049787 3300025944 Bacteria 3336
656 Ga0207661_10069230 3300025944 Bacteria 2876
657 Ga0207661_10458710 3300025944 Bacteria 1161
658 Ga0207679_10005455 3300025945 Bacteria 7969
659 Ga0207679_10007203 3300025945 Bacteria 7046
660 Ga0207679_10020838 3300025945 Bacteria 4432
661 Ga0207679_10220317 3300025945 Bacteria 1596
662 Ga0207679_10523777 3300025945 Bacteria 1060
663 Ga0207667_10128343 3300025949 Bacteria 2612
664 Ga0207651_10002272 3300025960 Bacteria 9128
665 Ga0207651_10002401 3300025960 Bacteria 8948
666 Ga0207651_10055716 3300025960 Bacteria 2717
667 Ga0207651_10189721 3300025960 Bacteria 1638
668 Ga0207651_10201556 3300025960 Bacteria 1595
669 Ga0207651_10387161 3300025960 Bacteria 1186
670 Ga0207651_10970849 3300025960 Bacteria 758
671 Ga0207651_11052162 3300025960 Bacteria 728
672 Ga0207712_10017100 3300025961 Bacteria 4705
673 Ga0207712_10141491 3300025961 Bacteria 1847
674 Ga0207712_10233701 3300025961 Bacteria 1477
675 Ga0207712_10353734 3300025961 Bacteria 1222
676 Ga0207712_10756014 3300025961 Bacteria 852
677 Ga0207668_10004025 3300025972 Bacteria 8647
678 Ga0207668_10005485 3300025972 Bacteria 7473
679 Ga0207668_10015882 3300025972 Bacteria 4687
680 Ga0207668_10039212 3300025972 Bacteria 3186
681 Ga0207668_10043019 3300025972 Bacteria 3062
682 Ga0207668_10056559 3300025972 Bacteria 2732
683 Ga0207668_10096506 3300025972 Bacteria 2185
684 Ga0207668_10349179 3300025972 Bacteria 1236
685 Ga0207668_10459440 3300025972 Bacteria 1088
686 Ga0207668_10558618 3300025972 Bacteria 992
687 Ga0207668_10762827 3300025972 Bacteria 854
688 Ga0207668_10861923 3300025972 Bacteria 805
689 Ga0207668_11589749 3300025972 Bacteria 590
690 Ga0207640_10279474 3300025981 Bacteria 1311
691 Ga0207640_10919953 3300025981 Bacteria 765
692 Ga0207658_10003356 3300025986 Bacteria 11353
693 Ga0207658_10010727 3300025986 Bacteria 6229
694 Ga0207658_10013975 3300025986 Bacteria 5494
695 Ga0207658_10015576 3300025986 Bacteria 5216
696 Ga0207658_10017996 3300025986 Bacteria 4871
697 Ga0207658_10232399 3300025986 Bacteria 1557
698 Ga0207658_10998032 3300025986 Bacteria 764
699 Ga0207677_10009613 3300026023 Bacteria 5444
700 Ga0207677_10143938 3300026023 Bacteria 1829
701 Ga0207677_10265116 3300026023 Bacteria 1402
702 Ga0207677_10446199 3300026023 Bacteria 1108
703 Ga0207677_10614497 3300026023 Bacteria 955
704 Ga0207677_10692142 3300026023 Bacteria 904
705 Ga0207677_11322918 3300026023 Bacteria 662
706 Ga0207703_10000910 3300026035 Bacteria 28872
707 Ga0207703_10004196 3300026035 Bacteria 11883
708 Ga0207703_10012497 3300026035 Bacteria 6619
709 Ga0207703_10018346 3300026035 Bacteria 5463
710 Ga0207703_10118780 3300026035 Bacteria 2267
711 Ga0207703_11199358 3300026035 Bacteria 730
712 Ga0207639_10031127 3300026041 Bacteria 3919
713 Ga0207639_10062036 3300026041 Bacteria 2889
714 Ga0207639_10105498 3300026041 Bacteria 2286
715 Ga0207678_10024841 3300026067 Bacteria 5231
716 Ga0207678_10159322 3300026067 Bacteria 1928
717 Ga0207678_10168410 3300026067 Bacteria 1871
718 Ga0207678_10231752 3300026067 Bacteria 1581
719 Ga0207678_10354467 3300026067 Bacteria 1266
720 Ga0207678_10410923 3300026067 Bacteria 1173
721 Ga0207708_10044356 3300026075 Bacteria 3388
722 Ga0207708_10102888 3300026075 Bacteria 2212
723 Ga0207708_10216981 3300026075 Bacteria 1531
724 Ga0207708_10770909 3300026075 Bacteria 826
725 Ga0207708_11232689 3300026075 Bacteria 654
726 Ga0207702_10014997 3300026078 Bacteria 6427
727 Ga0207702_10461382 3300026078 Bacteria 1234
728 Ga0207702_10554051 3300026078 Bacteria 1125
729 Ga0207641_10003314 3300026088 Bacteria 14327
730 Ga0207641_10019913 3300026088 Bacteria 5507
731 Ga0207641_10021303 3300026088 Bacteria 5329
732 Ga0207641_10049829 3300026088 Bacteria 3540
733 Ga0207641_10274816 3300026088 Bacteria 1582
734 Ga0207641_10348692 3300026088 Bacteria 1410
735 Ga0207641_10914816 3300026088 Bacteria 871
736 Ga0207641_11138387 3300026088 Bacteria 779
737 Ga0207641_11215544 3300026088 Bacteria 753
738 Ga0207648_10009351 3300026089 Bacteria 9392
739 Ga0207648_10014197 3300026089 Bacteria 7367
740 Ga0207648_10031163 3300026089 Bacteria 4714
741 Ga0207648_10043263 3300026089 Bacteria 3953
742 Ga0207648_10054851 3300026089 Bacteria 3480
743 Ga0207648_10089939 3300026089 Bacteria 2682
744 Ga0207648_10091081 3300026089 Bacteria 2665
745 Ga0207648_10102483 3300026089 Bacteria 2509
746 Ga0207648_10433388 3300026089 Bacteria 1195
747 Ga0207648_11680659 3300026089 Bacteria 596
748 Ga0207676_10001427 3300026095 Bacteria 17753
749 Ga0207676_10003449 3300026095 Bacteria 11190
750 Ga0207676_10009320 3300026095 Bacteria 6985
751 Ga0207676_10021594 3300026095 Bacteria 4724
752 Ga0207676_10029533 3300026095 Bacteria 4106
753 Ga0207676_10075968 3300026095 Bacteria 2712
754 Ga0207676_10195265 3300026095 Bacteria 1784
755 Ga0207676_10198697 3300026095 Bacteria 1770
756 Ga0207676_10224089 3300026095 Bacteria 1676
757 Ga0207676_10535942 3300026095 Bacteria 1116
758 Ga0207676_10719883 3300026095 Bacteria 968
759 Ga0207674_10001341 3300026116 Bacteria 31867
760 Ga0207674_10038317 3300026116 Bacteria 4977
761 Ga0207674_10094814 3300026116 Bacteria 2970
762 Ga0207674_10175975 3300026116 Bacteria 2092
763 Ga0207674_11025622 3300026116 Bacteria 794
764 Ga0207675_100004202 3300026118 Bacteria 13935
765 Ga0207675_100045108 3300026118 Bacteria 4119
766 Ga0207675_100119683 3300026118 Bacteria 2491
767 Ga0207675_100122608 3300026118 Bacteria 2460
768 Ga0207675_100160923 3300026118 Bacteria 2141
769 Ga0207675_100240604 3300026118 Bacteria 1749
770 Ga0207675_100250401 3300026118 Bacteria 1714
771 Ga0207675_100765898 3300026118 Bacteria 977
772 Ga0207675_101051038 3300026118 Unclassified 833
773 Ga0207675_101949226 3300026118 Bacteria 605
774 Ga0207683_10025109 3300026121 Bacteria 5138
775 Ga0207683_10031708 3300026121 Bacteria 4588
776 Ga0207683_10031785 3300026121 Bacteria 4583
777 Ga0207683_10051903 3300026121 Bacteria 3593
778 Ga0207683_10103160 3300026121 Bacteria 2547
779 Ga0207683_10105238 3300026121 Bacteria 2522
780 Ga0207683_10265639 3300026121 Bacteria 1567
781 Ga0207683_10421026 3300026121 Bacteria 1230
782 Ga0207683_10471499 3300026121 Bacteria 1158
783 Ga0207683_11869521 3300026121 Bacteria 549
784 Ga0207698_10003666 3300026142 Bacteria 9276
785 Ga0207698_10036943 3300026142 Bacteria 3592
786 Ga0207698_10143593 3300026142 Bacteria 2060
787 Ga0207698_10291308 3300026142 Bacteria 1515
788 Ga0207698_10303660 3300026142 Bacteria 1487
789 Ga0207698_10312847 3300026142 Bacteria 1467
790 Ga0207698_10360985 3300026142 Bacteria 1376
791 Ga0207698_10386939 3300026142 Bacteria 1332
792 Ga0207698_10410485 3300026142 Bacteria 1297
793 Ga0207698_10930760 3300026142 Bacteria 877
794 Ga0207698_11310454 3300026142 Bacteria 739
795 Ga0207428_10023641 3300027907 Bacteria 5165
796 Ga0268266_10003452 3300028379 Bacteria 15763
797 Ga0268266_10014928 3300028379 Bacteria 6669
798 Ga0268266_10706948 3300028379 Bacteria 971
799 Ga0268266_11552798 3300028379 Bacteria 637
800 Ga0268266_11631230 3300028379 Bacteria 620
801 Ga0268265_10024121 3300028380 Bacteria 4298
802 Ga0268265_10066677 3300028380 Bacteria 2783
803 Ga0268265_10086503 3300028380 Bacteria 2491
804 Ga0268265_10222848 3300028380 Bacteria 1651
805 Ga0268265_10241093 3300028380 Bacteria 1595
806 Ga0268265_10242194 3300028380 Bacteria 1592
807 Ga0268265_10776590 3300028380 Bacteria 932
808 Ga0268265_11647218 3300028380 Bacteria 647
809 Ga0268264_10001527 3300028381 Bacteria 21548
810 Ga0268264_10018003 3300028381 Bacteria 5777
811 Ga0268264_10032659 3300028381 Bacteria 4271
812 Ga0268264_10037745 3300028381 Bacteria 3984
813 Ga0268264_10087949 3300028381 Bacteria 2672
814 Ga0268264_10093681 3300028381 Bacteria 2595
815 Ga0268264_10939559 3300028381 Unclassified 869
816 Ga0265330_10000832 3300031235 Bacteria 19375
817 Ga0265332_10000449 3300031238 Bacteria 28929
818 Ga0265328_10025110 3300031239 Bacteria 2246
819 Ga0265328_10043849 3300031239 Bacteria 1645
820 Ga0265325_10089238 3300031241 Bacteria 1522
821 Ga0265329_10013462 3300031242 Bacteria 2915
822 Ga0265340_10222683 3300031247 Bacteria 845
823 Ga0265331_10000571 3300031250 Bacteria 33044
824 Ga0265327_10017824 3300031251 Bacteria 4430
825 Ga0265316_10005569 3300031344 Bacteria 12209
826 Ga0316575_10001239 3300031665 Bacteria 8098
827 Ga0316579_10038128 3300031691 Bacteria 2221
828 Ga0265342_10044351 3300031712 Bacteria 2681
829 Ga0316576_10002389 3300031727 Bacteria 10672
830 Ga0316576_10003885 3300031727 Bacteria 8849
831 Ga0316578_10000412 3300031728 Bacteria 13969
832 Ga0307405_10019849 3300031731 Bacteria 3744
833 Ga0316577_10011949 3300031733 Bacteria 4718
834 Ga0307413_10440221 3300031824 Bacteria 1032
835 Ga0307412_10445511 3300031911 Bacteria 1065
836 Ga0307409_100042758 3300031995 Bacteria 3396
837 Ga0307409_101822509 3300031995 Bacteria 638
838 Ga0307416_100000751 3300032002 Bacteria 16970
839 Ga0316585_10037738 3300032137 Bacteria 1534
840 Ga0316580_10000473 3300032139 Bacteria 9284
841 Ga0373929_0130691 3300035085 Bacteria 658
842 Ga0373939_0021444 3300035114 Bacteria 1769
843 Ga0373954_0120767 3300035118 Bacteria 1272
844 Ga0373956_0119012 3300035119 Bacteria 1233
845 Ga0373957_0089427 3300035120 Bacteria 1223
846 Ga0373957_0204957 3300035120 Bacteria 823
847 Ga0373943_0429590 3300035170 Bacteria 765
848 Ga0373955_0082860 3300035172 Bacteria 1816
849 Ga0373955_0631059 3300035172 Unclassified 657
850 Ga0316574_0000327 3300035398 Bacteria 18235
851 Ga0316574_0005355 3300035398 Bacteria 6835
852 Ga0373935_0617998 3300035692 Bacteria 793
853 Ga0373935_1250145 3300035692 Bacteria 554
854 Ga0373927_0631194 3300035695 Bacteria 708
855 Ga0373927_0872956 3300035695 Bacteria 594
856 Ga0373933_0092801 3300035724 Bacteria 1865
857 Ga0373947_0257211 3300035725 Bacteria 1156
858 Ga0373937_0086585 3300036401 Bacteria 2899
859 Ga0373937_0183283 3300036401 Bacteria 1966
860 Ga0373937_0386645 3300036401 Bacteria 1327
861 Ga0316582_0166184 3300036647 Bacteria 1496
862 Ga0316584_0005424 3300036712 Bacteria 8557
863 Ga0316584_0102853 3300036712 Bacteria 2139
864 Ga0373925_0278897 3300037068 Bacteria 1346
865 Ga0373925_0924806 3300037068 Bacteria 719
866 Ga0436363_1254080 3300039450 Bacteria 717
867 Ga0451791_1228634 3300041451 Bacteria 983
868 Ga0451853_2088882 3300041512 Bacteria 770
869 Ga0451853_2171643 3300041512 Bacteria 2148
870 Ga0439441_026399 3300042001 Bacteria 1102
871 Ga0439450_005310 3300042008 Bacteria 2260
872 Ga0450892_006938 3300042130 Bacteria 949
873 Ga0439434_0085064 3300042435 Bacteria 1007
874 Ga0439464_0004547 3300042439 Bacteria 3554
875 Ga0439460_0010105 3300042461 Bacteria 2407
876 Ga0451577_0129940 3300042876 Bacteria 2259
877 Ga0453684_0036774 3300044712 Bacteria 6739
878 Ga0451576_0005175 3300045051 Bacteria 16499
879 Ga0495629_0490074 3300046459 Bacteria 830
880 Ga0495651_0127303 3300046462 Bacteria 1864
881 Ga0495651_0398068 3300046462 Bacteria 900
882 Ga0495653_0490089 3300046463 Bacteria 768
883 Ga0495580_0048179 3300046472 Bacteria 3019
884 Ga0495580_0254118 3300046472 Bacteria 1203
885 Ga0495664_0201108 3300046477 Bacteria 1207
886 Ga0495608_0717120 3300046511 Bacteria 594
887 Ga0495628_0275344 3300046516 Bacteria 1251
888 Ga0495644_0232045 3300046523 Bacteria 715
889 Ga0495652_0712050 3300046529 Bacteria 675
890 Ga0495586_0212235 3300046535 Bacteria 1099
891 Ga0495587_0111462 3300046536 Bacteria 1571
892 Ga0495598_0033284 3300046537 Bacteria 1462
893 Ga0495598_0238299 3300046537 Bacteria 670
894 Ga0495598_0460724 3300046537 Bacteria 504
895 Ga0495621_0022996 3300046539 Bacteria 2071
896 Ga0495621_0130430 3300046539 Bacteria 977
897 Ga0495621_0320817 3300046539 Unclassified 645
898 Ga0495645_0001597 3300046543 Bacteria 15335
899 Ga0495645_0076395 3300046543 Bacteria 2410
900 Ga0495667_0011969 3300046559 Bacteria 5879
901 Ga0495657_0432709 3300046675 Bacteria 772
902 Ga0495623_0011209 3300046679 Bacteria 5799
903 Ga0495646_0163728 3300046680 Bacteria 1230
904 Ga0495647_0085075 3300046681 Bacteria 1288
905 Ga0495658_0070598 3300046683 Bacteria 2027
906 Ga0495658_0095749 3300046683 Bacteria 1765
907 Ga0495658_0627259 3300046683 Bacteria 688
908 Ga0495600_0135221 3300046809 Bacteria 1602
909 Ga0495604_0202777 3300047317 Bacteria 1375
910 Ga0495604_0218818 3300047317 Bacteria 1312
911 Ga0495674_0129051 3300047319 Bacteria 2131
912 Ga0495680_0032033 3300047322 Bacteria 4272
913 Ga0495684_0171248 3300047471 Bacteria 1615
914 Ga0495684_0174589 3300047471 Bacteria 1596
915 Ga0496100_0033570 3300048903 Bacteria 3212
916 Ga0496101_0068311 3300048904 Bacteria 2598
917 Ga0496101_0588022 3300048904 Bacteria 880
918 Ga0496101_0812959 3300048904 Bacteria 737
919 Ga0496102_0032024 3300048905 Bacteria 4722
920 Ga0496102_0135534 3300048905 Bacteria 2307
921 Ga0496102_0177688 3300048905 Bacteria 2005
922 Ga0496102_0267705 3300048905 Bacteria 1611
923 Ga0496102_0680728 3300048905 Bacteria 952
924 Ga0496103_0087895 3300048906 Bacteria 1960
925 Ga0496103_0659979 3300048906 Bacteria 664
926 Ga0496104_0090992 3300048907 Bacteria 2916
927 Ga0496105_0230350 3300048908 Bacteria 1506
928 Ga0496105_0254667 3300048908 Bacteria 1421
929 Ga0496106_0054400 3300048909 Bacteria 3024
930 Ga0496106_0473055 3300048909 Bacteria 1007
931 Ga0496106_0569334 3300048909 Bacteria 908
932 Ga0496107_0060545 3300048910 Bacteria 2740
933 Ga0496107_0062032 3300048910 Bacteria 2708
934 Ga0496108_0010257 3300048911 Bacteria 7605
935 Ga0496108_0189271 3300048911 Bacteria 1783
936 Ga0496108_0212067 3300048911 Bacteria 1681
937 Ga0496109_0006536 3300048912 Bacteria 9815
938 Ga0496109_0111264 3300048912 Bacteria 2547
939 Ga0496109_0179690 3300048912 Bacteria 1987
940 Ga0496109_1257359 3300048912 Bacteria 676
941 Ga0496109_1271884 3300048912 Bacteria 672
942 Ga0496110_0003711 3300048913 Bacteria 11755
943 Ga0496110_0024801 3300048913 Bacteria 5117
944 Ga0496110_0106666 3300048913 Bacteria 2514
945 Ga0496110_0485249 3300048913 Bacteria 1126
946 Ga0496110_0528152 3300048913 Bacteria 1073
947 Ga0496110_0614752 3300048913 Bacteria 985
948 Ga0496110_1402250 3300048913 Bacteria 608
949 Ga0496111_0092428 3300048914 Bacteria 2218
950 Ga0496111_0129007 3300048914 Bacteria 1870
951 Ga0496112_0000757 3300048915 Bacteria 22660
952 Ga0496112_0621083 3300048915 Bacteria 1012
953 Ga0496113_0018914 3300048916 Bacteria 4809
954 Ga0496113_0519158 3300048916 Bacteria 956
955 Ga0496114_0619533 3300048917 Bacteria 953
956 Ga0496114_1180525 3300048917 Bacteria 651
957 Ga0496115_1058564 3300048918 Bacteria 617
958 Ga0501036_0873661 3300049572 Bacteria 739
959 Ga0501071_0349636 3300049587 Bacteria 1125
960 Ga0501076_1010130 3300049592 Bacteria 685
961 Ga0501045_0292152 3300049824 Bacteria 1213
962 nmdc:mga0k408_446384_c1 3300050493 Bacteria 768
963 nmdc:mga08y16_380098_c1 3300050511 Bacteria 1448
964 nmdc:mga08y16_472172_c1 3300050511 Bacteria 1277
965 nmdc:mga08y16_519680_c1 3300050511 Bacteria 1207
966 nmdc:mga08y16_765559_c1 3300050511 Bacteria 961
967 nmdc:mga0n895_360931_c1 3300050512 Bacteria 1471
968 Ga0495601_0033382 3300053077 Bacteria 3207
969 Ga0495601_0484715 3300053077 Bacteria 799
970 Ga0495612_0021486 3300053078 Bacteria 2590
971 Ga0495612_0367064 3300053078 Bacteria 651
972 Ga0495595_0022840 3300053084 Bacteria 2749
973 Ga0495595_0060135 3300053084 Bacteria 1778
974 Ga0495619_0046836 3300053085 Bacteria 2845
975 Ga0495619_0151306 3300053085 Bacteria 1601
976 Ga0495619_0263429 3300053085 Bacteria 1194
977 Ga0307413_10607550
978 JGI24738J21930_10103678
979 JGI24749J21850_1006390
980 JGI24035J26624_1025670
981 JGI24751J29686_10031005
982 Ga0065712_10095366
983 Ga0065715_10179808
984 Ga0065715_10189271
985 Ga0065715_10211621
986 Ga0070658_10040962
987 Ga0070658_10394950
988 Ga0070676_10000344
989 Ga0070676_10011378
990 Ga0070676_10011883
991 Ga0070676_10015396
992 Ga0070676_10378270
993 Ga0070676_10393378
994 Ga0070676_10432721
995 Ga0070676_10633045
996 Ga0070676_10698425
997 Ga0070683_100021801
998 Ga0070683_100056776
999 Ga0070683_100311516
1000 Ga0070683_100651054
1001 Ga0070690_100007726
1002 Ga0070690_100063483
1003 Ga0070690_100449162
1004 Ga0070690_100530400
1005 Ga0070670_100006654
1006 Ga0070670_100021994
1007 Ga0070670_100029123
1008 Ga0070670_100034134
1009 Ga0070670_100037797
1010 Ga0070670_100069982
1011 Ga0070670_100074674
1012 Ga0070670_100167174
1013 Ga0070670_100366326
1014 Ga0070670_100417508
1015 Ga0070670_100560872
1016 Ga0070670_100669679
1017 Ga0070677_10008344
1018 Ga0070677_10018254
1019 Ga0070677_10063960
1020 Ga0070677_10185686
1021 Ga0068869_100001390
1022 Ga0068869_100018108
1023 Ga0068869_100075381
1024 Ga0068869_100124637
1025 Ga0068869_100292991
1026 Ga0068869_100568471
1027 Ga0070666_10001973
1028 Ga0070666_10002757
1029 Ga0070666_10002876
1030 Ga0070666_10030567
1031 Ga0070666_10043671
1032 Ga0070666_10093233
1033 Ga0070666_10129965
1034 Ga0070666_10384623
1035 Ga0070666_10947049
1036 Ga0068868_100014546
1037 Ga0068868_100100730
1038 Ga0068868_100169549
1039 Ga0068868_100202193
1040 Ga0068868_100245237
1041 Ga0068868_100427650
1042 Ga0068868_100852143
1043 Ga0070660_100152045
1044 Ga0070660_100712724
1045 Ga0070660_101005601
1046 Ga0070689_100013194
1047 Ga0070689_100023376
1048 Ga0070689_100154521
1049 Ga0070689_100291555
1050 Ga0070689_100366891
1051 Ga0070689_100561475
1052 Ga0070687_100191315
1053 Ga0070661_100016322
1054 Ga0070661_100029443
1055 Ga0070661_100042476
1056 Ga0070661_100487000
1057 Ga0070661_100666339
1058 Ga0070668_100003802
1059 Ga0070668_100009616
1060 Ga0070668_100026834
1061 Ga0070668_100044719
1062 Ga0070668_100088006
1063 Ga0070668_100114902
1064 Ga0070668_100183707
1065 Ga0070668_100302940
1066 Ga0070668_100322175
1067 Ga0070668_100358608
1068 Ga0070668_100703181
1069 Ga0070668_101046698
1070 Ga0070668_101240512
1071 Ga0070669_100004539
1072 Ga0070669_100007773
1073 Ga0070669_100015364
1074 Ga0070669_100026847
1075 Ga0070669_100069997
1076 Ga0070669_100121497
1077 Ga0070669_100147558
1078 Ga0070669_100176604
1079 Ga0070669_100699762
1080 Ga0070669_101308734
1081 Ga0070675_100000222
1082 Ga0070675_100004675
1083 Ga0070675_100036061
1084 Ga0070675_100048541
1085 Ga0070675_100052849
1086 Ga0070675_100288248
1087 Ga0070675_100298670
1088 Ga0070675_100361178
1089 Ga0070675_100684329
1090 Ga0070675_100959740
1091 Ga0070675_101318647
1092 Ga0070671_100007206
1093 Ga0070671_100037823
1094 Ga0070671_100042664
1095 Ga0070671_100067537
1096 Ga0070671_100109063
1097 Ga0070671_100127233
1098 Ga0070671_100149462
1099 Ga0070671_100149651
1100 Ga0070671_100356590
1101 Ga0070671_100399669
1102 Ga0070671_100576002
1103 Ga0070671_100828113
1104 Ga0070671_100953509
1105 Ga0070674_100021666
1106 Ga0070674_100025179
1107 Ga0070674_100056900
1108 Ga0070674_100106081
1109 Ga0070674_100344550
1110 Ga0070674_100360123
1111 Ga0070674_100409044
1112 Ga0070674_100699246
1113 Ga0070674_100754421
1114 Ga0070673_100015730
1115 Ga0070673_100018599
1116 Ga0070673_100060946
1117 Ga0070673_100178070
1118 Ga0070673_100332085
1119 Ga0070673_100531550
1120 Ga0070673_101378627
1121 Ga0070673_101534675
1122 Ga0070688_100022065
1123 Ga0070688_100677187
1124 Ga0070659_100015739
1125 Ga0070659_100413528
1126 Ga0070667_100000717
1127 Ga0070667_100020471
1128 Ga0070667_100040308
1129 Ga0070667_100047648
1130 Ga0070667_100136440
1131 Ga0070667_100294009
1132 Ga0070667_100473233
1133 Ga0070667_100500459
1134 Ga0070667_100617028
1135 Ga0070667_100778854
1136 Ga0070667_100925990
1137 Ga0070667_101808450
1138 Ga0070701_10017392
1139 Ga0070701_10312485
1140 Ga0070705_100069878
1141 Ga0070700_100016961
1142 Ga0070700_100171484
1143 Ga0070700_100321824
1144 Ga0070700_100825434
1145 Ga0070694_100980592
1146 Ga0070663_100029864
1147 Ga0070663_100051857
1148 Ga0070663_100075352
1149 Ga0070663_100115035
1150 Ga0070663_100405724
1151 Ga0070663_100786696
1152 Ga0070663_101170490
1153 Ga0070663_101779341
1154 Ga0070678_100000448
1155 Ga0070678_100020232
1156 Ga0070678_100030703
1157 Ga0070678_100031948
1158 Ga0070678_100035584
1159 Ga0070678_100080337
1160 Ga0070678_100090623
1161 Ga0070678_100090806
1162 Ga0070678_100235734
1163 Ga0070678_100284293
1164 Ga0070678_100342797
1165 Ga0070678_100669270
1166 Ga0070678_100767410
1167 Ga0070678_101141392
1168 Ga0070662_100012294
1169 Ga0070662_100015058
1170 Ga0070662_100102722
1171 Ga0070662_100182686
1172 Ga0070662_100269020
1173 Ga0070681_10083766
1174 Ga0068867_100006159
1175 Ga0068867_100046038
1176 Ga0068867_100073666
1177 Ga0068867_100079799
1178 Ga0068867_100084084
1179 Ga0068867_100139378
1180 Ga0068867_100278676
1181 Ga0068867_100348193
1182 Ga0068867_100909011
1183 Ga0068867_100929203
1184 Ga0070685_10023265
1185 Ga0070685_10337387
1186 Ga0070685_10711501
1187 Ga0070684_100078149
1188 Ga0070684_100309877
1189 Ga0068853_100142534
1190 Ga0068853_100201664
1191 Ga0068853_100322190
1192 Ga0068853_100329870
1193 Ga0068853_100378529
1194 Ga0068853_100412424
1195 Ga0070672_100006399
1196 Ga0070672_100013828
1197 Ga0070672_100014571
1198 Ga0070672_100021293
1199 Ga0070672_100024856
1200 Ga0070672_100028103
1201 Ga0070672_100044528
1202 Ga0070672_100057207
1203 Ga0070672_100062761
1204 Ga0070672_100075317
1205 Ga0070672_100104276
1206 Ga0070672_100156825
1207 Ga0070672_100593715
1208 Ga0070672_100923589
1209 Ga0070672_100949393
1210 Ga0070686_100080563
1211 Ga0070686_100425191
1212 Ga0070696_100760376
1213 Ga0070693_100055055
1214 Ga0070693_101180317
1215 Ga0070665_100012487
1216 Ga0070665_100158931
1217 Ga0070665_100162771
1218 Ga0070665_100721442
1219 Ga0070665_101527928
1220 Ga0070665_102325989
1221 Ga0068855_100145744
1222 Ga0070664_100025096
1223 Ga0070664_100036108
1224 Ga0070664_100039474
1225 Ga0070664_100049889
1226 Ga0070664_100532104
1227 Ga0070664_100854606
1228 Ga0070664_100936976
1229 Ga0068857_100002093
1230 Ga0068857_100028766
1231 Ga0068857_100071116
1232 Ga0068857_100072190
1233 Ga0068857_100428773
1234 Ga0068854_100113769
1235 Ga0068854_100196599
1236 Ga0068854_100442716
1237 Ga0068854_100672901
1238 Ga0068856_100019767
1239 Ga0068856_100380810
1240 Ga0070702_100049400
1241 Ga0070702_100282711
1242 Ga0070702_100459403
1243 Ga0068852_100004459
1244 Ga0068852_100046987
1245 Ga0068852_100063222
1246 Ga0068852_100135722
1247 Ga0068852_100191456
1248 Ga0068852_100294322
1249 Ga0068852_100853026
1250 Ga0068859_100002411
1251 Ga0068859_100004263
1252 Ga0068859_100073622
1253 Ga0068859_100115296
1254 Ga0068859_100195405
1255 Ga0068859_100218262
1256 Ga0068859_100375867
1257 Ga0068859_100560248
1258 Ga0068864_100001390
1259 Ga0068864_100004956
1260 Ga0068864_100013391
1261 Ga0068864_100081171
1262 Ga0068864_100097227
1263 Ga0068864_100120290
1264 Ga0068864_100205660
1265 Ga0068864_100803536
1266 Ga0068864_100817731
1267 Ga0068864_101289773
1268 Ga0068866_10004138
1269 Ga0068866_10164465
1270 Ga0068866_10771539
1271 Ga0068861_100001956
1272 Ga0068861_100077438
1273 Ga0068861_100145440
1274 Ga0068861_100234185
1275 Ga0068861_101298827
1276 Ga0068851_10051328
1277 Ga0068851_10074816
1278 Ga0068851_10115413
1279 Ga0068851_10123494
1280 Ga0068851_10145857
1281 Ga0068851_10210522
1282 Ga0068851_10226347
1283 Ga0068851_10427656
1284 Ga0068870_10004955
1285 Ga0068870_10054392
1286 Ga0068870_10120527
1287 Ga0068863_100008219
1288 Ga0068863_100014500
1289 Ga0068863_100020573
1290 Ga0068863_100030547
1291 Ga0068863_100035713
1292 Ga0068863_100069953
1293 Ga0068863_100263218
1294 Ga0068863_100298479
1295 Ga0068863_100495669
1296 Ga0068863_100747884
1297 Ga0068863_101222455
1298 Ga0068863_101322153
1299 Ga0068858_100001430
1300 Ga0068858_100003528
1301 Ga0068858_100008761
1302 Ga0068858_100009455
1303 Ga0068858_100178656
1304 Ga0068858_100471776
1305 Ga0068858_100592031
1306 Ga0068858_101362709
1307 Ga0068860_100004964
1308 Ga0068860_100008639
1309 Ga0068860_100027092
1310 Ga0068860_100058219
1311 Ga0068860_100138768
1312 Ga0068860_100207486
1313 Ga0068860_100952506
1314 Ga0068860_101258139
1315 Ga0068862_100013644
1316 Ga0068862_100032313
1317 Ga0068862_100044056
1318 Ga0068862_100080012
1319 Ga0068862_100091061
1320 Ga0068862_100125742
1321 Ga0068862_100933812
1322 Ga0075366_10053172
1323 Ga0097621_100020220
1324 Ga0097621_100050413
1325 Ga0097621_100068707
1326 Ga0097621_100102403
1327 Ga0097621_100164487
1328 Ga0097621_100415981
1329 Ga0097621_100443213
1330 Ga0097621_100589121
1331 Ga0068871_100000813
1332 Ga0068871_100050459
1333 Ga0068871_100057770
1334 Ga0068871_100062592
1335 Ga0068871_100127811
1336 Ga0068871_100205636
1337 Ga0068871_100974037
1338 Ga0075434_100264493
1339 Ga0068865_100001369
1340 Ga0068865_100068242
1341 Ga0068865_100078860
1342 Ga0068865_100174027
1343 Ga0068865_100432115
1344 Ga0068865_100626781
1345 Ga0068865_100647625
1346 Ga0097620_100002411
1347 Ga0097620_100004263
1348 Ga0097620_100073621
1349 Ga0097620_100115298
1350 Ga0097620_100195411
1351 Ga0097620_100218252
1352 Ga0097620_100375859
1353 Ga0097620_100560254
1354 Ga0105240_10249210
1355 Ga0111539_10009075
1356 Ga0111539_10041362
1357 Ga0111539_10314911
1358 Ga0111539_10650099
1359 Ga0105245_10285136
1360 Ga0105245_10344241
1361 Ga0105245_10380721
1362 Ga0105245_10825668
1363 Ga0105245_11178390
1364 Ga0105247_10122160
1365 Ga0105243_10019318
1366 Ga0105243_10075847
1367 Ga0105243_10076375
1368 Ga0105243_10161352
1369 Ga0105241_10533868
1370 Ga0105241_11513017
1371 Ga0105242_10115581
1372 Ga0105248_10004747
1373 Ga0105248_10010148
1374 Ga0105248_10056024
1375 Ga0105248_10088897
1376 Ga0105248_10105560
1377 Ga0105248_10158445
1378 Ga0105248_10177653
1379 Ga0105248_10541380
1380 Ga0105248_10609372
1381 Ga0105237_10172313
1382 Ga0105237_10507527
1383 Ga0105249_10127804
1384 Ga0105249_10342421
1385 Ga0105249_10500761
1386 Ga0105249_10513303
1387 Ga0105239_10158413
1388 Ga0105239_10447911
1389 Ga0105239_11069577
1390 Ga0105246_10319171
1391 Ga0105246_11080888
1392 Ga0157323_1004431
1393 Ga0157373_10121040
1394 Ga0157371_10411347
1395 Ga0157369_10058543
1396 Ga0157374_10013081
1397 Ga0157374_10055448
1398 Ga0157374_10154539
1399 Ga0157374_10268032
1400 Ga0157374_10346403
1401 Ga0157374_10525563
1402 Ga0157378_10113572
1403 Ga0157378_10154450
1404 Ga0157378_10192853
1405 Ga0157378_10359779
1406 Ga0157378_10920372
1407 Ga0157378_11281057
1408 Ga0163162_10024366
1409 Ga0163162_10036721
1410 Ga0163162_10037039
1411 Ga0163162_10077834
1412 Ga0163162_10586414
1413 Ga0163162_10620143
1414 Ga0163162_10778228
1415 Ga0163162_11538501
1416 Ga0163162_12312881
1417 Ga0157372_10005474
1418 Ga0157372_10388904
1419 Ga0157372_11707567
1420 Ga0157375_10006101
1421 Ga0157375_10046049
1422 Ga0157375_10198089
1423 Ga0157375_10246080
1424 Ga0157375_10308611
1425 Ga0157375_10314225
1426 Ga0157375_10557014
1427 Ga0157375_10661816
1428 Ga0157375_11336229
1429 Ga0163163_10017919
1430 Ga0163163_10047727
1431 Ga0163163_10152450
1432 Ga0163163_10336671
1433 Ga0163163_10481744
1434 Ga0157380_10104096
1435 Ga0157380_10130702
1436 Ga0157380_10491807
1437 Ga0157380_10543199
1438 Ga0157380_11965875
1439 Ga0157377_10026099
1440 Ga0157377_10139827
1441 Ga0157377_10377117
1442 Ga0157379_10001286
1443 Ga0157379_10006766
1444 Ga0157379_10008868
1445 Ga0157379_10067397
1446 Ga0157379_10323077
1447 Ga0157379_10476665
1448 Ga0157379_10717820
1449 Ga0157379_10873492
1450 Ga0157376_10005091
1451 Ga0157376_10011918
1452 Ga0157376_10113417
1453 Ga0157376_10195711
1454 Ga0157376_10202209
1455 Ga0157376_10311350
1456 Ga0157376_10673811
1457 Ga0163161_10032859
1458 Ga0163161_10052316
1459 Ga0163161_10059517
1460 Ga0163161_10126172
1461 Ga0163161_10129907
1462 Ga0163161_10997877
1463 Ga0207673_1000306
1464 Ga0207697_10004410
1465 Ga0207697_10006696
1466 Ga0207697_10007949
1467 Ga0207697_10023476
1468 Ga0207697_10043552
1469 Ga0207656_10028436
1470 Ga0207656_10084064
1471 Ga0207656_10088766
1472 Ga0207656_10149513
1473 Ga0207656_10278231
1474 Ga0207656_10279354
1475 Ga0207656_10314432
1476 Ga0207682_10002330
1477 Ga0207682_10003599
1478 Ga0207682_10023140
1479 Ga0207682_10027820
1480 Ga0207682_10061388
1481 Ga0207642_10015761
1482 Ga0207642_10164685
1483 Ga0207642_10606593
1484 Ga0207710_10023078
1485 Ga0207688_10049724
1486 Ga0207688_10400808
1487 Ga0207688_10401533
1488 Ga0207680_10000460
1489 Ga0207680_10003375
1490 Ga0207680_10007709
1491 Ga0207680_10023237
1492 Ga0207680_10154774
1493 Ga0207680_10378210
1494 Ga0207680_10477983
1495 Ga0207685_10011257
1496 Ga0207645_10000286
1497 Ga0207645_10007203
1498 Ga0207645_10017166
1499 Ga0207645_10075750
1500 Ga0207645_10084974
1501 Ga0207645_10114941
1502 Ga0207645_10139560
1503 Ga0207645_10179633
1504 Ga0207645_10680995
1505 Ga0207645_10732150
1506 Ga0207643_10001339
1507 Ga0207643_10003357
1508 Ga0207643_10102273
1509 Ga0207643_10300344
1510 Ga0207643_10641336
1511 Ga0207705_10023604
1512 Ga0207654_10292454
1513 Ga0207707_10143522
1514 Ga0207695_10370610
1515 Ga0207671_10543420
1516 Ga0207662_10066328
1517 Ga0207662_10070276
1518 Ga0207657_10022097
1519 Ga0207657_10104684
1520 Ga0207657_10243866
1521 Ga0207657_10421905
1522 Ga0207657_10738146
1523 Ga0207649_10003717
1524 Ga0207649_10022991
1525 Ga0207649_10143271
1526 Ga0207649_10196353
1527 Ga0207649_10309630
1528 Ga0207681_10003352
1529 Ga0207681_10004963
1530 Ga0207681_10008968
1531 Ga0207681_10022382
1532 Ga0207681_10190303
1533 Ga0207681_10237011
1534 Ga0207681_10250598
1535 Ga0207681_10331834
1536 Ga0207681_10397548
1537 Ga0207681_10796853
1538 Ga0207694_10083149
1539 Ga0207694_10177423
1540 Ga0207650_10000961
1541 Ga0207650_10009622
1542 Ga0207650_10026267
1543 Ga0207650_10033258
1544 Ga0207650_10046291
1545 Ga0207650_10050267
1546 Ga0207650_10163516
1547 Ga0207650_10696807
1548 Ga0207659_10000564
1549 Ga0207659_10000743
1550 Ga0207659_10031675
1551 Ga0207659_10034469
1552 Ga0207659_10087961
1553 Ga0207659_10122289
1554 Ga0207659_10176619
1555 Ga0207659_10380191
1556 Ga0207659_10660106
1557 Ga0207659_10665132
1558 Ga0207659_11268593
1559 Ga0207687_10188128
1560 Ga0207687_10242917
1561 Ga0207687_10257728
1562 Ga0207687_10938204
1563 Ga0207644_10002908
1564 Ga0207644_10004624
1565 Ga0207644_10021809
1566 Ga0207644_10115831
1567 Ga0207644_10138652
1568 Ga0207644_10151963
1569 Ga0207644_10305927
1570 Ga0207644_10365809
1571 Ga0207644_10455459
1572 Ga0207644_10804180
1573 Ga0207644_10927893
1574 Ga0207690_10018444
1575 Ga0207690_10197465
1576 Ga0207690_10418420
1577 Ga0207706_10017710
1578 Ga0207706_10032610
1579 Ga0207706_10071392
1580 Ga0207706_10089891
1581 Ga0207706_10112140
1582 Ga0207706_10430568
1583 Ga0207686_10011394
1584 Ga0207709_10025665
1585 Ga0207709_10044981
1586 Ga0207709_10373945
1587 Ga0207709_10519417
1588 Ga0207709_10858954
1589 Ga0207670_10010466
1590 Ga0207670_10135451
1591 Ga0207670_10165060
1592 Ga0207670_10549245
1593 Ga0207669_10021886
1594 Ga0207669_10085710
1595 Ga0207669_10098616
1596 Ga0207669_10106809
1597 Ga0207669_10200026
1598 Ga0207669_10390411
1599 Ga0207704_10001991
1600 Ga0207704_10118773
1601 Ga0207704_10156370
1602 Ga0207704_10264830
1603 Ga0207704_10903634
1604 Ga0207704_11126483
1605 Ga0207691_10008331
1606 Ga0207691_10009059
1607 Ga0207691_10014823
1608 Ga0207691_10024448
1609 Ga0207691_10028760
1610 Ga0207691_10046562
1611 Ga0207691_10058847
1612 Ga0207691_10061234
1613 Ga0207691_10062707
1614 Ga0207691_10079471
1615 Ga0207691_10096539
1616 Ga0207691_10177037
1617 Ga0207691_10517348
1618 Ga0207691_10859719
1619 Ga0207711_10004787
1620 Ga0207711_10005414
1621 Ga0207711_10090593
1622 Ga0207711_10096225
1623 Ga0207711_10134112
1624 Ga0207711_10191264
1625 Ga0207711_10364076
1626 Ga0207689_10002442
1627 Ga0207689_10029515
1628 Ga0207689_10036183
1629 Ga0207689_10074735
1630 Ga0207689_10453005
1631 Ga0207661_10049787
1632 Ga0207661_10069230
1633 Ga0207661_10458710
1634 Ga0207679_10005455
1635 Ga0207679_10007203
1636 Ga0207679_10020838
1637 Ga0207679_10220317
1638 Ga0207679_10523777
1639 Ga0207667_10128343
1640 Ga0207651_10002272
1641 Ga0207651_10002401
1642 Ga0207651_10055716
1643 Ga0207651_10189721
1644 Ga0207651_10201556
1645 Ga0207651_10387161
1646 Ga0207651_10970849
1647 Ga0207651_11052162
1648 Ga0207712_10017100
1649 Ga0207712_10141491
1650 Ga0207712_10233701
1651 Ga0207712_10353734
1652 Ga0207712_10756014
1653 Ga0207668_10004025
1654 Ga0207668_10005485
1655 Ga0207668_10015882
1656 Ga0207668_10039212
1657 Ga0207668_10043019
1658 Ga0207668_10056559
1659 Ga0207668_10096506
1660 Ga0207668_10349179
1661 Ga0207668_10459440
1662 Ga0207668_10558618
1663 Ga0207668_10762827
1664 Ga0207668_10861923
1665 Ga0207668_11589749
1666 Ga0207640_10279474
1667 Ga0207640_10919953
1668 Ga0207658_10003356
1669 Ga0207658_10010727
1670 Ga0207658_10013975
1671 Ga0207658_10015576
1672 Ga0207658_10017996
1673 Ga0207658_10232399
1674 Ga0207658_10998032
1675 Ga0207677_10009613
1676 Ga0207677_10143938
1677 Ga0207677_10265116
1678 Ga0207677_10446199
1679 Ga0207677_10614497
1680 Ga0207677_10692142
1681 Ga0207677_11322918
1682 Ga0207703_10000910
1683 Ga0207703_10004196
1684 Ga0207703_10012497
1685 Ga0207703_10018346
1686 Ga0207703_10118780
1687 Ga0207703_11199358
1688 Ga0207639_10031127
1689 Ga0207639_10062036
1690 Ga0207639_10105498
1691 Ga0207678_10024841
1692 Ga0207678_10159322
1693 Ga0207678_10168410
1694 Ga0207678_10231752
1695 Ga0207678_10354467
1696 Ga0207678_10410923
1697 Ga0207708_10044356
1698 Ga0207708_10102888
1699 Ga0207708_10216981
1700 Ga0207708_10770909
1701 Ga0207708_11232689
1702 Ga0207702_10014997
1703 Ga0207702_10461382
1704 Ga0207702_10554051
1705 Ga0207641_10003314
1706 Ga0207641_10019913
1707 Ga0207641_10021303
1708 Ga0207641_10049829
1709 Ga0207641_10274816
1710 Ga0207641_10348692
1711 Ga0207641_10914816
1712 Ga0207641_11138387
1713 Ga0207641_11215544
1714 Ga0207648_10009351
1715 Ga0207648_10014197
1716 Ga0207648_10031163
1717 Ga0207648_10043263
1718 Ga0207648_10054851
1719 Ga0207648_10089939
1720 Ga0207648_10091081
1721 Ga0207648_10102483
1722 Ga0207648_10433388
1723 Ga0207648_11680659
1724 Ga0207676_10001427
1725 Ga0207676_10003449
1726 Ga0207676_10009320
1727 Ga0207676_10021594
1728 Ga0207676_10029533
1729 Ga0207676_10075968
1730 Ga0207676_10195265
1731 Ga0207676_10198697
1732 Ga0207676_10224089
1733 Ga0207676_10535942
1734 Ga0207676_10719883
1735 Ga0207674_10001341
1736 Ga0207674_10038317
1737 Ga0207674_10094814
1738 Ga0207674_10175975
1739 Ga0207674_11025622
1740 Ga0207675_100004202
1741 Ga0207675_100045108
1742 Ga0207675_100119683
1743 Ga0207675_100122608
1744 Ga0207675_100160923
1745 Ga0207675_100240604
1746 Ga0207675_100250401
1747 Ga0207675_100765898
1748 Ga0207675_101051038
1749 Ga0207675_101949226
1750 Ga0207683_10025109
1751 Ga0207683_10031708
1752 Ga0207683_10031785
1753 Ga0207683_10051903
1754 Ga0207683_10103160
1755 Ga0207683_10105238
1756 Ga0207683_10265639
1757 Ga0207683_10421026
1758 Ga0207683_10471499
1759 Ga0207683_11869521
1760 Ga0207698_10003666
1761 Ga0207698_10036943
1762 Ga0207698_10143593
1763 Ga0207698_10291308
1764 Ga0207698_10303660
1765 Ga0207698_10312847
1766 Ga0207698_10360985
1767 Ga0207698_10386939
1768 Ga0207698_10410485
1769 Ga0207698_10930760
1770 Ga0207698_11310454
1771 Ga0207428_10023641
1772 Ga0268266_10003452
1773 Ga0268266_10014928
1774 Ga0268266_10706948
1775 Ga0268266_11552798
1776 Ga0268266_11631230
1777 Ga0268265_10024121
1778 Ga0268265_10066677
1779 Ga0268265_10086503
1780 Ga0268265_10222848
1781 Ga0268265_10241093
1782 Ga0268265_10242194
1783 Ga0268265_10776590
1784 Ga0268265_11647218
1785 Ga0268264_10001527
1786 Ga0268264_10018003
1787 Ga0268264_10032659
1788 Ga0268264_10037745
1789 Ga0268264_10087949
1790 Ga0268264_10093681
1791 Ga0268264_10939559
1792 Ga0265330_10000832
1793 Ga0265332_10000449
1794 Ga0265328_10025110
1795 Ga0265328_10043849
1796 Ga0265325_10089238
1797 Ga0265329_10013462
1798 Ga0265340_10222683
1799 Ga0265331_10000571
1800 Ga0265327_10017824
1801 Ga0265316_10005569
1802 Ga0316575_10001239
1803 Ga0316579_10038128
1804 Ga0265342_10044351
1805 Ga0316576_10002389
1806 Ga0316576_10003885
1807 Ga0316578_10000412
1808 Ga0307405_10019849
1809 Ga0316577_10011949
1810 Ga0307413_10440221
1811 Ga0307412_10445511
1812 Ga0307409_100042758
1813 Ga0307409_101822509
1814 Ga0307416_100000751
1815 Ga0316585_10037738
1816 Ga0316580_10000473
1817 Ga0373929_0130691
1818 Ga0373939_0021444
1819 Ga0373954_0120767
1820 Ga0373956_0119012
1821 Ga0373957_0089427
1822 Ga0373957_0204957
1823 Ga0373943_0429590
1824 Ga0373955_0082860
1825 Ga0373955_0631059
1826 Ga0316574_0000327
1827 Ga0316574_0005355
1828 Ga0373935_0617998
1829 Ga0373935_1250145
1830 Ga0373927_0631194
1831 Ga0373927_0872956
1832 Ga0373933_0092801
1833 Ga0373947_0257211
1834 Ga0373937_0086585
1835 Ga0373937_0183283
1836 Ga0373937_0386645
1837 Ga0316582_0166184
1838 Ga0316584_0005424
1839 Ga0316584_0102853
1840 Ga0373925_0278897
1841 Ga0373925_0924806
1842 Ga0436363_1254080
1843 Ga0451791_1228634
1844 Ga0451853_2088882
1845 Ga0451853_2171643
1846 Ga0439441_026399
1847 Ga0439450_005310
1848 Ga0450892_006938
1849 Ga0439434_0085064
1850 Ga0439464_0004547
1851 Ga0439460_0010105
1852 Ga0451577_0129940
1853 Ga0453684_0036774
1854 Ga0451576_0005175
1855 Ga0495629_0490074
1856 Ga0495651_0127303
1857 Ga0495651_0398068
1858 Ga0495653_0490089
1859 Ga0495580_0048179
1860 Ga0495580_0254118
1861 Ga0495664_0201108
1862 Ga0495608_0717120
1863 Ga0495628_0275344
1864 Ga0495644_0232045
1865 Ga0495652_0712050
1866 Ga0495586_0212235
1867 Ga0495587_0111462
1868 Ga0495598_0033284
1869 Ga0495598_0238299
1870 Ga0495598_0460724
1871 Ga0495621_0022996
1872 Ga0495621_0130430
1873 Ga0495621_0320817
1874 Ga0495645_0001597
1875 Ga0495645_0076395
1876 Ga0495667_0011969
1877 Ga0495657_0432709
1878 Ga0495623_0011209
1879 Ga0495646_0163728
1880 Ga0495647_0085075
1881 Ga0495658_0070598
1882 Ga0495658_0095749
1883 Ga0495658_0627259
1884 Ga0495600_0135221
1885 Ga0495604_0202777
1886 Ga0495604_0218818
1887 Ga0495674_0129051
1888 Ga0495680_0032033
1889 Ga0495684_0171248
1890 Ga0495684_0174589
1891 Ga0496100_0033570
1892 Ga0496101_0068311
1893 Ga0496101_0588022
1894 Ga0496101_0812959
1895 Ga0496102_0032024
1896 Ga0496102_0135534
1897 Ga0496102_0177688
1898 Ga0496102_0267705
1899 Ga0496102_0680728
1900 Ga0496103_0087895
1901 Ga0496103_0659979
1902 Ga0496104_0090992
1903 Ga0496105_0230350
1904 Ga0496105_0254667
1905 Ga0496106_0054400
1906 Ga0496106_0473055
1907 Ga0496106_0569334
1908 Ga0496107_0060545
1909 Ga0496107_0062032
1910 Ga0496108_0010257
1911 Ga0496108_0189271
1912 Ga0496108_0212067
1913 Ga0496109_0006536
1914 Ga0496109_0111264
1915 Ga0496109_0179690
1916 Ga0496109_1257359
1917 Ga0496109_1271884
1918 Ga0496110_0003711
1919 Ga0496110_0024801
1920 Ga0496110_0106666
1921 Ga0496110_0485249
1922 Ga0496110_0528152
1923 Ga0496110_0614752
1924 Ga0496110_1402250
1925 Ga0496111_0092428
1926 Ga0496111_0129007
1927 Ga0496112_0000757
1928 Ga0496112_0621083
1929 Ga0496113_0018914
1930 Ga0496113_0519158
1931 Ga0496114_0619533
1932 Ga0496114_1180525
1933 Ga0496115_1058564
1934 Ga0501036_0873661
1935 Ga0501071_0349636
1936 Ga0501076_1010130
1937 Ga0501045_0292152
1938 nmdc:mga0k408_446384_c1
1939 nmdc:mga08y16_380098_c1
1940 nmdc:mga08y16_472172_c1
1941 nmdc:mga08y16_519680_c1
1942 nmdc:mga08y16_765559_c1
1943 nmdc:mga0n895_360931_c1
1944 Ga0495601_0033382
1945 Ga0495601_0484715
1946 Ga0495612_0021486
1947 Ga0495612_0367064
1948 Ga0495595_0022840
1949 Ga0495595_0060135
1950 Ga0495619_0046836
1951 Ga0495619_0151306
1952 Ga0495619_0263429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

8

154

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.8772 20 153
6zjy-assembly1.cif.gz_2 respiratory complex i from thermus thermophilus, nad+ dataset, minor state 0.86 7 152
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.86 74 150
3iam-assembly1.cif.gz_2 crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh 0.8522 5 152
7p8n-assembly1.cif.gz_b tmhydabc- t. maritima hydrogenase with bridge closed 0.8514 74 150
ID Description Score Start End Superfamily
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9806 71 152 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9682 70 150 3.40.30.10
af_B4FPX5_191_300_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9661 71 152 3.40.30.10
af_A4HX94_128_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9441 71 152 3.40.30.10
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9423 72 152 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3N9VPE8-F1-model_v4 Bidirectional hydrogenase complex protein HoxE 0.9413 21 150 GO:0003677
GO:0016491
GO:0046872
GO:0051537
AF-A0A2P8KF63-F1-model_v4 Formate dehydrogenase subunit gamma 0.9223 21 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A7C1FUE7-F1-model_v4 Bidirectional hydrogenase complex protein HoxE 0.9209 21 152 GO:0003677
GO:0016491
GO:0046872
GO:0051537
AF-A0A2G6GL94-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.919 21 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A6I7QIF3-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9151 21 152 GO:0016491
GO:0046872
GO:0051537

Map