F486697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 955 | 448 | 737 | 376 |
Family's Representative Sequence
| Representative Sequence | 2162886011|MRS1b_contig_6976788|MRS1b_0576.00002960 |
| Length | 432 |
| Sequence | MAGFLAGGHSVIVPCLKSVDDNRASGEYPKRALVWRRRFVLKDNHPFITLPQGARMKASWDIFCSVVDNYGDVGVTWRLARQLVAEHGLKIRLWIDDLSAFARLCPQADAHVEQQWHEGVEVCLWPKEWVSTDIPEGVIEAFACRLPAAYTDAMLQRSPRPVWLNLDYLSAEEWVTGCHGLPSLQSSGLRKFFFFPGFRDTTGGLLRENSLIEQRRAFQRDNKARLDFLSRLGVEPRIDARLISVFAYENPALGSWLDTLSGDSHATHLLVPEGRILGDLQQWLGVDHLQVGEVLRRGSLTVQVLPFVSQEDYDRVLWSCHFNVVRGEDSFVRAQWAGRPMLWHIYQQEGDAHLPKLDAFLELYLAGLSPEAGQALDAFWQAWNANQALSEXXXLLSNHWPEVQRHAEQWCDEQASRTDLAAALVQFYVNSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 5 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 6 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 7 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 8 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 9 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 10 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 11 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 12 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 13 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 14 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 15 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 16 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 17 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 18 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 19 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 20 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 21 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 22 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 23 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 24 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 25 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 26 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 27 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 28 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 29 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 30 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 31 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 32 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 33 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 34 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 35 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 36 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 37 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 38 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 39 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 40 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 41 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 42 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 43 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 44 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 45 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 46 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 47 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 48 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 49 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 50 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 51 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 52 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 53 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 54 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 55 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 56 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 57 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 58 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 59 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 60 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 61 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 62 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 63 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 64 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 65 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 66 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 67 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 68 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 69 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 70 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 71 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 72 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 73 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 74 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 75 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 76 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 77 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 78 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 79 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 80 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 81 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 82 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 83 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 84 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 85 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 86 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 87 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 88 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 89 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 90 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 91 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 92 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 93 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 94 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 95 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 96 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 97 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 98 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 99 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 100 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 101 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 102 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 103 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 104 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 105 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 106 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 107 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 108 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 109 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 110 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 111 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 112 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 113 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 114 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 115 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 116 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 117 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 118 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 119 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 120 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 121 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 122 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 123 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 124 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 125 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 126 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 127 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 128 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 129 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 130 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 131 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 132 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 133 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 134 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 135 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 136 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 137 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 138 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 139 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 140 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 141 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 142 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 143 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 144 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 145 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 146 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 147 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 148 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 149 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 150 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 151 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 152 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 153 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 154 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 155 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 156 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 157 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 158 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 159 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 160 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 161 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 162 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 163 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 164 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 165 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 166 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 167 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 168 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 169 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 170 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 171 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 172 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 173 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 174 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 175 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 176 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 177 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 178 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 179 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 180 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 181 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 182 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 183 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 184 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 185 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 186 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 187 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 188 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 189 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 190 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 191 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 192 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 193 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 194 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 195 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 196 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 197 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 198 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 199 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 200 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 201 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 202 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 203 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 204 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 205 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 206 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 207 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 208 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 209 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 210 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 211 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 212 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 213 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 214 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 215 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 216 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 217 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 224 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 225 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 226 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 227 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 228 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 237 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 245 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 246 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 247 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 249 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 259 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 261 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 264 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 279 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 281 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 283 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 284 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 285 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 286 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 287 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 288 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 289 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 290 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 291 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 292 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 293 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 294 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 295 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 296 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 297 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 298 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 299 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 300 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 301 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 302 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 303 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 304 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 305 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 306 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 307 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 308 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 309 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 310 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 311 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 312 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 313 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 314 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 315 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 316 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 317 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 318 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 319 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 320 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 321 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 322 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 323 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 324 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 325 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 402 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 403 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 404 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 405 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 406 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 407 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 408 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 409 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 410 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 411 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 412 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 413 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 414 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 415 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 416 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 419 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 420 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 421 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 422 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 423 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 424 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 425 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 426 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 427 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 428 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 429 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 430 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 431 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 432 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 433 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 434 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 435 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 436 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 437 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 438 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 439 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 440 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 441 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 442 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 443 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 444 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 445 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 446 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 447 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 448 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.17 |
| Metatranscriptomes | 0 |
| Isolates | 22.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.34 |
| Nodule | 2.3 |
| Rhizoplane | 7.33 |
| Rhizosphere | 72.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_6176 | 2124908027 | Bacteria | 5712 |
| 2 | SwRhRL2b_contig_2223659 | 2162886007 | Bacteria | 2860 |
| 3 | MRS1b_contig_6976788 | 2162886011 | Bacteria | 3368 |
| 4 | JGI25162J39368_1001980 | 3300002737 | Bacteria | 9178 |
| 5 | JGI25163J39215_1001687 | 3300002771 | Bacteria | 3176 |
| 6 | JGI25164J39214_1000968 | 3300002772 | Bacteria | 9177 |
| 7 | JGI25165J46597_1000362 | 3300003214 | Bacteria | 50814 |
| 8 | Ga0055539_1000134 | 3300003752 | Bacteria | 78300 |
| 9 | Ga0055533_1000138 | 3300003756 | Bacteria | 78275 |
| 10 | Ga0055532_1000142 | 3300003758 | Bacteria | 69999 |
| 11 | Ga0055525_1000183 | 3300003759 | Bacteria | 78300 |
| 12 | Ga0055535_1005240 | 3300003761 | Bacteria | 2899 |
| 13 | Ga0055526_1019534 | 3300003771 | Bacteria | 2466 |
| 14 | Ga0055536_1003164 | 3300003781 | Bacteria | 8924 |
| 15 | Ga0055536_1011927 | 3300003781 | Bacteria | 3275 |
| 16 | Ga0055536_1011959 | 3300003781 | Bacteria | 3267 |
| 17 | Ga0055530_10011048 | 3300003791 | Bacteria | 3276 |
| 18 | Ga0055530_10011088 | 3300003791 | Bacteria | 3268 |
| 19 | Ga0055530_10037562 | 3300003791 | Bacteria | 1210 |
| 20 | Ga0055540_1003543 | 3300003792 | Bacteria | 7476 |
| 21 | Ga0055540_1009780 | 3300003792 | Bacteria | 3268 |
| 22 | Ga0055531_10000155 | 3300003794 | Bacteria | 79002 |
| 23 | Ga0055541_1000089 | 3300003841 | Bacteria | 78275 |
| 24 | Ga0065714_10000759 | 3300005288 | Bacteria | 2667 |
| 25 | Ga0065714_10003248 | 3300005288 | Bacteria | 11726 |
| 26 | Ga0065714_10016937 | 3300005288 | Bacteria | 1359 |
| 27 | Ga0065714_10024949 | 3300005288 | Bacteria | 1326 |
| 28 | Ga0065714_10065661 | 3300005288 | Bacteria | 8972 |
| 29 | Ga0065714_10068871 | 3300005288 | Bacteria | 4502 |
| 30 | Ga0065714_10072724 | 3300005288 | Bacteria | 3313 |
| 31 | Ga0065714_10073020 | 3300005288 | Bacteria | 3258 |
| 32 | Ga0065714_10082358 | 3300005288 | Bacteria | 2287 |
| 33 | Ga0065714_10099572 | 3300005288 | Bacteria | 1680 |
| 34 | Ga0065714_10109927 | 3300005288 | Bacteria | 1493 |
| 35 | Ga0065714_10121590 | 3300005288 | Bacteria | 1342 |
| 36 | Ga0065704_10073943 | 3300005289 | Bacteria | 6647 |
| 37 | Ga0065712_10068223 | 3300005290 | Bacteria | 12740 |
| 38 | Ga0065712_10076344 | 3300005290 | Bacteria | 3680 |
| 39 | Ga0065715_10127901 | 3300005293 | Bacteria | 2077 |
| 40 | Ga0070670_100061378 | 3300005331 | Bacteria | 3227 |
| 41 | Ga0070661_100001382 | 3300005344 | Bacteria | 16961 |
| 42 | Ga0070669_100003585 | 3300005353 | Bacteria | 11204 |
| 43 | Ga0070669_100050275 | 3300005353 | Bacteria | 3045 |
| 44 | Ga0070662_100004011 | 3300005457 | Bacteria | 9231 |
| 45 | Ga0070665_100044913 | 3300005548 | Bacteria | 4435 |
| 46 | Ga0070664_100005010 | 3300005564 | Bacteria | 10613 |
| 47 | Ga0068851_10000050 | 3300005834 | Bacteria | 72913 |
| 48 | Ga0075432_10001936 | 3300006058 | Bacteria | 6873 |
| 49 | Ga0075432_10009655 | 3300006058 | Bacteria | 3285 |
| 50 | Ga0075432_10064265 | 3300006058 | Bacteria | 1310 |
| 51 | Ga0075362_10029125 | 3300006177 | Bacteria | 2377 |
| 52 | Ga0075436_100125576 | 3300006914 | Bacteria | 1797 |
| 53 | Ga0079104_1000124 | 3300006946 | Bacteria | 110752 |
| 54 | Ga0079104_1000346 | 3300006946 | Bacteria | 55624 |
| 55 | Ga0105251_10000125 | 3300009011 | Bacteria | 77078 |
| 56 | Ga0105251_10005278 | 3300009011 | Bacteria | 8501 |
| 57 | Ga0105251_10007357 | 3300009011 | Bacteria | 6801 |
| 58 | Ga0105251_10021500 | 3300009011 | Bacteria | 3367 |
| 59 | Ga0105251_10027770 | 3300009011 | Bacteria | 2864 |
| 60 | Ga0105251_10035119 | 3300009011 | Bacteria | 2476 |
| 61 | Ga0105251_10076599 | 3300009011 | Bacteria | 1552 |
| 62 | Ga0105244_10001004 | 3300009036 | Bacteria | 23633 |
| 63 | Ga0105244_10001906 | 3300009036 | Bacteria | 16204 |
| 64 | Ga0105244_10003260 | 3300009036 | Bacteria | 11709 |
| 65 | Ga0105244_10025034 | 3300009036 | Bacteria | 3249 |
| 66 | Ga0105244_10032220 | 3300009036 | Bacteria | 2776 |
| 67 | Ga0105244_10044084 | 3300009036 | Bacteria | 2299 |
| 68 | Ga0105244_10071664 | 3300009036 | Bacteria | 1727 |
| 69 | Ga0105244_10085648 | 3300009036 | Bacteria | 1555 |
| 70 | Ga0105250_10000612 | 3300009092 | Bacteria | 23290 |
| 71 | Ga0105250_10028504 | 3300009092 | Bacteria | 2248 |
| 72 | Ga0105250_10030721 | 3300009092 | Bacteria | 2159 |
| 73 | Ga0105250_10071089 | 3300009092 | Bacteria | 1405 |
| 74 | Ga0105250_10088822 | 3300009092 | Bacteria | 1256 |
| 75 | Ga0105250_10088823 | 3300009092 | Bacteria | 1256 |
| 76 | Ga0105243_10006610 | 3300009148 | Bacteria | 8953 |
| 77 | Ga0105243_10050449 | 3300009148 | Bacteria | 3287 |
| 78 | Ga0105243_10067654 | 3300009148 | Bacteria | 2876 |
| 79 | Ga0105243_10186928 | 3300009148 | Bacteria | 1806 |
| 80 | Ga0105242_10002363 | 3300009176 | Bacteria | 14891 |
| 81 | Ga0105248_10071057 | 3300009177 | Bacteria | 3909 |
| 82 | Ga0105237_10001117 | 3300009545 | Bacteria | 35949 |
| 83 | Ga0105246_10000120 | 3300011119 | Bacteria | 35764 |
| 84 | Ga0105246_10000955 | 3300011119 | Bacteria | 16543 |
| 85 | Ga0105246_10042404 | 3300011119 | Bacteria | 3081 |
| 86 | Ga0157345_1000641 | 3300012498 | Bacteria | 2926 |
| 87 | Ga0157373_10045585 | 3300013100 | Bacteria | 3129 |
| 88 | Ga0157373_10053495 | 3300013100 | Bacteria | 2870 |
| 89 | Ga0157373_10056628 | 3300013100 | Bacteria | 2783 |
| 90 | Ga0157373_10219316 | 3300013100 | Bacteria | 1342 |
| 91 | Ga0157371_10000539 | 3300013102 | Bacteria | 45066 |
| 92 | Ga0157371_10045305 | 3300013102 | Bacteria | 3130 |
| 93 | Ga0157370_10011567 | 3300013104 | Bacteria | 9213 |
| 94 | Ga0157370_10061911 | 3300013104 | Bacteria | 3551 |
| 95 | Ga0157370_10238523 | 3300013104 | Bacteria | 1683 |
| 96 | Ga0157370_10318808 | 3300013104 | Bacteria | 1434 |
| 97 | Ga0157370_10372198 | 3300013104 | Bacteria | 1316 |
| 98 | Ga0157369_10024274 | 3300013105 | Bacteria | 6747 |
| 99 | Ga0157369_10027324 | 3300013105 | Bacteria | 6327 |
| 100 | Ga0157369_10128942 | 3300013105 | Bacteria | 2681 |
| 101 | Ga0163162_10084799 | 3300013306 | Bacteria | 3244 |
| 102 | Ga0157372_10151925 | 3300013307 | Bacteria | 2673 |
| 103 | Ga0157375_10091637 | 3300013308 | Bacteria | 3101 |
| 104 | Ga0157375_10128203 | 3300013308 | Bacteria | 2655 |
| 105 | Ga0157375_10157671 | 3300013308 | Bacteria | 2410 |
| 106 | Ga0157375_10528237 | 3300013308 | Bacteria | 1343 |
| 107 | Ga0182008_10000220 | 3300014497 | Bacteria | 44813 |
| 108 | Ga0182008_10029330 | 3300014497 | Bacteria | 2780 |
| 109 | Ga0182008_10031546 | 3300014497 | Bacteria | 2667 |
| 110 | Ga0182008_10119219 | 3300014497 | Bacteria | 1311 |
| 111 | Ga0182008_10120565 | 3300014497 | Bacteria | 1303 |
| 112 | Ga0182006_1016215 | 3300015261 | Bacteria | 3179 |
| 113 | Ga0182006_1017477 | 3300015261 | Bacteria | 3046 |
| 114 | Ga0182006_1023118 | 3300015261 | Bacteria | 2576 |
| 115 | Ga0182006_1030098 | 3300015261 | Bacteria | 2196 |
| 116 | Ga0182006_1033945 | 3300015261 | Bacteria | 2044 |
| 117 | Ga0182005_1022357 | 3300015265 | Bacteria | 1733 |
| 118 | Ga0182005_1023978 | 3300015265 | Bacteria | 1668 |
| 119 | Ga0182005_1027103 | 3300015265 | Bacteria | 1563 |
| 120 | Ga0182005_1035494 | 3300015265 | Bacteria | 1356 |
| 121 | Ga0163161_10028354 | 3300017792 | Bacteria | 3976 |
| 122 | Ga0163161_10036333 | 3300017792 | Bacteria | 3528 |
| 123 | Ga0163161_10053175 | 3300017792 | Bacteria | 2936 |
| 124 | Ga0163161_10084181 | 3300017792 | Bacteria | 2345 |
| 125 | Ga0209435_101864 | 3300025206 | Bacteria | 2539 |
| 126 | Ga0209760_100266 | 3300025207 | Bacteria | 19495 |
| 127 | Ga0209784_100040 | 3300025224 | Bacteria | 231812 |
| 128 | Ga0209566_100051 | 3300025225 | Bacteria | 231920 |
| 129 | Ga0209674_100072 | 3300025226 | Bacteria | 231812 |
| 130 | Ga0209147_100067 | 3300025229 | Bacteria | 231812 |
| 131 | Ga0209563_100073 | 3300025230 | Bacteria | 231920 |
| 132 | Ga0209563_100986 | 3300025230 | Bacteria | 8338 |
| 133 | Ga0207427_100074 | 3300025231 | Bacteria | 153455 |
| 134 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 135 | Ga0209258_100585 | 3300025242 | Bacteria | 30446 |
| 136 | Ga0209646_1000325 | 3300025246 | Bacteria | 36642 |
| 137 | Ga0209677_100121 | 3300025253 | Bacteria | 80378 |
| 138 | Ga0209759_1013808 | 3300025256 | Bacteria | 2167 |
| 139 | Ga0209233_1000105 | 3300025261 | Bacteria | 272035 |
| 140 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 141 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 142 | Ga0209676_1000223 | 3300025292 | Bacteria | 124359 |
| 143 | Ga0209676_1015874 | 3300025292 | Bacteria | 2750 |
| 144 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 145 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 146 | Ga0209050_1000214 | 3300025298 | Bacteria | 129270 |
| 147 | Ga0209050_1004712 | 3300025298 | Bacteria | 9042 |
| 148 | Ga0209051_1000104 | 3300025303 | Bacteria | 161001 |
| 149 | Ga0209051_1000163 | 3300025303 | Bacteria | 124249 |
| 150 | Ga0209051_1021985 | 3300025303 | Bacteria | 2698 |
| 151 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 152 | Ga0207656_10000683 | 3300025321 | Bacteria | 11116 |
| 153 | Ga0207696_1000171 | 3300025711 | Bacteria | 102599 |
| 154 | Ga0207696_1000191 | 3300025711 | Bacteria | 94782 |
| 155 | Ga0207696_1003722 | 3300025711 | Bacteria | 6828 |
| 156 | Ga0207696_1014501 | 3300025711 | Bacteria | 2701 |
| 157 | Ga0207696_1022598 | 3300025711 | Bacteria | 1996 |
| 158 | Ga0207655_1000286 | 3300025728 | Bacteria | 77168 |
| 159 | Ga0207655_1000654 | 3300025728 | Bacteria | 41218 |
| 160 | Ga0207655_1002485 | 3300025728 | Bacteria | 14924 |
| 161 | Ga0207655_1002922 | 3300025728 | Bacteria | 13144 |
| 162 | Ga0207655_1003053 | 3300025728 | Bacteria | 12768 |
| 163 | Ga0207655_1005310 | 3300025728 | Bacteria | 8814 |
| 164 | Ga0207655_1016926 | 3300025728 | Bacteria | 3960 |
| 165 | Ga0207655_1027662 | 3300025728 | Bacteria | 2696 |
| 166 | Ga0207655_1065783 | 3300025728 | Bacteria | 1374 |
| 167 | Ga0207713_1000166 | 3300025735 | Bacteria | 96359 |
| 168 | Ga0207713_1000530 | 3300025735 | Bacteria | 38258 |
| 169 | Ga0207713_1002221 | 3300025735 | Bacteria | 14387 |
| 170 | Ga0207713_1002411 | 3300025735 | Bacteria | 13651 |
| 171 | Ga0207713_1003362 | 3300025735 | Bacteria | 10971 |
| 172 | Ga0207713_1005180 | 3300025735 | Bacteria | 8236 |
| 173 | Ga0207713_1005193 | 3300025735 | Bacteria | 8222 |
| 174 | Ga0207713_1018540 | 3300025735 | Bacteria | 3441 |
| 175 | Ga0207713_1023472 | 3300025735 | Bacteria | 2902 |
| 176 | Ga0207713_1037223 | 3300025735 | Bacteria | 2077 |
| 177 | Ga0207713_1049875 | 3300025735 | Bacteria | 1675 |
| 178 | Ga0207671_10000989 | 3300025914 | Bacteria | 35031 |
| 179 | Ga0207649_10000041 | 3300025920 | Bacteria | 117781 |
| 180 | Ga0207681_10002768 | 3300025923 | Bacteria | 11087 |
| 181 | Ga0207650_10000174 | 3300025925 | Bacteria | 75634 |
| 182 | Ga0207650_10001409 | 3300025925 | Bacteria | 17327 |
| 183 | Ga0207706_10002445 | 3300025933 | Bacteria | 18134 |
| 184 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 185 | Ga0207709_10000821 | 3300025935 | Bacteria | 24022 |
| 186 | Ga0207709_10067235 | 3300025935 | Bacteria | 2261 |
| 187 | Ga0207679_10000018 | 3300025945 | Bacteria | 238375 |
| 188 | Ga0209281_1000018 | 3300027111 | Bacteria | 579091 |
| 189 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 190 | Ga0209281_1003944 | 3300027111 | Bacteria | 4612 |
| 191 | Ga0209371_1000237 | 3300027312 | Bacteria | 69091 |
| 192 | Ga0209371_1000412 | 3300027312 | Bacteria | 44123 |
| 193 | Ga0207428_10019213 | 3300027907 | Bacteria | 5827 |
| 194 | Ga0207428_10047817 | 3300027907 | Bacteria | 3435 |
| 195 | Ga0207428_10068251 | 3300027907 | Bacteria | 2798 |
| 196 | Ga0207428_10081090 | 3300027907 | Bacteria | 2534 |
| 197 | Ga0268266_10067858 | 3300028379 | Bacteria | 3087 |
| 198 | Ga0268266_10201429 | 3300028379 | Bacteria | 1822 |
| 199 | Ga0268256_1000485 | 3300030500 | Bacteria | 34065 |
| 200 | Ga0268256_1000486 | 3300030500 | Bacteria | 33974 |
| 201 | Ga0314311_1116939 | 3300030733 | Bacteria | 3490 |
| 202 | Ga0316179_1034474 | 3300030734 | Bacteria | 3546 |
| 203 | Ga0316178_1126744 | 3300030735 | Bacteria | 26718 |
| 204 | Ga0307408_100000004 | 3300031548 | Bacteria | 572889 |
| 205 | Ga0307408_100043312 | 3300031548 | Bacteria | 3202 |
| 206 | Ga0307408_100057473 | 3300031548 | Bacteria | 2824 |
| 207 | Ga0307405_10003193 | 3300031731 | Bacteria | 7464 |
| 208 | Ga0307405_10031515 | 3300031731 | Bacteria | 3122 |
| 209 | Ga0307413_10205928 | 3300031824 | Bacteria | 1424 |
| 210 | Ga0307406_10034858 | 3300031901 | Bacteria | 3090 |
| 211 | Ga0307412_10033335 | 3300031911 | Bacteria | 3272 |
| 212 | Ga0307412_10125213 | 3300031911 | Bacteria | 1857 |
| 213 | Ga0307409_100359645 | 3300031995 | Bacteria | 1376 |
| 214 | Ga0307416_100121382 | 3300032002 | Bacteria | 2330 |
| 215 | Ga0307414_10360013 | 3300032004 | Bacteria | 1251 |
| 216 | Ga0307411_10080812 | 3300032005 | Bacteria | 2236 |
| 217 | Ga0307411_10251205 | 3300032005 | Bacteria | 1390 |
| 218 | Ga0307510_10007567 | 3300033180 | Bacteria | 12944 |
| 219 | Ga0237819_01237 | 3300038705 | Bacteria | 7066 |
| 220 | Ga0439438_003561 | 3300041405 | Bacteria | 6250 |
| 221 | Ga0439438_009727 | 3300041405 | Bacteria | 3093 |
| 222 | Ga0439438_012314 | 3300041405 | Bacteria | 2625 |
| 223 | Ga0439438_012621 | 3300041405 | Bacteria | 2584 |
| 224 | Ga0439438_025060 | 3300041405 | Bacteria | 1628 |
| 225 | Ga0439438_036182 | 3300041405 | Bacteria | 1295 |
| 226 | Ga0439447_010218 | 3300041407 | Bacteria | 2796 |
| 227 | Ga0439447_010590 | 3300041407 | Bacteria | 2730 |
| 228 | Ga0439447_016024 | 3300041407 | Bacteria | 2064 |
| 229 | Ga0439466_0002783 | 3300041411 | Bacteria | 6845 |
| 230 | Ga0439466_0008472 | 3300041411 | Bacteria | 3875 |
| 231 | Ga0439466_0008509 | 3300041411 | Bacteria | 3869 |
| 232 | Ga0439466_0014068 | 3300041411 | Bacteria | 2918 |
| 233 | Ga0439466_0026865 | 3300041411 | Bacteria | 1997 |
| 234 | Ga0439466_0028294 | 3300041411 | Bacteria | 1935 |
| 235 | Ga0439466_0030242 | 3300041411 | Bacteria | 1858 |
| 236 | Ga0439466_0033357 | 3300041411 | Bacteria | 1749 |
| 237 | Ga0439466_0044018 | 3300041411 | Bacteria | 1480 |
| 238 | Ga0439431_0006811 | 3300041997 | Bacteria | 2537 |
| 239 | Ga0439432_017486 | 3300042006 | Bacteria | 2406 |
| 240 | Ga0439432_032243 | 3300042006 | Bacteria | 1690 |
| 241 | Ga0439452_001600 | 3300042010 | Bacteria | 8942 |
| 242 | Ga0439452_002058 | 3300042010 | Bacteria | 7642 |
| 243 | Ga0439452_008170 | 3300042010 | Bacteria | 3165 |
| 244 | Ga0439452_010576 | 3300042010 | Bacteria | 2677 |
| 245 | Ga0439452_021412 | 3300042010 | Bacteria | 1685 |
| 246 | Ga0439456_002417 | 3300042013 | Bacteria | 3764 |
| 247 | Ga0439456_004928 | 3300042013 | Bacteria | 2706 |
| 248 | Ga0439456_004996 | 3300042013 | Bacteria | 2694 |
| 249 | Ga0439463_001279 | 3300042016 | Bacteria | 6715 |
| 250 | Ga0439463_039712 | 3300042016 | Bacteria | 1195 |
| 251 | Ga0450911_000111 | 3300042115 | Bacteria | 33827 |
| 252 | Ga0450911_002953 | 3300042115 | Bacteria | 3142 |
| 253 | Ga0450911_003808 | 3300042115 | Bacteria | 2584 |
| 254 | Ga0450920_003522 | 3300042122 | Bacteria | 2717 |
| 255 | Ga0450890_007074 | 3300042127 | Bacteria | 1430 |
| 256 | Ga0450902_003406 | 3300042137 | Bacteria | 2318 |
| 257 | Ga0450903_013028 | 3300042138 | Bacteria | 1324 |
| 258 | Ga0450904_000019 | 3300042139 | Bacteria | 39540 |
| 259 | Ga0450904_002558 | 3300042139 | Bacteria | 2130 |
| 260 | Ga0450905_005198 | 3300042142 | Bacteria | 1745 |
| 261 | Ga0450905_006150 | 3300042142 | Bacteria | 1621 |
| 262 | Ga0450906_008493 | 3300042145 | Bacteria | 1984 |
| 263 | Ga0450907_002272 | 3300042146 | Bacteria | 3727 |
| 264 | Ga0450907_006733 | 3300042146 | Bacteria | 1918 |
| 265 | Ga0450907_011390 | 3300042146 | Bacteria | 1476 |
| 266 | Ga0450910_002701 | 3300042147 | Bacteria | 2333 |
| 267 | Ga0439446_0005983 | 3300042156 | Bacteria | 3151 |
| 268 | Ga0439446_0006966 | 3300042156 | Bacteria | 2961 |
| 269 | Ga0450908_004883 | 3300042184 | Bacteria | 2576 |
| 270 | Ga0450909_000126 | 3300042185 | Bacteria | 7798 |
| 271 | Ga0450909_012466 | 3300042185 | Bacteria | 1247 |
| 272 | Ga0439434_0024725 | 3300042435 | Bacteria | 1812 |
| 273 | Ga0439460_0010970 | 3300042461 | Bacteria | 2330 |
| 274 | Ga0450901_000952 | 3300042533 | Bacteria | 3385 |
| 275 | Ga0450901_001756 | 3300042533 | Bacteria | 2436 |
| 276 | Ga0466969_0000928 | 3300044656 | Bacteria | 15826 |
| 277 | Ga0466966_0001527 | 3300044684 | Bacteria | 14840 |
| 278 | Ga0466961_0000036 | 3300044693 | Bacteria | 81498 |
| 279 | Ga0466959_0002824 | 3300045049 | Bacteria | 11188 |
| 280 | Ga0466959_0049607 | 3300045049 | Bacteria | 3084 |
| 281 | Ga0495617_010279 | 3300046452 | Bacteria | 3204 |
| 282 | Ga0495617_011394 | 3300046452 | Bacteria | 3033 |
| 283 | Ga0495617_012372 | 3300046452 | Bacteria | 2907 |
| 284 | Ga0495617_013362 | 3300046452 | Bacteria | 2793 |
| 285 | Ga0495617_022531 | 3300046452 | Bacteria | 2129 |
| 286 | Ga0495617_023210 | 3300046452 | Bacteria | 2096 |
| 287 | Ga0495627_000152 | 3300046453 | Bacteria | 81535 |
| 288 | Ga0495627_000169 | 3300046453 | Bacteria | 74332 |
| 289 | Ga0495627_001562 | 3300046453 | Bacteria | 13009 |
| 290 | Ga0495627_012091 | 3300046453 | Bacteria | 3073 |
| 291 | Ga0495627_014275 | 3300046453 | Bacteria | 2776 |
| 292 | Ga0495627_032110 | 3300046453 | Bacteria | 1654 |
| 293 | Ga0495603_0033091 | 3300046455 | Bacteria | 3110 |
| 294 | Ga0495603_0098414 | 3300046455 | Bacteria | 1708 |
| 295 | Ga0495590_0013743 | 3300046457 | Bacteria | 2970 |
| 296 | Ga0495590_0016521 | 3300046457 | Bacteria | 2663 |
| 297 | Ga0495590_0021318 | 3300046457 | Bacteria | 2296 |
| 298 | Ga0495590_0041743 | 3300046457 | Bacteria | 1599 |
| 299 | Ga0495591_000128 | 3300046458 | Bacteria | 82830 |
| 300 | Ga0495591_003049 | 3300046458 | Bacteria | 8898 |
| 301 | Ga0495591_012170 | 3300046458 | Bacteria | 3214 |
| 302 | Ga0495591_013547 | 3300046458 | Bacteria | 2972 |
| 303 | Ga0495591_015710 | 3300046458 | Bacteria | 2664 |
| 304 | Ga0495591_015835 | 3300046458 | Bacteria | 2648 |
| 305 | Ga0495591_016211 | 3300046458 | Bacteria | 2606 |
| 306 | Ga0495591_021436 | 3300046458 | Bacteria | 2108 |
| 307 | Ga0495591_025130 | 3300046458 | Bacteria | 1873 |
| 308 | Ga0495591_026266 | 3300046458 | Bacteria | 1812 |
| 309 | Ga0495629_0056079 | 3300046459 | Bacteria | 2755 |
| 310 | Ga0495638_0007628 | 3300046460 | Bacteria | 7733 |
| 311 | Ga0495638_0007670 | 3300046460 | Bacteria | 7713 |
| 312 | Ga0495638_0034184 | 3300046460 | Bacteria | 3246 |
| 313 | Ga0495638_0051052 | 3300046460 | Bacteria | 2580 |
| 314 | Ga0495638_0051465 | 3300046460 | Bacteria | 2568 |
| 315 | Ga0495638_0053149 | 3300046460 | Bacteria | 2521 |
| 316 | Ga0495638_0062437 | 3300046460 | Bacteria | 2300 |
| 317 | Ga0495638_0071359 | 3300046460 | Bacteria | 2124 |
| 318 | Ga0495638_0076055 | 3300046460 | Bacteria | 2045 |
| 319 | Ga0495638_0099319 | 3300046460 | Bacteria | 1742 |
| 320 | Ga0495638_0157135 | 3300046460 | Bacteria | 1314 |
| 321 | Ga0495653_0013920 | 3300046463 | Bacteria | 6558 |
| 322 | Ga0495653_0054158 | 3300046463 | Bacteria | 3066 |
| 323 | Ga0495653_0071195 | 3300046463 | Bacteria | 2600 |
| 324 | Ga0495653_0118494 | 3300046463 | Bacteria | 1890 |
| 325 | Ga0495650_0003022 | 3300046471 | Bacteria | 12692 |
| 326 | Ga0495650_0020793 | 3300046471 | Bacteria | 3190 |
| 327 | Ga0495650_0021504 | 3300046471 | Bacteria | 3115 |
| 328 | Ga0495650_0025175 | 3300046471 | Bacteria | 2794 |
| 329 | Ga0495650_0027093 | 3300046471 | Bacteria | 2654 |
| 330 | Ga0495650_0027294 | 3300046471 | Bacteria | 2640 |
| 331 | Ga0495650_0038777 | 3300046471 | Bacteria | 2061 |
| 332 | Ga0495650_0081331 | 3300046471 | Bacteria | 1248 |
| 333 | Ga0495582_0025982 | 3300046473 | Bacteria | 3208 |
| 334 | Ga0495605_0000088 | 3300046474 | Bacteria | 119191 |
| 335 | Ga0495605_0001002 | 3300046474 | Bacteria | 19067 |
| 336 | Ga0495605_0024557 | 3300046474 | Bacteria | 3152 |
| 337 | Ga0495605_0032305 | 3300046474 | Bacteria | 2665 |
| 338 | Ga0495605_0033551 | 3300046474 | Bacteria | 2604 |
| 339 | Ga0495605_0034785 | 3300046474 | Bacteria | 2549 |
| 340 | Ga0495605_0043020 | 3300046474 | Bacteria | 2241 |
| 341 | Ga0495605_0064048 | 3300046474 | Bacteria | 1752 |
| 342 | Ga0495605_0066926 | 3300046474 | Bacteria | 1705 |
| 343 | Ga0495605_0119553 | 3300046474 | Bacteria | 1195 |
| 344 | Ga0495639_0001985 | 3300046475 | Bacteria | 9063 |
| 345 | Ga0495639_0102826 | 3300046475 | Bacteria | 1350 |
| 346 | Ga0495584_0023632 | 3300046491 | Bacteria | 3116 |
| 347 | Ga0495584_0030085 | 3300046491 | Bacteria | 2751 |
| 348 | Ga0495584_0037457 | 3300046491 | Bacteria | 2451 |
| 349 | Ga0495584_0048441 | 3300046491 | Bacteria | 2142 |
| 350 | Ga0495584_0053964 | 3300046491 | Bacteria | 2022 |
| 351 | Ga0495584_0071541 | 3300046491 | Bacteria | 1743 |
| 352 | Ga0495584_0118003 | 3300046491 | Bacteria | 1343 |
| 353 | Ga0495585_0006456 | 3300046492 | Bacteria | 7274 |
| 354 | Ga0495585_0036868 | 3300046492 | Bacteria | 2755 |
| 355 | Ga0495585_0039286 | 3300046492 | Bacteria | 2660 |
| 356 | Ga0495585_0071554 | 3300046492 | Bacteria | 1890 |
| 357 | Ga0495585_0094929 | 3300046492 | Bacteria | 1602 |
| 358 | Ga0495585_0129452 | 3300046492 | Bacteria | 1329 |
| 359 | Ga0495585_0142083 | 3300046492 | Bacteria | 1256 |
| 360 | Ga0495585_0145534 | 3300046492 | Bacteria | 1238 |
| 361 | Ga0495585_0151536 | 3300046492 | Bacteria | 1208 |
| 362 | Ga0495594_0000262 | 3300046499 | Bacteria | 25773 |
| 363 | Ga0495594_0057768 | 3300046499 | Bacteria | 2142 |
| 364 | Ga0495594_0090802 | 3300046499 | Bacteria | 1711 |
| 365 | Ga0495594_0129600 | 3300046499 | Bacteria | 1428 |
| 366 | Ga0495596_0002947 | 3300046500 | Bacteria | 8830 |
| 367 | Ga0495607_0000186 | 3300046501 | Bacteria | 66578 |
| 368 | Ga0495607_0000827 | 3300046501 | Bacteria | 29265 |
| 369 | Ga0495607_0007952 | 3300046501 | Bacteria | 7289 |
| 370 | Ga0495607_0015142 | 3300046501 | Bacteria | 5007 |
| 371 | Ga0495607_0015749 | 3300046501 | Bacteria | 4892 |
| 372 | Ga0495607_0033580 | 3300046501 | Bacteria | 3121 |
| 373 | Ga0495607_0042760 | 3300046501 | Bacteria | 2684 |
| 374 | Ga0495607_0044154 | 3300046501 | Bacteria | 2629 |
| 375 | Ga0495607_0047676 | 3300046501 | Bacteria | 2508 |
| 376 | Ga0495607_0052500 | 3300046501 | Bacteria | 2361 |
| 377 | Ga0495607_0063758 | 3300046501 | Bacteria | 2083 |
| 378 | Ga0495607_0076053 | 3300046501 | Bacteria | 1858 |
| 379 | Ga0495607_0089208 | 3300046501 | Bacteria | 1674 |
| 380 | Ga0495607_0091553 | 3300046501 | Bacteria | 1646 |
| 381 | Ga0495583_0000135 | 3300046506 | Bacteria | 123916 |
| 382 | Ga0495583_0001024 | 3300046506 | Bacteria | 31772 |
| 383 | Ga0495583_0002277 | 3300046506 | Bacteria | 16828 |
| 384 | Ga0495583_0016893 | 3300046506 | Bacteria | 3898 |
| 385 | Ga0495583_0028151 | 3300046506 | Bacteria | 2766 |
| 386 | Ga0495583_0030622 | 3300046506 | Bacteria | 2617 |
| 387 | Ga0495583_0031597 | 3300046506 | Bacteria | 2565 |
| 388 | Ga0495583_0058271 | 3300046506 | Bacteria | 1734 |
| 389 | Ga0495583_0069941 | 3300046506 | Bacteria | 1544 |
| 390 | Ga0495606_0000453 | 3300046507 | Bacteria | 67136 |
| 391 | Ga0495606_0012586 | 3300046507 | Bacteria | 6769 |
| 392 | Ga0495606_0016837 | 3300046507 | Bacteria | 5554 |
| 393 | Ga0495606_0041173 | 3300046507 | Bacteria | 3099 |
| 394 | Ga0495606_0042856 | 3300046507 | Bacteria | 3023 |
| 395 | Ga0495606_0048759 | 3300046507 | Bacteria | 2782 |
| 396 | Ga0495606_0054539 | 3300046507 | Bacteria | 2588 |
| 397 | Ga0495606_0073204 | 3300046507 | Bacteria | 2150 |
| 398 | Ga0495610_0008078 | 3300046512 | Bacteria | 6884 |
| 399 | Ga0495610_0025493 | 3300046512 | Bacteria | 3172 |
| 400 | Ga0495610_0027799 | 3300046512 | Bacteria | 3000 |
| 401 | Ga0495610_0028924 | 3300046512 | Bacteria | 2925 |
| 402 | Ga0495610_0034224 | 3300046512 | Bacteria | 2618 |
| 403 | Ga0495610_0035818 | 3300046512 | Bacteria | 2542 |
| 404 | Ga0495610_0038040 | 3300046512 | Bacteria | 2444 |
| 405 | Ga0495610_0054237 | 3300046512 | Bacteria | 1937 |
| 406 | Ga0495610_0068495 | 3300046512 | Bacteria | 1662 |
| 407 | Ga0495616_0002292 | 3300046513 | Bacteria | 12801 |
| 408 | Ga0495616_0008007 | 3300046513 | Bacteria | 6294 |
| 409 | Ga0495616_0034048 | 3300046513 | Bacteria | 2648 |
| 410 | Ga0495616_0034383 | 3300046513 | Bacteria | 2632 |
| 411 | Ga0495616_0035412 | 3300046513 | Bacteria | 2583 |
| 412 | Ga0495616_0036932 | 3300046513 | Bacteria | 2517 |
| 413 | Ga0495616_0047867 | 3300046513 | Bacteria | 2151 |
| 414 | Ga0495620_0000034 | 3300046515 | Bacteria | 117942 |
| 415 | Ga0495620_0004777 | 3300046515 | Bacteria | 7618 |
| 416 | Ga0495620_0020775 | 3300046515 | Bacteria | 3199 |
| 417 | Ga0495620_0027861 | 3300046515 | Bacteria | 2636 |
| 418 | Ga0495620_0060996 | 3300046515 | Bacteria | 1570 |
| 419 | Ga0495630_0067846 | 3300046517 | Bacteria | 2681 |
| 420 | Ga0495631_0006409 | 3300046518 | Bacteria | 6074 |
| 421 | Ga0495631_0019601 | 3300046518 | Bacteria | 3170 |
| 422 | Ga0495631_0025277 | 3300046518 | Bacteria | 2736 |
| 423 | Ga0495631_0026689 | 3300046518 | Bacteria | 2648 |
| 424 | Ga0495631_0026745 | 3300046518 | Bacteria | 2645 |
| 425 | Ga0495632_0000496 | 3300046519 | Bacteria | 37085 |
| 426 | Ga0495632_0006673 | 3300046519 | Bacteria | 7381 |
| 427 | Ga0495632_0012549 | 3300046519 | Bacteria | 4882 |
| 428 | Ga0495632_0027024 | 3300046519 | Bacteria | 3011 |
| 429 | Ga0495632_0030378 | 3300046519 | Bacteria | 2804 |
| 430 | Ga0495632_0031356 | 3300046519 | Bacteria | 2748 |
| 431 | Ga0495632_0032027 | 3300046519 | Bacteria | 2712 |
| 432 | Ga0495632_0034011 | 3300046519 | Bacteria | 2611 |
| 433 | Ga0495632_0035114 | 3300046519 | Bacteria | 2560 |
| 434 | Ga0495632_0036929 | 3300046519 | Bacteria | 2482 |
| 435 | Ga0495632_0039508 | 3300046519 | Bacteria | 2381 |
| 436 | Ga0495632_0050009 | 3300046519 | Bacteria | 2063 |
| 437 | Ga0495632_0051664 | 3300046519 | Bacteria | 2022 |
| 438 | Ga0495637_0001794 | 3300046520 | Bacteria | 12293 |
| 439 | Ga0495637_0002688 | 3300046520 | Bacteria | 9705 |
| 440 | Ga0495637_0012771 | 3300046520 | Bacteria | 4007 |
| 441 | Ga0495637_0022802 | 3300046520 | Bacteria | 2851 |
| 442 | Ga0495637_0024175 | 3300046520 | Bacteria | 2749 |
| 443 | Ga0495637_0024465 | 3300046520 | Bacteria | 2732 |
| 444 | Ga0495637_0026566 | 3300046520 | Bacteria | 2596 |
| 445 | Ga0495637_0039624 | 3300046520 | Bacteria | 2032 |
| 446 | Ga0495637_0057872 | 3300046520 | Bacteria | 1599 |
| 447 | Ga0495637_0085121 | 3300046520 | Bacteria | 1254 |
| 448 | Ga0495643_0000291 | 3300046522 | Bacteria | 71440 |
| 449 | Ga0495643_0009520 | 3300046522 | Bacteria | 6035 |
| 450 | Ga0495643_0041047 | 3300046522 | Bacteria | 2524 |
| 451 | Ga0495643_0046697 | 3300046522 | Bacteria | 2346 |
| 452 | Ga0495643_0068118 | 3300046522 | Bacteria | 1873 |
| 453 | Ga0495644_0013275 | 3300046523 | Bacteria | 3162 |
| 454 | Ga0495644_0017742 | 3300046523 | Bacteria | 2719 |
| 455 | Ga0495644_0024244 | 3300046523 | Bacteria | 2307 |
| 456 | Ga0495644_0076928 | 3300046523 | Bacteria | 1257 |
| 457 | Ga0495648_0001134 | 3300046524 | Bacteria | 26952 |
| 458 | Ga0495648_0010375 | 3300046524 | Bacteria | 7098 |
| 459 | Ga0495648_0010500 | 3300046524 | Bacteria | 7046 |
| 460 | Ga0495648_0047372 | 3300046524 | Bacteria | 2657 |
| 461 | Ga0495648_0059813 | 3300046524 | Bacteria | 2270 |
| 462 | Ga0495648_0060234 | 3300046524 | Bacteria | 2260 |
| 463 | Ga0495648_0097238 | 3300046524 | Bacteria | 1633 |
| 464 | Ga0495648_0105742 | 3300046524 | Bacteria | 1542 |
| 465 | Ga0495666_0007305 | 3300046526 | Bacteria | 5543 |
| 466 | Ga0495666_0032996 | 3300046526 | Bacteria | 2531 |
| 467 | Ga0495666_0104497 | 3300046526 | Bacteria | 1333 |
| 468 | Ga0495642_0000932 | 3300046528 | Bacteria | 13693 |
| 469 | Ga0495642_0015737 | 3300046528 | Bacteria | 2944 |
| 470 | Ga0495642_0018110 | 3300046528 | Bacteria | 2754 |
| 471 | Ga0495652_0072802 | 3300046529 | Bacteria | 2863 |
| 472 | Ga0495654_0001112 | 3300046530 | Bacteria | 19430 |
| 473 | Ga0495654_0004113 | 3300046530 | Bacteria | 8729 |
| 474 | Ga0495654_0011415 | 3300046530 | Bacteria | 4808 |
| 475 | Ga0495654_0022182 | 3300046530 | Bacteria | 3299 |
| 476 | Ga0495654_0026029 | 3300046530 | Bacteria | 3011 |
| 477 | Ga0495654_0027203 | 3300046530 | Bacteria | 2934 |
| 478 | Ga0495654_0029783 | 3300046530 | Bacteria | 2782 |
| 479 | Ga0495654_0033652 | 3300046530 | Bacteria | 2592 |
| 480 | Ga0495654_0037546 | 3300046530 | Bacteria | 2427 |
| 481 | Ga0495654_0042259 | 3300046530 | Bacteria | 2263 |
| 482 | Ga0495654_0048286 | 3300046530 | Bacteria | 2089 |
| 483 | Ga0495654_0073295 | 3300046530 | Bacteria | 1619 |
| 484 | Ga0495654_0102525 | 3300046530 | Bacteria | 1315 |
| 485 | Ga0495654_0103003 | 3300046530 | Bacteria | 1311 |
| 486 | Ga0495654_0112520 | 3300046530 | Bacteria | 1240 |
| 487 | Ga0495654_0112826 | 3300046530 | Bacteria | 1238 |
| 488 | Ga0495587_0043389 | 3300046536 | Bacteria | 2678 |
| 489 | Ga0495587_0085550 | 3300046536 | Bacteria | 1825 |
| 490 | Ga0495609_0000247 | 3300046538 | Bacteria | 51172 |
| 491 | Ga0495609_0027260 | 3300046538 | Bacteria | 2611 |
| 492 | Ga0495609_0027652 | 3300046538 | Bacteria | 2590 |
| 493 | Ga0495609_0029080 | 3300046538 | Bacteria | 2518 |
| 494 | Ga0495609_0080381 | 3300046538 | Bacteria | 1425 |
| 495 | Ga0495597_0000059 | 3300046542 | Bacteria | 92644 |
| 496 | Ga0495597_0000692 | 3300046542 | Bacteria | 27121 |
| 497 | Ga0495597_0023082 | 3300046542 | Bacteria | 2879 |
| 498 | Ga0495597_0025688 | 3300046542 | Bacteria | 2710 |
| 499 | Ga0495597_0028235 | 3300046542 | Bacteria | 2568 |
| 500 | Ga0495597_0046468 | 3300046542 | Bacteria | 1923 |
| 501 | Ga0495597_0069795 | 3300046542 | Bacteria | 1515 |
| 502 | Ga0495622_0019702 | 3300046557 | Bacteria | 3141 |
| 503 | Ga0495622_0023539 | 3300046557 | Bacteria | 2872 |
| 504 | Ga0495622_0028385 | 3300046557 | Bacteria | 2613 |
| 505 | Ga0495622_0038923 | 3300046557 | Bacteria | 2213 |
| 506 | Ga0495633_0000468 | 3300046558 | Bacteria | 41323 |
| 507 | Ga0495633_0022860 | 3300046558 | Bacteria | 3102 |
| 508 | Ga0495656_0012220 | 3300046615 | Bacteria | 3163 |
| 509 | Ga0495668_0117634 | 3300046616 | Bacteria | 1453 |
| 510 | Ga0495634_0042607 | 3300046642 | Bacteria | 3078 |
| 511 | Ga0495611_0001045 | 3300046648 | Bacteria | 14647 |
| 512 | Ga0495611_0005778 | 3300046648 | Bacteria | 5279 |
| 513 | Ga0495611_0024210 | 3300046648 | Bacteria | 2640 |
| 514 | Ga0495611_0068989 | 3300046648 | Bacteria | 1614 |
| 515 | Ga0495611_0111163 | 3300046648 | Bacteria | 1275 |
| 516 | Ga0495625_0021451 | 3300046660 | Bacteria | 4975 |
| 517 | Ga0495625_0111690 | 3300046660 | Bacteria | 1867 |
| 518 | Ga0495625_0199241 | 3300046660 | Bacteria | 1322 |
| 519 | Ga0495625_0202911 | 3300046660 | Bacteria | 1307 |
| 520 | Ga0495635_0040084 | 3300046663 | Bacteria | 3237 |
| 521 | Ga0495635_0053856 | 3300046663 | Bacteria | 2771 |
| 522 | Ga0495659_0009531 | 3300046664 | Bacteria | 3101 |
| 523 | Ga0495659_0082318 | 3300046664 | Bacteria | 1223 |
| 524 | Ga0495661_0000078 | 3300046665 | Bacteria | 119097 |
| 525 | Ga0495661_0000359 | 3300046665 | Bacteria | 49499 |
| 526 | Ga0495661_0009655 | 3300046665 | Bacteria | 6610 |
| 527 | Ga0495661_0036423 | 3300046665 | Bacteria | 3081 |
| 528 | Ga0495661_0068298 | 3300046665 | Bacteria | 2085 |
| 529 | Ga0495661_0073412 | 3300046665 | Bacteria | 1993 |
| 530 | Ga0495661_0088550 | 3300046665 | Bacteria | 1767 |
| 531 | Ga0495661_0089374 | 3300046665 | Bacteria | 1756 |
| 532 | Ga0495661_0104859 | 3300046665 | Bacteria | 1584 |
| 533 | Ga0495661_0133100 | 3300046665 | Bacteria | 1360 |
| 534 | Ga0495661_0159655 | 3300046665 | Bacteria | 1211 |
| 535 | Ga0495588_0084004 | 3300046674 | Bacteria | 1663 |
| 536 | Ga0495588_0140771 | 3300046674 | Bacteria | 1274 |
| 537 | Ga0495623_0041257 | 3300046679 | Bacteria | 2944 |
| 538 | Ga0495623_0051655 | 3300046679 | Bacteria | 2599 |
| 539 | Ga0495646_0033608 | 3300046680 | Bacteria | 3188 |
| 540 | Ga0495669_0037429 | 3300046684 | Bacteria | 2147 |
| 541 | Ga0495613_0059030 | 3300046689 | Bacteria | 2813 |
| 542 | Ga0495613_0133482 | 3300046689 | Bacteria | 1777 |
| 543 | Ga0495624_0050948 | 3300046690 | Bacteria | 2621 |
| 544 | Ga0495670_0001176 | 3300046691 | Bacteria | 12714 |
| 545 | Ga0495670_0022477 | 3300046691 | Bacteria | 3113 |
| 546 | Ga0495670_0030209 | 3300046691 | Bacteria | 2691 |
| 547 | Ga0495670_0039117 | 3300046691 | Bacteria | 2365 |
| 548 | Ga0495670_0062205 | 3300046691 | Bacteria | 1878 |
| 549 | Ga0495671_0002181 | 3300046692 | Bacteria | 12475 |
| 550 | Ga0495671_0004069 | 3300046692 | Bacteria | 8827 |
| 551 | Ga0495671_0009691 | 3300046692 | Bacteria | 5371 |
| 552 | Ga0495671_0023614 | 3300046692 | Bacteria | 3211 |
| 553 | Ga0495671_0025413 | 3300046692 | Bacteria | 3078 |
| 554 | Ga0495671_0026951 | 3300046692 | Bacteria | 2972 |
| 555 | Ga0495671_0032819 | 3300046692 | Bacteria | 2648 |
| 556 | Ga0495671_0035802 | 3300046692 | Bacteria | 2519 |
| 557 | Ga0495671_0040740 | 3300046692 | Bacteria | 2341 |
| 558 | Ga0495671_0046838 | 3300046692 | Bacteria | 2161 |
| 559 | Ga0495671_0050018 | 3300046692 | Bacteria | 2082 |
| 560 | Ga0495671_0050589 | 3300046692 | Bacteria | 2068 |
| 561 | Ga0495671_0060052 | 3300046692 | Bacteria | 1877 |
| 562 | Ga0495649_0000610 | 3300046694 | Bacteria | 29797 |
| 563 | Ga0495649_0008901 | 3300046694 | Bacteria | 6007 |
| 564 | Ga0495649_0028085 | 3300046694 | Bacteria | 3118 |
| 565 | Ga0495649_0031677 | 3300046694 | Bacteria | 2914 |
| 566 | Ga0495649_0035392 | 3300046694 | Bacteria | 2746 |
| 567 | Ga0495649_0036931 | 3300046694 | Bacteria | 2683 |
| 568 | Ga0495649_0058033 | 3300046694 | Bacteria | 2086 |
| 569 | Ga0495649_0078390 | 3300046694 | Bacteria | 1767 |
| 570 | Ga0495649_0094930 | 3300046694 | Bacteria | 1587 |
| 571 | Ga0495649_0106763 | 3300046694 | Bacteria | 1486 |
| 572 | Ga0495649_0112709 | 3300046694 | Bacteria | 1441 |
| 573 | Ga0495649_0140474 | 3300046694 | Bacteria | 1271 |
| 574 | Ga0495589_0000534 | 3300046794 | Bacteria | 26598 |
| 575 | Ga0495589_0003758 | 3300046794 | Bacteria | 8168 |
| 576 | Ga0495589_0029162 | 3300046794 | Bacteria | 2781 |
| 577 | Ga0495589_0031153 | 3300046794 | Bacteria | 2685 |
| 578 | Ga0495589_0032200 | 3300046794 | Bacteria | 2636 |
| 579 | Ga0495589_0037268 | 3300046794 | Bacteria | 2436 |
| 580 | Ga0495589_0039260 | 3300046794 | Bacteria | 2366 |
| 581 | Ga0495600_0090800 | 3300046809 | Bacteria | 1992 |
| 582 | Ga0495660_0001075 | 3300046810 | Bacteria | 19588 |
| 583 | Ga0495660_0001494 | 3300046810 | Bacteria | 15817 |
| 584 | Ga0495660_0002049 | 3300046810 | Bacteria | 13106 |
| 585 | Ga0495660_0034912 | 3300046810 | Bacteria | 2811 |
| 586 | Ga0495660_0035999 | 3300046810 | Bacteria | 2762 |
| 587 | Ga0495660_0049842 | 3300046810 | Bacteria | 2283 |
| 588 | Ga0495660_0052180 | 3300046810 | Bacteria | 2222 |
| 589 | Ga0495660_0069648 | 3300046810 | Bacteria | 1869 |
| 590 | Ga0495660_0074217 | 3300046810 | Bacteria | 1797 |
| 591 | Ga0495660_0075495 | 3300046810 | Bacteria | 1778 |
| 592 | Ga0495660_0095243 | 3300046810 | Bacteria | 1540 |
| 593 | Ga0495581_0081596 | 3300047315 | Bacteria | 1872 |
| 594 | Ga0495581_0155488 | 3300047315 | Bacteria | 1336 |
| 595 | Ga0495604_0055239 | 3300047317 | Bacteria | 3061 |
| 596 | Ga0495636_0014202 | 3300047318 | Bacteria | 3166 |
| 597 | Ga0495674_0072281 | 3300047319 | Bacteria | 2975 |
| 598 | Ga0495672_0006371 | 3300047320 | Bacteria | 9167 |
| 599 | Ga0495672_0042947 | 3300047320 | Bacteria | 2721 |
| 600 | Ga0495672_0044092 | 3300047320 | Bacteria | 2677 |
| 601 | Ga0495672_0044515 | 3300047320 | Bacteria | 2663 |
| 602 | Ga0495672_0045485 | 3300047320 | Bacteria | 2626 |
| 603 | Ga0495672_0049407 | 3300047320 | Bacteria | 2489 |
| 604 | Ga0495672_0056659 | 3300047320 | Bacteria | 2278 |
| 605 | Ga0495672_0060693 | 3300047320 | Bacteria | 2182 |
| 606 | Ga0495672_0069889 | 3300047320 | Bacteria | 1992 |
| 607 | Ga0495672_0120938 | 3300047320 | Bacteria | 1392 |
| 608 | Ga0495680_0009294 | 3300047322 | Bacteria | 8855 |
| 609 | Ga0495680_0055198 | 3300047322 | Bacteria | 3082 |
| 610 | Ga0495680_0123274 | 3300047322 | Bacteria | 1911 |
| 611 | Ga0495680_0180363 | 3300047322 | Bacteria | 1524 |
| 612 | Ga0495683_0000409 | 3300047323 | Bacteria | 34478 |
| 613 | Ga0495683_0023630 | 3300047323 | Bacteria | 3158 |
| 614 | Ga0495683_0026477 | 3300047323 | Bacteria | 2967 |
| 615 | Ga0495683_0028687 | 3300047323 | Bacteria | 2844 |
| 616 | Ga0495683_0032346 | 3300047323 | Bacteria | 2664 |
| 617 | Ga0495687_017772 | 3300047443 | Bacteria | 3532 |
| 618 | Ga0495687_021761 | 3300047443 | Bacteria | 3092 |
| 619 | Ga0495687_023299 | 3300047443 | Bacteria | 2958 |
| 620 | Ga0495687_029792 | 3300047443 | Bacteria | 2520 |
| 621 | Ga0495675_0066999 | 3300047444 | Bacteria | 2269 |
| 622 | Ga0495677_0016142 | 3300047445 | Bacteria | 2709 |
| 623 | Ga0495679_000417 | 3300047446 | Bacteria | 31474 |
| 624 | Ga0495679_004078 | 3300047446 | Bacteria | 6846 |
| 625 | Ga0495679_017603 | 3300047446 | Bacteria | 2555 |
| 626 | Ga0495679_019895 | 3300047446 | Bacteria | 2348 |
| 627 | Ga0495685_017632 | 3300047447 | Bacteria | 2446 |
| 628 | Ga0495685_026843 | 3300047447 | Bacteria | 1981 |
| 629 | Ga0495673_0007780 | 3300047469 | Bacteria | 6108 |
| 630 | Ga0495673_0021249 | 3300047469 | Bacteria | 3210 |
| 631 | Ga0495673_0022309 | 3300047469 | Bacteria | 3105 |
| 632 | Ga0495673_0023833 | 3300047469 | Bacteria | 2968 |
| 633 | Ga0495673_0025187 | 3300047469 | Bacteria | 2860 |
| 634 | Ga0495673_0027187 | 3300047469 | Bacteria | 2725 |
| 635 | Ga0495673_0038335 | 3300047469 | Bacteria | 2181 |
| 636 | Ga0495673_0084558 | 3300047469 | Bacteria | 1307 |
| 637 | Ga0495681_0006487 | 3300047470 | Bacteria | 7684 |
| 638 | Ga0495681_0008990 | 3300047470 | Bacteria | 6199 |
| 639 | Ga0495681_0028400 | 3300047470 | Bacteria | 2878 |
| 640 | Ga0495681_0029334 | 3300047470 | Bacteria | 2816 |
| 641 | Ga0495681_0029766 | 3300047470 | Bacteria | 2789 |
| 642 | Ga0495681_0029932 | 3300047470 | Bacteria | 2780 |
| 643 | Ga0495681_0029968 | 3300047470 | Bacteria | 2777 |
| 644 | Ga0495681_0033212 | 3300047470 | Bacteria | 2588 |
| 645 | Ga0495681_0033268 | 3300047470 | Bacteria | 2584 |
| 646 | Ga0495681_0034761 | 3300047470 | Bacteria | 2508 |
| 647 | Ga0495681_0037465 | 3300047470 | Bacteria | 2387 |
| 648 | Ga0495681_0038664 | 3300047470 | Bacteria | 2336 |
| 649 | Ga0495681_0039112 | 3300047470 | Bacteria | 2318 |
| 650 | Ga0495681_0090593 | 3300047470 | Bacteria | 1351 |
| 651 | Ga0495686_0035868 | 3300047472 | Bacteria | 3185 |
| 652 | Ga0495686_0041293 | 3300047472 | Bacteria | 2937 |
| 653 | Ga0495686_0045948 | 3300047472 | Bacteria | 2762 |
| 654 | Ga0495686_0117995 | 3300047472 | Bacteria | 1584 |
| 655 | Ga0495686_0189450 | 3300047472 | Bacteria | 1186 |
| 656 | Ga0495593_0036920 | 3300047673 | Bacteria | 2646 |
| 657 | Ga0495593_0067271 | 3300047673 | Bacteria | 1865 |
| 658 | Ga0495602_0087996 | 3300048088 | Bacteria | 2586 |
| 659 | Ga0495626_0004242 | 3300048091 | Bacteria | 8859 |
| 660 | Ga0495626_0005262 | 3300048091 | Bacteria | 7647 |
| 661 | Ga0495626_0023401 | 3300048091 | Bacteria | 3042 |
| 662 | Ga0495626_0028155 | 3300048091 | Bacteria | 2726 |
| 663 | Ga0495626_0028439 | 3300048091 | Bacteria | 2710 |
| 664 | Ga0495626_0030485 | 3300048091 | Bacteria | 2601 |
| 665 | Ga0495626_0045829 | 3300048091 | Bacteria | 2039 |
| 666 | Ga0496102_0073025 | 3300048905 | Bacteria | 3153 |
| 667 | Ga0496103_0037628 | 3300048906 | Bacteria | 2965 |
| 668 | Ga0496110_0011753 | 3300048913 | Bacteria | 7184 |
| 669 | Ga0496111_0130941 | 3300048914 | Bacteria | 1856 |
| 670 | Ga0496114_0133724 | 3300048917 | Bacteria | 2143 |
| 671 | Ga0496116_0000532 | 3300048919 | Bacteria | 51124 |
| 672 | Ga0496116_0004803 | 3300048919 | Bacteria | 12755 |
| 673 | Ga0496116_0008407 | 3300048919 | Bacteria | 8960 |
| 674 | Ga0496116_0081774 | 3300048919 | Bacteria | 2001 |
| 675 | Ga0496117_0009614 | 3300048920 | Bacteria | 8953 |
| 676 | Ga0496117_0009811 | 3300048920 | Bacteria | 8823 |
| 677 | Ga0496117_0154892 | 3300048920 | Bacteria | 1351 |
| 678 | Ga0496118_0031718 | 3300048921 | Bacteria | 4373 |
| 679 | Ga0496118_0068523 | 3300048921 | Bacteria | 2576 |
| 680 | Ga0496118_0075693 | 3300048921 | Bacteria | 2399 |
| 681 | Ga0496118_0079743 | 3300048921 | Bacteria | 2308 |
| 682 | Ga0496120_0032535 | 3300048923 | Bacteria | 3143 |
| 683 | Ga0496120_0039433 | 3300048923 | Bacteria | 2786 |
| 684 | Ga0496121_0001218 | 3300048924 | Bacteria | 44832 |
| 685 | Ga0496121_0092571 | 3300048924 | Bacteria | 2356 |
| 686 | Ga0496121_0144818 | 3300048924 | Bacteria | 1757 |
| 687 | Ga0496121_0301302 | 3300048924 | Bacteria | 1087 |
| 688 | Ga0496122_0011822 | 3300048925 | Bacteria | 8777 |
| 689 | Ga0496122_0029267 | 3300048925 | Bacteria | 4649 |
| 690 | Ga0496122_0062670 | 3300048925 | Bacteria | 2720 |
| 691 | Ga0496122_0066210 | 3300048925 | Bacteria | 2612 |
| 692 | Ga0496122_0081146 | 3300048925 | Bacteria | 2259 |
| 693 | Ga0496122_0164285 | 3300048925 | Bacteria | 1348 |
| 694 | Ga0496123_0009410 | 3300048926 | Bacteria | 8801 |
| 695 | Ga0496123_0076428 | 3300048926 | Bacteria | 2061 |
| 696 | Ga0496123_0104869 | 3300048926 | Bacteria | 1633 |
| 697 | Ga0496123_0161524 | 3300048926 | Bacteria | 1194 |
| 698 | Ga0496123_0161780 | 3300048926 | Bacteria | 1192 |
| 699 | Ga0496124_0000658 | 3300048927 | Bacteria | 56989 |
| 700 | Ga0496124_0006635 | 3300048927 | Bacteria | 12557 |
| 701 | Ga0496124_0015829 | 3300048927 | Bacteria | 7205 |
| 702 | Ga0496124_0017179 | 3300048927 | Bacteria | 6833 |
| 703 | Ga0496124_0062022 | 3300048927 | Bacteria | 3130 |
| 704 | Ga0496124_0097717 | 3300048927 | Bacteria | 2384 |
| 705 | Ga0496124_0173931 | 3300048927 | Bacteria | 1664 |
| 706 | Ga0496124_0219866 | 3300048927 | Bacteria | 1429 |
| 707 | Ga0496125_0011496 | 3300048928 | Bacteria | 8849 |
| 708 | Ga0496125_0018304 | 3300048928 | Bacteria | 6656 |
| 709 | Ga0496125_0018409 | 3300048928 | Bacteria | 6634 |
| 710 | Ga0496125_0061391 | 3300048928 | Bacteria | 3014 |
| 711 | Ga0496125_0064361 | 3300048928 | Bacteria | 2914 |
| 712 | Ga0496125_0081711 | 3300048928 | Bacteria | 2467 |
| 713 | Ga0496125_0134026 | 3300048928 | Bacteria | 1737 |
| 714 | Ga0496125_0222808 | 3300048928 | Bacteria | 1213 |
| 715 | Ga0496126_0037424 | 3300048929 | Bacteria | 4528 |
| 716 | Ga0496126_0070023 | 3300048929 | Bacteria | 3126 |
| 717 | Ga0496126_0113263 | 3300048929 | Bacteria | 2361 |
| 718 | Ga0495678_000081 | 3300049459 | Bacteria | 118700 |
| 719 | Ga0495678_020360 | 3300049459 | Bacteria | 2940 |
| 720 | Ga0495678_025095 | 3300049459 | Bacteria | 2564 |
| 721 | Ga0495678_032517 | 3300049459 | Bacteria | 2162 |
| 722 | Ga0495678_033009 | 3300049459 | Bacteria | 2140 |
| 723 | Ga0495678_038527 | 3300049459 | Bacteria | 1933 |
| 724 | Ga0495678_042255 | 3300049459 | Bacteria | 1818 |
| 725 | Ga0495678_064892 | 3300049459 | Bacteria | 1357 |
| 726 | Ga0495682_0015572 | 3300049460 | Bacteria | 2880 |
| 727 | Ga0495682_0016504 | 3300049460 | Bacteria | 2794 |
| 728 | Ga0495682_0016685 | 3300049460 | Bacteria | 2778 |
| 729 | Ga0495682_0033487 | 3300049460 | Bacteria | 1896 |
| 730 | Ga0495682_0035541 | 3300049460 | Bacteria | 1835 |
| 731 | Ga0501226_000009 | 3300049853 | Bacteria | 194138 |
| 732 | Ga0500650_0000086 | 3300053098 | Bacteria | 26596 |
| 733 | Ga0500572_006879 | 3300053111 | Bacteria | 2616 |
| 734 | Ga0500573_0061631 | 3300053140 | Bacteria | 2148 |
| 735 | Ga0500622_0003419 | 3300053156 | Bacteria | 10646 |
| 736 | Ga0500634_0026560 | 3300053161 | Bacteria | 3153 |
| 737 | Ga0500661_003227 | 3300055283 | Bacteria | 3071 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047470 | Ga0495681_0029932 | Ga0495681_0029932_333_1277 | 314 |
| 2 | 3300048924 | Ga0496121_0301302 | Ga0496121_0301302_21_1070 | 331 |
| 3 | 3300048913 | Ga0496110_0011753 | Ga0496110_0011753_5478_6701 | 335 |
| 4 | 3300048927 | Ga0496124_0006635 | Ga0496124_0006635_11095_12318 | 335 |
| 5 | 3300048928 | Ga0496125_0081711 | Ga0496125_0081711_157_1380 | 335 |
| 6 | 3300048929 | Ga0496126_0037424 | Ga0496126_0037424_3131_4354 | 335 |
| 7 | 3300053156 | Ga0500622_0003419 | Ga0500622_0003419_7322_8380 | 340 |
| 8 | 3300003771 | Ga0055526_1019534 | Ga0055526_10195342 | 346 |
| 9 | 3300025295 | Ga0209564_1000005 | Ga0209564_1000005814 | 346 |
| 10 | 3300002737 | JGI25162J39368_1001980 | JGI25162J39368_10019801 | 347 |
| 11 | 3300002771 | JGI25163J39215_1001687 | JGI25163J39215_10016871 | 347 |
| 12 | 3300002772 | JGI25164J39214_1000968 | JGI25164J39214_10009681 | 347 |
| 13 | 3300003214 | JGI25165J46597_1000362 | JGI25165J46597_100036252 | 347 |
| 14 | 3300009148 | Ga0105243_10006610 | Ga0105243_100066101 | 347 |
| 15 | 3300014497 | Ga0182008_10000220 | Ga0182008_100002201 | 347 |
| 16 | 3300025207 | Ga0209760_100266 | Ga0209760_10026614 | 347 |
| 17 | 3300025231 | Ga0207427_100074 | Ga0207427_100074120 | 347 |
| 18 | 3300025233 | Ga0209437_100006 | Ga0209437_100006121 | 347 |
| 19 | 3300025261 | Ga0209233_1000105 | Ga0209233_1000105102 | 347 |
| 20 | 3300025935 | Ga0207709_10000821 | Ga0207709_100008215 | 347 |
| 21 | 3300048919 | Ga0496116_0000532 | Ga0496116_0000532_49898_51031 | 347 |
| 22 | 3300048920 | Ga0496117_0009614 | Ga0496117_0009614_7728_8861 | 347 |
| 23 | 3300048921 | Ga0496118_0031718 | Ga0496118_0031718_3157_4290 | 347 |
| 24 | 3300048924 | Ga0496121_0001218 | Ga0496121_0001218_98_1231 | 347 |
| 25 | 3300048925 | Ga0496122_0011822 | Ga0496122_0011822_7551_8684 | 347 |
| 26 | 3300048926 | Ga0496123_0009410 | Ga0496123_0009410_81_1214 | 347 |
| 27 | 3300041405 | Ga0439438_003561 | Ga0439438_003561_254_1387 | 354 |
| 28 | 3300046474 | Ga0495605_0119553 | Ga0495605_0119553_11_1111 | 355 |
| 29 | 3300005344 | Ga0070661_100001382 | Ga0070661_10000138213 | 358 |
| 30 | 3300005564 | Ga0070664_100005010 | Ga0070664_10000501011 | 358 |
| 31 | 3300009036 | Ga0105244_10001906 | Ga0105244_1000190611 | 358 |
| 32 | 3300009176 | Ga0105242_10002363 | Ga0105242_1000236314 | 358 |
| 33 | 3300009545 | Ga0105237_10001117 | Ga0105237_1000111728 | 358 |
| 34 | 3300011119 | Ga0105246_10042404 | Ga0105246_100424043 | 358 |
| 35 | 3300013104 | Ga0157370_10011567 | Ga0157370_1001156710 | 358 |
| 36 | 3300013105 | Ga0157369_10027324 | Ga0157369_100273244 | 358 |
| 37 | 3300013308 | Ga0157375_10128203 | Ga0157375_101282034 | 358 |
| 38 | 3300025728 | Ga0207655_1000654 | Ga0207655_100065428 | 358 |
| 39 | 3300025914 | Ga0207671_10000989 | Ga0207671_1000098928 | 358 |
| 40 | 3300025920 | Ga0207649_10000041 | Ga0207649_1000004111 | 358 |
| 41 | 3300025945 | Ga0207679_10000018 | Ga0207679_1000001828 | 358 |
| 42 | 3300030733 | Ga0314311_1116939 | Ga0314311_11169393 | 358 |
| 43 | 3300031548 | Ga0307408_100043312 | Ga0307408_1000433124 | 358 |
| 44 | 3300031731 | Ga0307405_10003193 | Ga0307405_100031939 | 358 |
| 45 | 3300031824 | Ga0307413_10205928 | Ga0307413_102059281 | 358 |
| 46 | 3300031911 | Ga0307412_10125213 | Ga0307412_101252132 | 358 |
| 47 | 3300031995 | Ga0307409_100359645 | Ga0307409_1003596452 | 358 |
| 48 | 3300032002 | Ga0307416_100121382 | Ga0307416_1001213824 | 358 |
| 49 | 3300048928 | Ga0496125_0061391 | Ga0496125_0061391_1701_2834 | 358 |
| 50 | 3300005288 | Ga0065714_10073020 | Ga0065714_100730201 | 359 |
| 51 | 3300009148 | Ga0105243_10067654 | Ga0105243_100676543 | 359 |
| 52 | 3300013100 | Ga0157373_10053495 | Ga0157373_100534951 | 359 |
| 53 | 3300046453 | Ga0495627_000169 | Ga0495627_000169_1390_2553 | 359 |
| 54 | 3300046460 | Ga0495638_0007628 | Ga0495638_0007628_17_1159 | 359 |
| 55 | 3300046471 | Ga0495650_0038777 | Ga0495650_0038777_805_1968 | 359 |
| 56 | 3300046471 | Ga0495650_0081331 | Ga0495650_0081331_89_1231 | 359 |
| 57 | 3300046518 | Ga0495631_0006409 | Ga0495631_0006409_4719_5882 | 359 |
| 58 | 3300046530 | Ga0495654_0011415 | Ga0495654_0011415_248_1411 | 359 |
| 59 | 3300046692 | Ga0495671_0004069 | Ga0495671_0004069_3581_4744 | 359 |
| 60 | 3300047470 | Ga0495681_0034761 | Ga0495681_0034761_1255_2397 | 359 |
| 61 | 3300047320 | Ga0495672_0069889 | Ga0495672_0069889_438_1601 | 360 |
| 62 | 3300005290 | Ga0065712_10076344 | Ga0065712_100763442 | 362 |
| 63 | 3300009011 | Ga0105251_10076599 | Ga0105251_100765992 | 362 |
| 64 | 3300025735 | Ga0207713_1003362 | Ga0207713_10033624 | 362 |
| 65 | 3300028379 | Ga0268266_10201429 | Ga0268266_102014292 | 362 |
| 66 | 3300031731 | Ga0307405_10031515 | Ga0307405_100315154 | 362 |
| 67 | iso_pu_bacteria | 2823421272 | 2823423605 | 362 |
| 68 | iso_pu_bacteria | 2919501602 | 2919503452 | 362 |
| 69 | iso_pu_bacteria | 2926063275 | 2926065977 | 362 |
| 70 | 3300009092 | Ga0105250_10030721 | Ga0105250_100307211 | 363 |
| 71 | 3300048914 | Ga0496111_0130941 | Ga0496111_0130941_50_1165 | 363 |
| 72 | 3300013102 | Ga0157371_10000539 | Ga0157371_1000053948 | 364 |
| 73 | 3300013308 | Ga0157375_10091637 | Ga0157375_100916374 | 364 |
| 74 | 3300046455 | Ga0495603_0098414 | Ga0495603_0098414_44_1186 | 364 |
| 75 | 3300046457 | Ga0495590_0016521 | Ga0495590_0016521_1465_2607 | 364 |
| 76 | 3300046474 | Ga0495605_0024557 | Ga0495605_0024557_1906_3048 | 364 |
| 77 | 3300046512 | Ga0495610_0034224 | Ga0495610_0034224_1404_2546 | 364 |
| 78 | 3300046523 | Ga0495644_0076928 | Ga0495644_0076928_46_1188 | 364 |
| 79 | 3300046528 | Ga0495642_0000932 | Ga0495642_0000932_1485_2627 | 364 |
| 80 | 3300046530 | Ga0495654_0073295 | Ga0495654_0073295_61_1203 | 364 |
| 81 | 3300046616 | Ga0495668_0117634 | Ga0495668_0117634_90_1232 | 364 |
| 82 | 3300046674 | Ga0495588_0140771 | Ga0495588_0140771_56_1198 | 364 |
| 83 | 3300046684 | Ga0495669_0037429 | Ga0495669_0037429_71_1213 | 364 |
| 84 | 3300046694 | Ga0495649_0036931 | Ga0495649_0036931_1459_2601 | 364 |
| 85 | 3300046794 | Ga0495589_0039260 | Ga0495589_0039260_55_1197 | 364 |
| 86 | 3300047320 | Ga0495672_0044515 | Ga0495672_0044515_1421_2563 | 364 |
| 87 | 3300047469 | Ga0495673_0023833 | Ga0495673_0023833_1804_2946 | 364 |
| 88 | iso_pu_bacteria | 2738541276 | 2738715570 | 365 |
| 89 | 3300031901 | Ga0307406_10034858 | Ga0307406_100348581 | 366 |
| 90 | 3300032005 | Ga0307411_10080812 | Ga0307411_100808123 | 366 |
| 91 | 3300046692 | Ga0495671_0002181 | Ga0495671_0002181_7758_8870 | 366 |
| 92 | 3300046492 | Ga0495585_0142083 | Ga0495585_0142083_136_1239 | 367 |
| 93 | 3300046492 | Ga0495585_0151536 | Ga0495585_0151536_88_1191 | 367 |
| 94 | 3300003781 | Ga0055536_1003164 | Ga0055536_10031641 | 368 |
| 95 | 3300025292 | Ga0209676_1000223 | Ga0209676_100022355 | 368 |
| 96 | 3300030734 | Ga0316179_1034474 | Ga0316179_10344744 | 368 |
| 97 | 3300030735 | Ga0316178_1126744 | Ga0316178_112674429 | 368 |
| 98 | 3300032004 | Ga0307414_10360013 | Ga0307414_103600131 | 368 |
| 99 | 3300042016 | Ga0439463_039712 | Ga0439463_039712_12_1154 | 368 |
| 100 | 3300046459 | Ga0495629_0056079 | Ga0495629_0056079_71_1213 | 368 |
| 101 | 3300046463 | Ga0495653_0054158 | Ga0495653_0054158_95_1237 | 368 |
| 102 | 3300046473 | Ga0495582_0025982 | Ga0495582_0025982_2034_3176 | 368 |
| 103 | 3300046475 | Ga0495639_0102826 | Ga0495639_0102826_60_1202 | 368 |
| 104 | 3300046526 | Ga0495666_0007305 | Ga0495666_0007305_4330_5472 | 368 |
| 105 | 3300046536 | Ga0495587_0043389 | Ga0495587_0043389_1437_2579 | 368 |
| 106 | 3300046663 | Ga0495635_0040084 | Ga0495635_0040084_65_1207 | 368 |
| 107 | 3300046680 | Ga0495646_0033608 | Ga0495646_0033608_1948_3090 | 368 |
| 108 | 3300046689 | Ga0495613_0059030 | Ga0495613_0059030_1637_2779 | 368 |
| 109 | 3300047315 | Ga0495581_0155488 | Ga0495581_0155488_169_1311 | 368 |
| 110 | 3300047317 | Ga0495604_0055239 | Ga0495604_0055239_1860_3002 | 368 |
| 111 | 3300047322 | Ga0495680_0009294 | Ga0495680_0009294_7610_8752 | 368 |
| 112 | 3300005548 | Ga0070665_100044913 | Ga0070665_1000449132 | 369 |
| 113 | 3300006058 | Ga0075432_10009655 | Ga0075432_100096552 | 369 |
| 114 | 3300009011 | Ga0105251_10007357 | Ga0105251_100073579 | 369 |
| 115 | 3300027907 | Ga0207428_10081090 | Ga0207428_100810904 | 369 |
| 116 | 3300028379 | Ga0268266_10067858 | Ga0268266_100678583 | 369 |
| 117 | 3300046460 | Ga0495638_0007670 | Ga0495638_0007670_6490_7623 | 369 |
| 118 | 3300046519 | Ga0495632_0032027 | Ga0495632_0032027_1500_2633 | 369 |
| 119 | 3300046692 | Ga0495671_0009691 | Ga0495671_0009691_95_1228 | 369 |
| 120 | 3300047323 | Ga0495683_0032346 | Ga0495683_0032346_70_1203 | 369 |
| 121 | 3300047469 | Ga0495673_0025187 | Ga0495673_0025187_1655_2788 | 369 |
| 122 | 3300048927 | Ga0496124_0017179 | Ga0496124_0017179_5598_6731 | 369 |
| 123 | 3300053098 | Ga0500650_0000086 | Ga0500650_0000086_6064_7245 | 369 |
| 124 | 3300013105 | Ga0157369_10128942 | Ga0157369_101289421 | 370 |
| 125 | 3300046458 | Ga0495591_015710 | Ga0495591_015710_1440_2582 | 370 |
| 126 | iso_pu_bacteria | 2606217733 | 2608381904 | 370 |
| 127 | iso_pu_bacteria | 2738543020 | 2739285316 | 370 |
| 128 | iso_pu_bacteria | 2738543021 | 2739290630 | 370 |
| 129 | iso_pu_bacteria | 3007252601 | 3007253080 | 370 |
| 130 | iso_pu_bacteria | 3007315729 | 3007318243 | 370 |
| 131 | 3300041405 | Ga0439438_025060 | Ga0439438_025060_396_1538 | 371 |
| 132 | 3300041405 | Ga0439438_036182 | Ga0439438_036182_80_1222 | 371 |
| 133 | 3300041411 | Ga0439466_0002783 | Ga0439466_0002783_5627_6769 | 371 |
| 134 | 3300041411 | Ga0439466_0033357 | Ga0439466_0033357_48_1190 | 371 |
| 135 | 3300042010 | Ga0439452_001600 | Ga0439452_001600_66_1247 | 371 |
| 136 | 3300042010 | Ga0439452_002058 | Ga0439452_002058_6464_7606 | 371 |
| 137 | 3300042013 | Ga0439456_004996 | Ga0439456_004996_58_1239 | 371 |
| 138 | 3300042137 | Ga0450902_003406 | Ga0450902_003406_1146_2288 | 371 |
| 139 | 3300046460 | Ga0495638_0099319 | Ga0495638_0099319_539_1681 | 371 |
| 140 | 3300046501 | Ga0495607_0033580 | Ga0495607_0033580_1951_3093 | 371 |
| 141 | 3300046519 | Ga0495632_0050009 | Ga0495632_0050009_64_1206 | 371 |
| 142 | 3300046522 | Ga0495643_0009520 | Ga0495643_0009520_100_1242 | 371 |
| 143 | 3300046542 | Ga0495597_0023082 | Ga0495597_0023082_54_1196 | 371 |
| 144 | 3300046665 | Ga0495661_0159655 | Ga0495661_0159655_30_1172 | 371 |
| 145 | 3300046810 | Ga0495660_0075495 | Ga0495660_0075495_603_1745 | 371 |
| 146 | 3300046810 | Ga0495660_0095243 | Ga0495660_0095243_340_1482 | 371 |
| 147 | 3300047470 | Ga0495681_0033212 | Ga0495681_0033212_1426_2568 | 371 |
| 148 | 3300047472 | Ga0495686_0189450 | Ga0495686_0189450_33_1175 | 371 |
| 149 | 3300049459 | Ga0495678_020360 | Ga0495678_020360_1752_2894 | 371 |
| 150 | iso_pu_bacteria | 2811994881 | 2812366277 | 371 |
| 151 | iso_pu_bacteria | 2923519811 | 2923520301 | 371 |
| 152 | iso_pu_bacteria | 8011350971 | 8011351807 | 371 |
| 153 | 3300003791 | Ga0055530_10037562 | Ga0055530_100375621 | 372 |
| 154 | 3300006058 | Ga0075432_10064265 | Ga0075432_100642651 | 372 |
| 155 | 3300009148 | Ga0105243_10186928 | Ga0105243_101869282 | 372 |
| 156 | 3300014497 | Ga0182008_10031546 | Ga0182008_100315462 | 372 |
| 157 | 3300025292 | Ga0209676_1015874 | Ga0209676_10158744 | 372 |
| 158 | 3300025298 | Ga0209050_1004712 | Ga0209050_10047121 | 372 |
| 159 | 3300025303 | Ga0209051_1021985 | Ga0209051_10219851 | 372 |
| 160 | 3300025728 | Ga0207655_1005310 | Ga0207655_10053105 | 372 |
| 161 | 3300025728 | Ga0207655_1065783 | Ga0207655_10657831 | 372 |
| 162 | 3300025735 | Ga0207713_1049875 | Ga0207713_10498752 | 372 |
| 163 | 3300025935 | Ga0207709_10067235 | Ga0207709_100672353 | 372 |
| 164 | 3300041411 | Ga0439466_0044018 | Ga0439466_0044018_293_1435 | 372 |
| 165 | 3300042010 | Ga0439452_008170 | Ga0439452_008170_82_1224 | 372 |
| 166 | 3300042013 | Ga0439456_004928 | Ga0439456_004928_1499_2641 | 372 |
| 167 | 3300042142 | Ga0450905_006150 | Ga0450905_006150_417_1559 | 372 |
| 168 | 3300042185 | Ga0450909_012466 | Ga0450909_012466_38_1180 | 372 |
| 169 | 3300042461 | Ga0439460_0010970 | Ga0439460_0010970_1150_2292 | 372 |
| 170 | 3300046452 | Ga0495617_012372 | Ga0495617_012372_68_1210 | 372 |
| 171 | 3300046453 | Ga0495627_032110 | Ga0495627_032110_450_1592 | 372 |
| 172 | 3300046457 | Ga0495590_0013743 | Ga0495590_0013743_1765_2907 | 372 |
| 173 | 3300046458 | Ga0495591_003049 | Ga0495591_003049_7655_8797 | 372 |
| 174 | 3300046458 | Ga0495591_021436 | Ga0495591_021436_876_2018 | 372 |
| 175 | 3300046460 | Ga0495638_0062437 | Ga0495638_0062437_91_1233 | 372 |
| 176 | 3300046460 | Ga0495638_0071359 | Ga0495638_0071359_916_2058 | 372 |
| 177 | 3300046463 | Ga0495653_0071195 | Ga0495653_0071195_1434_2576 | 372 |
| 178 | 3300046471 | Ga0495650_0020793 | Ga0495650_0020793_90_1232 | 372 |
| 179 | 3300046491 | Ga0495584_0048441 | Ga0495584_0048441_46_1188 | 372 |
| 180 | 3300046491 | Ga0495584_0053964 | Ga0495584_0053964_63_1205 | 372 |
| 181 | 3300046500 | Ga0495596_0002947 | Ga0495596_0002947_101_1243 | 372 |
| 182 | 3300046501 | Ga0495607_0015142 | Ga0495607_0015142_93_1235 | 372 |
| 183 | 3300046501 | Ga0495607_0044154 | Ga0495607_0044154_1436_2578 | 372 |
| 184 | 3300046501 | Ga0495607_0047676 | Ga0495607_0047676_25_1167 | 372 |
| 185 | 3300046501 | Ga0495607_0063758 | Ga0495607_0063758_911_2053 | 372 |
| 186 | 3300046506 | Ga0495583_0058271 | Ga0495583_0058271_66_1208 | 372 |
| 187 | 3300046507 | Ga0495606_0012586 | Ga0495606_0012586_5561_6703 | 372 |
| 188 | 3300046507 | Ga0495606_0073204 | Ga0495606_0073204_84_1226 | 372 |
| 189 | 3300046512 | Ga0495610_0028924 | Ga0495610_0028924_1718_2860 | 372 |
| 190 | 3300046512 | Ga0495610_0035818 | Ga0495610_0035818_42_1184 | 372 |
| 191 | 3300046513 | Ga0495616_0008007 | Ga0495616_0008007_4844_5986 | 372 |
| 192 | 3300046513 | Ga0495616_0036932 | Ga0495616_0036932_1323_2465 | 372 |
| 193 | 3300046513 | Ga0495616_0047867 | Ga0495616_0047867_943_2085 | 372 |
| 194 | 3300046515 | Ga0495620_0060996 | Ga0495620_0060996_67_1209 | 372 |
| 195 | 3300046518 | Ga0495631_0026689 | Ga0495631_0026689_1174_2316 | 372 |
| 196 | 3300046519 | Ga0495632_0006673 | Ga0495632_0006673_5562_6704 | 372 |
| 197 | 3300046519 | Ga0495632_0034011 | Ga0495632_0034011_80_1222 | 372 |
| 198 | 3300046520 | Ga0495637_0012771 | Ga0495637_0012771_2254_3396 | 372 |
| 199 | 3300046520 | Ga0495637_0085121 | Ga0495637_0085121_45_1187 | 372 |
| 200 | 3300046523 | Ga0495644_0017742 | Ga0495644_0017742_86_1228 | 372 |
| 201 | 3300046523 | Ga0495644_0024244 | Ga0495644_0024244_91_1233 | 372 |
| 202 | 3300046530 | Ga0495654_0026029 | Ga0495654_0026029_1814_2956 | 372 |
| 203 | 3300046530 | Ga0495654_0042259 | Ga0495654_0042259_54_1196 | 372 |
| 204 | 3300046530 | Ga0495654_0048286 | Ga0495654_0048286_876_2018 | 372 |
| 205 | 3300046530 | Ga0495654_0112826 | Ga0495654_0112826_52_1194 | 372 |
| 206 | 3300046648 | Ga0495611_0068989 | Ga0495611_0068989_452_1594 | 372 |
| 207 | 3300046665 | Ga0495661_0104859 | Ga0495661_0104859_67_1209 | 372 |
| 208 | 3300046691 | Ga0495670_0039117 | Ga0495670_0039117_64_1206 | 372 |
| 209 | 3300046692 | Ga0495671_0040740 | Ga0495671_0040740_101_1243 | 372 |
| 210 | 3300046692 | Ga0495671_0046838 | Ga0495671_0046838_925_2067 | 372 |
| 211 | 3300046694 | Ga0495649_0031677 | Ga0495649_0031677_1701_2843 | 372 |
| 212 | 3300046694 | Ga0495649_0094930 | Ga0495649_0094930_84_1226 | 372 |
| 213 | 3300046810 | Ga0495660_0069648 | Ga0495660_0069648_56_1198 | 372 |
| 214 | 3300047320 | Ga0495672_0060693 | Ga0495672_0060693_56_1198 | 372 |
| 215 | 3300047469 | Ga0495673_0007780 | Ga0495673_0007780_4882_6024 | 372 |
| 216 | 3300047469 | Ga0495673_0022309 | Ga0495673_0022309_1916_3058 | 372 |
| 217 | 3300047469 | Ga0495673_0084558 | Ga0495673_0084558_96_1238 | 372 |
| 218 | 3300047470 | Ga0495681_0006487 | Ga0495681_0006487_6442_7584 | 372 |
| 219 | 3300047470 | Ga0495681_0038664 | Ga0495681_0038664_1153_2295 | 372 |
| 220 | 3300047470 | Ga0495681_0039112 | Ga0495681_0039112_64_1206 | 372 |
| 221 | 3300047472 | Ga0495686_0035868 | Ga0495686_0035868_85_1227 | 372 |
| 222 | 3300048091 | Ga0495626_0004242 | Ga0495626_0004242_101_1243 | 372 |
| 223 | 3300048091 | Ga0495626_0005262 | Ga0495626_0005262_84_1226 | 372 |
| 224 | 3300048091 | Ga0495626_0023401 | Ga0495626_0023401_73_1215 | 372 |
| 225 | 3300048921 | Ga0496118_0079743 | Ga0496118_0079743_30_1172 | 372 |
| 226 | 3300049459 | Ga0495678_033009 | Ga0495678_033009_64_1206 | 372 |
| 227 | 3300049459 | Ga0495678_038527 | Ga0495678_038527_61_1203 | 372 |
| 228 | iso_pu_bacteria | 2600254954 | 2600444739 | 372 |
| 229 | iso_pu_bacteria | 2600255389 | 2602011968 | 372 |
| 230 | iso_pu_bacteria | 8034962539 | 8034964730 | 372 |
| 231 | 3300046463 | Ga0495653_0013920 | Ga0495653_0013920_3997_5139 | 373 |
| 232 | 3300046690 | Ga0495624_0050948 | Ga0495624_0050948_1419_2561 | 373 |
| 233 | 3300047320 | Ga0495672_0045485 | Ga0495672_0045485_1424_2566 | 373 |
| 234 | 3300047322 | Ga0495680_0180363 | Ga0495680_0180363_318_1460 | 373 |
| 235 | 3300047673 | Ga0495593_0036920 | Ga0495593_0036920_1469_2611 | 373 |
| 236 | 3300048088 | Ga0495602_0087996 | Ga0495602_0087996_40_1182 | 373 |
| 237 | iso_pu_bacteria | 2511231006 | 2511268421 | 373 |
| 238 | iso_pu_bacteria | 2511231024 | 2511374427 | 373 |
| 239 | iso_pu_bacteria | 2511231156 | 2511823683 | 373 |
| 240 | iso_pu_bacteria | 2512047018 | 2512324012 | 373 |
| 241 | iso_pu_bacteria | 2554235341 | 2555671275 | 373 |
| 242 | iso_pu_bacteria | 2582580891 | 2583793684 | 373 |
| 243 | iso_pu_bacteria | 2597489887 | 2597859344 | 373 |
| 244 | iso_pu_bacteria | 2597489889 | 2597868791 | 373 |
| 245 | iso_pu_bacteria | 2599185155 | 2599327040 | 373 |
| 246 | iso_pu_bacteria | 2599185160 | 2599354566 | 373 |
| 247 | iso_pu_bacteria | 2599185161 | 2599359721 | 373 |
| 248 | iso_pu_bacteria | 2599185162 | 2599366043 | 373 |
| 249 | iso_pu_bacteria | 2599185163 | 2599372833 | 373 |
| 250 | iso_pu_bacteria | 2599185164 | 2599379673 | 373 |
| 251 | iso_pu_bacteria | 2599185165 | 2599385348 | 373 |
| 252 | iso_pu_bacteria | 2599185166 | 2599391692 | 373 |
| 253 | iso_pu_bacteria | 2599185167 | 2599401578 | 373 |
| 254 | iso_pu_bacteria | 2599185168 | 2599403458 | 373 |
| 255 | iso_pu_bacteria | 2599185179 | 2599451881 | 373 |
| 256 | iso_pu_bacteria | 2599185181 | 2599461400 | 373 |
| 257 | iso_pu_bacteria | 2599185182 | 2599469943 | 373 |
| 258 | iso_pu_bacteria | 2599185185 | 2599482174 | 373 |
| 259 | iso_pu_bacteria | 2599185186 | 2599490419 | 373 |
| 260 | iso_pu_bacteria | 2599185189 | 2599509648 | 373 |
| 261 | iso_pu_bacteria | 2599185190 | 2599514822 | 373 |
| 262 | iso_pu_bacteria | 2599185191 | 2599520920 | 373 |
| 263 | iso_pu_bacteria | 2599185212 | 2599611629 | 373 |
| 264 | iso_pu_bacteria | 2599185248 | 2599770276 | 373 |
| 265 | iso_pu_bacteria | 2599185257 | 2599804108 | 373 |
| 266 | iso_pu_bacteria | 2599185288 | 2599882167 | 373 |
| 267 | iso_pu_bacteria | 2599185289 | 2599887515 | 373 |
| 268 | iso_pu_bacteria | 2599185290 | 2599894381 | 373 |
| 269 | iso_pu_bacteria | 2599185291 | 2599900006 | 373 |
| 270 | iso_pu_bacteria | 2599185302 | 2599941789 | 373 |
| 271 | iso_pu_bacteria | 2599185303 | 2599951589 | 373 |
| 272 | iso_pu_bacteria | 2599185304 | 2599952691 | 373 |
| 273 | iso_pu_bacteria | 2599185305 | 2599960582 | 373 |
| 274 | iso_pu_bacteria | 2599185306 | 2599964876 | 373 |
| 275 | iso_pu_bacteria | 2599185308 | 2599976011 | 373 |
| 276 | iso_pu_bacteria | 2599185309 | 2599981958 | 373 |
| 277 | iso_pu_bacteria | 2599185310 | 2599987867 | 373 |
| 278 | iso_pu_bacteria | 2599185311 | 2599995570 | 373 |
| 279 | iso_pu_bacteria | 2599185312 | 2599998241 | 373 |
| 280 | iso_pu_bacteria | 2599185313 | 2600005405 | 373 |
| 281 | iso_pu_bacteria | 2599185314 | 2600010108 | 373 |
| 282 | iso_pu_bacteria | 2599185315 | 2600017377 | 373 |
| 283 | iso_pu_bacteria | 2599185316 | 2600022600 | 373 |
| 284 | iso_pu_bacteria | 2599185317 | 2600027620 | 373 |
| 285 | iso_pu_bacteria | 2599185318 | 2600034404 | 373 |
| 286 | iso_pu_bacteria | 2599185319 | 2600039900 | 373 |
| 287 | iso_pu_bacteria | 2599185320 | 2600046197 | 373 |
| 288 | iso_pu_bacteria | 2599185321 | 2600052200 | 373 |
| 289 | iso_pu_bacteria | 2599185322 | 2600057577 | 373 |
| 290 | iso_pu_bacteria | 2599185323 | 2600068811 | 373 |
| 291 | iso_pu_bacteria | 2599185324 | 2600072315 | 373 |
| 292 | iso_pu_bacteria | 2599185325 | 2600075875 | 373 |
| 293 | iso_pu_bacteria | 2599185356 | 2600214018 | 373 |
| 294 | iso_pu_bacteria | 2600254930 | 2600356671 | 373 |
| 295 | iso_pu_bacteria | 2600254931 | 2600364252 | 373 |
| 296 | iso_pu_bacteria | 2600255296 | 2601694292 | 373 |
| 297 | iso_pu_bacteria | 2600255313 | 2601774184 | 373 |
| 298 | iso_pu_bacteria | 2619619299 | 2621300930 | 373 |
| 299 | iso_pu_bacteria | 2643221571 | 2643871665 | 373 |
| 300 | iso_pu_bacteria | 2643221650 | 2644284861 | 373 |
| 301 | iso_pu_bacteria | 2643221713 | 2644623542 | 373 |
| 302 | iso_pu_bacteria | 2651869719 | 2652543838 | 373 |
| 303 | iso_pu_bacteria | 2667528170 | 2671090174 | 373 |
| 304 | iso_pu_bacteria | 2667528171 | 2671097147 | 373 |
| 305 | iso_pu_bacteria | 2667528176 | 2671126010 | 373 |
| 306 | iso_pu_bacteria | 2671180172 | 2671770324 | 373 |
| 307 | iso_pu_bacteria | 2675903420 | 2677896836 | 373 |
| 308 | iso_pu_bacteria | 2675903515 | 2678262615 | 373 |
| 309 | iso_pu_bacteria | 2721755607 | 2723247815 | 373 |
| 310 | iso_pu_bacteria | 2738541265 | 2738670445 | 373 |
| 311 | iso_pu_bacteria | 2738541271 | 2738689061 | 373 |
| 312 | iso_pu_bacteria | 2738541282 | 2738748838 | 373 |
| 313 | iso_pu_bacteria | 2738541294 | 2738810820 | 373 |
| 314 | iso_pu_bacteria | 2738541303 | 2738857880 | 373 |
| 315 | iso_pu_bacteria | 2738541309 | 2738898180 | 373 |
| 316 | iso_pu_bacteria | 2738543016 | 2739264448 | 373 |
| 317 | iso_pu_bacteria | 2740892503 | 2743738876 | 373 |
| 318 | iso_pu_bacteria | 2744054620 | 2745008955 | 373 |
| 319 | iso_pu_bacteria | 2765235841 | 2765585329 | 373 |
| 320 | iso_pu_bacteria | 2791355520 | 2794596419 | 373 |
| 321 | iso_pu_bacteria | 2808606373 | 2808907659 | 373 |
| 322 | iso_pu_bacteria | 2808606379 | 2808943382 | 373 |
| 323 | iso_pu_bacteria | 2808606385 | 2808979466 | 373 |
| 324 | iso_pu_bacteria | 2808606388 | 2808995390 | 373 |
| 325 | iso_pu_bacteria | 2816332298 | 2817489769 | 373 |
| 326 | iso_pu_bacteria | 2818991464 | 2819702244 | 373 |
| 327 | iso_pu_bacteria | 2825651385 | 2825653020 | 373 |
| 328 | iso_pu_bacteria | 2826581358 | 2826585903 | 373 |
| 329 | iso_pu_bacteria | 2834028612 | 2834029646 | 373 |
| 330 | iso_pu_bacteria | 2842815866 | 2842818936 | 373 |
| 331 | iso_pu_bacteria | 2842826826 | 2842831990 | 373 |
| 332 | iso_pu_bacteria | 2842837860 | 2842841574 | 373 |
| 333 | iso_pu_bacteria | 2842849001 | 2842853907 | 373 |
| 334 | iso_pu_bacteria | 2842854478 | 2842854669 | 373 |
| 335 | iso_pu_bacteria | 2844665904 | 2844671799 | 373 |
| 336 | iso_pu_bacteria | 2852612431 | 2852618473 | 373 |
| 337 | iso_pu_bacteria | 2852667396 | 2852673391 | 373 |
| 338 | iso_pu_bacteria | 2860867994 | 2860869640 | 373 |
| 339 | iso_pu_bacteria | 2908446538 | 2908448561 | 373 |
| 340 | iso_pu_bacteria | 2913036834 | 2913038594 | 373 |
| 341 | iso_pu_bacteria | 2917070673 | 2917075136 | 373 |
| 342 | iso_pu_bacteria | 2919481497 | 2919481869 | 373 |
| 343 | iso_pu_bacteria | 2923153595 | 2923157949 | 373 |
| 344 | iso_pu_bacteria | 2923586266 | 2923587294 | 373 |
| 345 | iso_pu_bacteria | 2929144301 | 2929146046 | 373 |
| 346 | iso_pu_bacteria | 2929189879 | 2929191616 | 373 |
| 347 | iso_pu_bacteria | 2931369376 | 2931370616 | 373 |
| 348 | iso_pu_bacteria | 2931390751 | 2931392713 | 373 |
| 349 | iso_pu_bacteria | 2935353572 | 2935356124 | 373 |
| 350 | iso_pu_bacteria | 2945928738 | 2945928952 | 373 |
| 351 | iso_pu_bacteria | 2945961074 | 2945962251 | 373 |
| 352 | iso_pu_bacteria | 2946006987 | 2946011175 | 373 |
| 353 | iso_pu_bacteria | 2946027586 | 2946029898 | 373 |
| 354 | iso_pu_bacteria | 2947233263 | 2947236469 | 373 |
| 355 | iso_pu_bacteria | 2984286254 | 2984288224 | 373 |
| 356 | iso_pu_bacteria | 3007395558 | 3007397258 | 373 |
| 357 | iso_pu_bacteria | 3007419365 | 3007424285 | 373 |
| 358 | iso_pu_bacteria | 637000220 | 637321602 | 373 |
| 359 | iso_pu_bacteria | 8019769354 | 8019775173 | 373 |
| 360 | iso_pu_bacteria | 8054285046 | 8054288270 | 373 |
| 361 | iso_pu_bacteria | 8054347763 | 8054352078 | 373 |
| 362 | iso_pu_bacteria | 8054503363 | 8054505217 | 373 |
| 363 | iso_pu_bacteria | 8055817908 | 8055819757 | 373 |
| 364 | iso_pu_bacteria | 8055878733 | 8055878809 | 373 |
| 365 | iso_pu_bacteria | 8056115690 | 8056117774 | 373 |
| 366 | iso_pu_bacteria | 8056120720 | 8056124551 | 373 |
| 367 | iso_pu_bacteria | 8056131705 | 8056133543 | 373 |
| 368 | iso_pu_bacteria | 8056143049 | 8056147245 | 373 |
| 369 | iso_pu_bacteria | 8056148874 | 8056150450 | 373 |
| 370 | iso_pu_bacteria | 8056161164 | 8056164966 | 373 |
| 371 | iso_pu_bacteria | 8057798959 | 8057804084 | 373 |
| 372 | 3300027312 | Ga0209371_1000412 | Ga0209371_100041237 | 374 |
| 373 | 3300030500 | Ga0268256_1000486 | Ga0268256_100048629 | 374 |
| 374 | 3300042006 | Ga0439432_032243 | Ga0439432_032243_475_1623 | 374 |
| 375 | 3300042115 | Ga0450911_003808 | Ga0450911_003808_71_1213 | 374 |
| 376 | 3300046522 | Ga0495643_0000291 | Ga0495643_0000291_43909_45045 | 374 |
| 377 | 3300048925 | Ga0496122_0081146 | Ga0496122_0081146_805_1929 | 374 |
| 378 | 3300046452 | Ga0495617_011394 | Ga0495617_011394_103_1260 | 375 |
| 379 | 3300046457 | Ga0495590_0021318 | Ga0495590_0021318_85_1242 | 375 |
| 380 | 3300046471 | Ga0495650_0025175 | Ga0495650_0025175_77_1234 | 375 |
| 381 | 3300046474 | Ga0495605_0001002 | Ga0495605_0001002_10004_11161 | 375 |
| 382 | 3300046501 | Ga0495607_0015749 | Ga0495607_0015749_3298_4455 | 375 |
| 383 | 3300046513 | Ga0495616_0002292 | Ga0495616_0002292_4694_5851 | 375 |
| 384 | 3300046519 | Ga0495632_0030378 | Ga0495632_0030378_1540_2697 | 375 |
| 385 | 3300046522 | Ga0495643_0046697 | Ga0495643_0046697_74_1231 | 375 |
| 386 | 3300046522 | Ga0495643_0068118 | Ga0495643_0068118_300_1427 | 375 |
| 387 | 3300046528 | Ga0495642_0018110 | Ga0495642_0018110_105_1262 | 375 |
| 388 | 3300046530 | Ga0495654_0027203 | Ga0495654_0027203_100_1257 | 375 |
| 389 | 3300046538 | Ga0495609_0029080 | Ga0495609_0029080_74_1231 | 375 |
| 390 | 3300046542 | Ga0495597_0069795 | Ga0495597_0069795_100_1257 | 375 |
| 391 | 3300046648 | Ga0495611_0024210 | Ga0495611_0024210_1421_2578 | 375 |
| 392 | 3300046694 | Ga0495649_0008901 | Ga0495649_0008901_4795_5952 | 375 |
| 393 | 3300046794 | Ga0495589_0003758 | Ga0495589_0003758_6756_7913 | 375 |
| 394 | 3300047318 | Ga0495636_0014202 | Ga0495636_0014202_1919_3076 | 375 |
| 395 | 3300047320 | Ga0495672_0006371 | Ga0495672_0006371_7955_9112 | 375 |
| 396 | 3300047443 | Ga0495687_017772 | Ga0495687_017772_2339_3496 | 375 |
| 397 | 3300047447 | Ga0495685_017632 | Ga0495685_017632_1226_2383 | 375 |
| 398 | 3300047472 | Ga0495686_0041293 | Ga0495686_0041293_1701_2843 | 375 |
| 399 | 3300048919 | Ga0496116_0004803 | Ga0496116_0004803_9850_10992 | 375 |
| 400 | 3300048927 | Ga0496124_0000658 | Ga0496124_0000658_42814_43959 | 375 |
| 401 | 3300027312 | Ga0209371_1000237 | Ga0209371_100023730 | 376 |
| 402 | 3300030500 | Ga0268256_1000485 | Ga0268256_100048513 | 376 |
| 403 | 3300031548 | Ga0307408_100000004 | Ga0307408_100000004345 | 376 |
| 404 | iso_pu_bacteria | 2511231007 | 2511273067 | 376 |
| 405 | iso_pu_bacteria | 2511231010 | 2511290570 | 376 |
| 406 | iso_pu_bacteria | 2511231011 | 2511295948 | 376 |
| 407 | iso_pu_bacteria | 2511231012 | 2511301104 | 376 |
| 408 | iso_pu_bacteria | 2511231014 | 2511312287 | 376 |
| 409 | iso_pu_bacteria | 2511231020 | 2511349822 | 376 |
| 410 | iso_pu_bacteria | 2511231021 | 2511355264 | 376 |
| 411 | iso_pu_bacteria | 2511231031 | 2511410847 | 376 |
| 412 | iso_pu_bacteria | 2600255318 | 2601796260 | 376 |
| 413 | iso_pu_bacteria | 2603880185 | 2606073409 | 376 |
| 414 | iso_pu_bacteria | 2603880199 | 2606126945 | 376 |
| 415 | iso_pu_bacteria | 2623620443 | 2624481909 | 376 |
| 416 | iso_pu_bacteria | 2623620446 | 2624491005 | 376 |
| 417 | iso_pu_bacteria | 2643221565 | 2643845611 | 376 |
| 418 | iso_pu_bacteria | 2643221589 | 2643956488 | 376 |
| 419 | iso_pu_bacteria | 2643221602 | 2644025470 | 376 |
| 420 | iso_pu_bacteria | 2643221633 | 2644185491 | 376 |
| 421 | iso_pu_bacteria | 2713897148 | 2715751212 | 376 |
| 422 | iso_pu_bacteria | 2713897149 | 2715758212 | 376 |
| 423 | iso_pu_bacteria | 2718217725 | 2718635160 | 376 |
| 424 | iso_pu_bacteria | 2738543004 | 2739201948 | 376 |
| 425 | iso_pu_bacteria | 2738543015 | 2739259249 | 376 |
| 426 | iso_pu_bacteria | 2738543025 | 2739314079 | 376 |
| 427 | iso_pu_bacteria | 2773857673 | 2774132819 | 376 |
| 428 | iso_pu_bacteria | 2818991456 | 2819655653 | 376 |
| 429 | iso_pu_bacteria | 2842832357 | 2842836504 | 376 |
| 430 | iso_pu_bacteria | 2842843487 | 2842844617 | 376 |
| 431 | iso_pu_bacteria | 2878029506 | 2878033893 | 376 |
| 432 | iso_pu_bacteria | 2880230671 | 2880234518 | 376 |
| 433 | iso_pu_bacteria | 2904518522 | 2904521341 | 376 |
| 434 | iso_pu_bacteria | 2904550169 | 2904555123 | 376 |
| 435 | iso_pu_bacteria | 2919063839 | 2919068879 | 376 |
| 436 | iso_pu_bacteria | 2919385768 | 2919387986 | 376 |
| 437 | iso_pu_bacteria | 2919487758 | 2919489832 | 376 |
| 438 | iso_pu_bacteria | 2919697872 | 2919702020 | 376 |
| 439 | iso_pu_bacteria | 2939636861 | 2939637634 | 376 |
| 440 | iso_pu_bacteria | 2969304461 | 2969308668 | 376 |
| 441 | iso_pu_bacteria | 2974289157 | 2974289958 | 376 |
| 442 | iso_pu_bacteria | 2998139840 | 2998143973 | 376 |
| 443 | iso_pu_bacteria | 3007614139 | 3007616879 | 376 |
| 444 | iso_pu_bacteria | 3007718800 | 3007718899 | 376 |
| 445 | iso_pu_bacteria | 3007855910 | 3007857879 | 376 |
| 446 | iso_pu_bacteria | 3007861166 | 3007865403 | 376 |
| 447 | iso_pu_bacteria | 8019775933 | 8019780976 | 376 |
| 448 | iso_pu_bacteria | 8029995093 | 8029996904 | 376 |
| 449 | iso_pu_bacteria | 8056125926 | 8056127585 | 376 |
| 450 | iso_pu_bacteria | 8056155041 | 8056157353 | 376 |
| 451 | iso_pu_bacteria | 8056166840 | 8056167302 | 376 |
| 452 | iso_pu_bacteria | 8056172158 | 8056173287 | 376 |
| 453 | 2162886007 | SwRhRL2b_contig_2223659 | SwRhRL2b_0170.00007830 | 377 |
| 454 | 3300003752 | Ga0055539_1000134 | Ga0055539_100013455 | 377 |
| 455 | 3300003756 | Ga0055533_1000138 | Ga0055533_100013827 | 377 |
| 456 | 3300003758 | Ga0055532_1000142 | Ga0055532_100014255 | 377 |
| 457 | 3300003759 | Ga0055525_1000183 | Ga0055525_100018355 | 377 |
| 458 | 3300003761 | Ga0055535_1005240 | Ga0055535_10052404 | 377 |
| 459 | 3300003781 | Ga0055536_1011959 | Ga0055536_10119591 | 377 |
| 460 | 3300003791 | Ga0055530_10011088 | Ga0055530_100110884 | 377 |
| 461 | 3300003792 | Ga0055540_1009780 | Ga0055540_10097801 | 377 |
| 462 | 3300003841 | Ga0055541_1000089 | Ga0055541_100008955 | 377 |
| 463 | 3300005288 | Ga0065714_10016937 | Ga0065714_100169371 | 377 |
| 464 | 3300005288 | Ga0065714_10065661 | Ga0065714_1006566111 | 377 |
| 465 | 3300005288 | Ga0065714_10082358 | Ga0065714_100823583 | 377 |
| 466 | 3300005288 | Ga0065714_10099572 | Ga0065714_100995722 | 377 |
| 467 | 3300005289 | Ga0065704_10073943 | Ga0065704_100739434 | 377 |
| 468 | 3300005290 | Ga0065712_10068223 | Ga0065712_100682235 | 377 |
| 469 | 3300005331 | Ga0070670_100061378 | Ga0070670_1000613781 | 377 |
| 470 | 3300005353 | Ga0070669_100003585 | Ga0070669_1000035854 | 377 |
| 471 | 3300005457 | Ga0070662_100004011 | Ga0070662_10000401111 | 377 |
| 472 | 3300005834 | Ga0068851_10000050 | Ga0068851_100000501 | 377 |
| 473 | 3300006946 | Ga0079104_1000346 | Ga0079104_100034657 | 377 |
| 474 | 3300009011 | Ga0105251_10021500 | Ga0105251_100215002 | 377 |
| 475 | 3300009011 | Ga0105251_10035119 | Ga0105251_100351194 | 377 |
| 476 | 3300009036 | Ga0105244_10001004 | Ga0105244_1000100412 | 377 |
| 477 | 3300009036 | Ga0105244_10003260 | Ga0105244_1000326011 | 377 |
| 478 | 3300009177 | Ga0105248_10071057 | Ga0105248_100710573 | 377 |
| 479 | 3300011119 | Ga0105246_10000955 | Ga0105246_1000095512 | 377 |
| 480 | 3300013100 | Ga0157373_10056628 | Ga0157373_100566281 | 377 |
| 481 | 3300013104 | Ga0157370_10372198 | Ga0157370_103721981 | 377 |
| 482 | 3300013308 | Ga0157375_10157671 | Ga0157375_101576714 | 377 |
| 483 | 3300017792 | Ga0163161_10053175 | Ga0163161_100531754 | 377 |
| 484 | 3300025206 | Ga0209435_101864 | Ga0209435_1018641 | 377 |
| 485 | 3300025224 | Ga0209784_100040 | Ga0209784_100040202 | 377 |
| 486 | 3300025225 | Ga0209566_100051 | Ga0209566_100051202 | 377 |
| 487 | 3300025226 | Ga0209674_100072 | Ga0209674_100072202 | 377 |
| 488 | 3300025229 | Ga0209147_100067 | Ga0209147_100067202 | 377 |
| 489 | 3300025230 | Ga0209563_100073 | Ga0209563_100073202 | 377 |
| 490 | 3300025242 | Ga0209258_100585 | Ga0209258_10058517 | 377 |
| 491 | 3300025246 | Ga0209646_1000325 | Ga0209646_100032527 | 377 |
| 492 | 3300025253 | Ga0209677_100121 | Ga0209677_10012155 | 377 |
| 493 | 3300025256 | Ga0209759_1013808 | Ga0209759_10138082 | 377 |
| 494 | 3300025292 | Ga0209676_1000006 | Ga0209676_1000006100 | 377 |
| 495 | 3300025298 | Ga0209050_1000214 | Ga0209050_1000214100 | 377 |
| 496 | 3300025303 | Ga0209051_1000163 | Ga0209051_10001631 | 377 |
| 497 | 3300025321 | Ga0207656_10000683 | Ga0207656_100006832 | 377 |
| 498 | 3300025711 | Ga0207696_1000171 | Ga0207696_100017182 | 377 |
| 499 | 3300025728 | Ga0207655_1002485 | Ga0207655_10024858 | 377 |
| 500 | 3300025728 | Ga0207655_1002922 | Ga0207655_10029223 | 377 |
| 501 | 3300025728 | Ga0207655_1003053 | Ga0207655_10030534 | 377 |
| 502 | 3300025735 | Ga0207713_1002411 | Ga0207713_100241113 | 377 |
| 503 | 3300025735 | Ga0207713_1018540 | Ga0207713_10185405 | 377 |
| 504 | 3300025923 | Ga0207681_10002768 | Ga0207681_100027684 | 377 |
| 505 | 3300025925 | Ga0207650_10000174 | Ga0207650_1000017476 | 377 |
| 506 | 3300025925 | Ga0207650_10001409 | Ga0207650_100014099 | 377 |
| 507 | 3300025933 | Ga0207706_10002445 | Ga0207706_1000244517 | 377 |
| 508 | 3300027111 | Ga0209281_1000018 | Ga0209281_1000018339 | 377 |
| 509 | 3300031548 | Ga0307408_100057473 | Ga0307408_1000574731 | 377 |
| 510 | 3300031911 | Ga0307412_10033335 | Ga0307412_100333351 | 377 |
| 511 | 3300041405 | Ga0439438_009727 | Ga0439438_009727_36_1169 | 377 |
| 512 | 3300041407 | Ga0439447_010590 | Ga0439447_010590_1468_2625 | 377 |
| 513 | 3300041407 | Ga0439447_016024 | Ga0439447_016024_96_1253 | 377 |
| 514 | 3300041411 | Ga0439466_0008472 | Ga0439466_0008472_792_1925 | 377 |
| 515 | 3300041411 | Ga0439466_0008509 | Ga0439466_0008509_1430_2563 | 377 |
| 516 | 3300041411 | Ga0439466_0028294 | Ga0439466_0028294_765_1898 | 377 |
| 517 | 3300041411 | Ga0439466_0030242 | Ga0439466_0030242_120_1277 | 377 |
| 518 | 3300041997 | Ga0439431_0006811 | Ga0439431_0006811_32_1165 | 377 |
| 519 | 3300042006 | Ga0439432_017486 | Ga0439432_017486_130_1287 | 377 |
| 520 | 3300042010 | Ga0439452_021412 | Ga0439452_021412_219_1352 | 377 |
| 521 | 3300042013 | Ga0439456_002417 | Ga0439456_002417_120_1277 | 377 |
| 522 | 3300042115 | Ga0450911_000111 | Ga0450911_000111_4765_5910 | 377 |
| 523 | 3300042127 | Ga0450890_007074 | Ga0450890_007074_85_1242 | 377 |
| 524 | 3300042138 | Ga0450903_013028 | Ga0450903_013028_66_1223 | 377 |
| 525 | 3300042139 | Ga0450904_000019 | Ga0450904_000019_5729_6874 | 377 |
| 526 | 3300042146 | Ga0450907_002272 | Ga0450907_002272_54_1211 | 377 |
| 527 | 3300042146 | Ga0450907_011390 | Ga0450907_011390_88_1245 | 377 |
| 528 | 3300042156 | Ga0439446_0006966 | Ga0439446_0006966_377_1522 | 377 |
| 529 | 3300042184 | Ga0450908_004883 | Ga0450908_004883_1294_2451 | 377 |
| 530 | 3300042185 | Ga0450909_000126 | Ga0450909_000126_6550_7707 | 377 |
| 531 | 3300042435 | Ga0439434_0024725 | Ga0439434_0024725_591_1748 | 377 |
| 532 | 3300042533 | Ga0450901_000952 | Ga0450901_000952_2065_3291 | 377 |
| 533 | 3300045049 | Ga0466959_0002824 | Ga0466959_0002824_7672_8835 | 377 |
| 534 | 3300046453 | Ga0495627_000152 | Ga0495627_000152_21538_22683 | 377 |
| 535 | 3300046453 | Ga0495627_012091 | Ga0495627_012091_96_1229 | 377 |
| 536 | 3300046458 | Ga0495591_013547 | Ga0495591_013547_1779_2912 | 377 |
| 537 | 3300046471 | Ga0495650_0003022 | Ga0495650_0003022_561_1694 | 377 |
| 538 | 3300046474 | Ga0495605_0000088 | Ga0495605_0000088_26079_27212 | 377 |
| 539 | 3300046474 | Ga0495605_0066926 | Ga0495605_0066926_103_1248 | 377 |
| 540 | 3300046499 | Ga0495594_0000262 | Ga0495594_0000262_24168_25301 | 377 |
| 541 | 3300046501 | Ga0495607_0000186 | Ga0495607_0000186_21604_22749 | 377 |
| 542 | 3300046501 | Ga0495607_0000827 | Ga0495607_0000827_6464_7609 | 377 |
| 543 | 3300046501 | Ga0495607_0089208 | Ga0495607_0089208_524_1657 | 377 |
| 544 | 3300046506 | Ga0495583_0000135 | Ga0495583_0000135_26046_27179 | 377 |
| 545 | 3300046506 | Ga0495583_0001024 | Ga0495583_0001024_20857_21990 | 377 |
| 546 | 3300046506 | Ga0495583_0002277 | Ga0495583_0002277_15589_16722 | 377 |
| 547 | 3300046506 | Ga0495583_0028151 | Ga0495583_0028151_1581_2714 | 377 |
| 548 | 3300046507 | Ga0495606_0048759 | Ga0495606_0048759_78_1211 | 377 |
| 549 | 3300046512 | Ga0495610_0038040 | Ga0495610_0038040_1239_2372 | 377 |
| 550 | 3300046515 | Ga0495620_0000034 | Ga0495620_0000034_90844_91977 | 377 |
| 551 | 3300046515 | Ga0495620_0020775 | Ga0495620_0020775_2031_3164 | 377 |
| 552 | 3300046519 | Ga0495632_0000496 | Ga0495632_0000496_5675_6808 | 377 |
| 553 | 3300046519 | Ga0495632_0035114 | Ga0495632_0035114_23_1156 | 377 |
| 554 | 3300046520 | Ga0495637_0002688 | Ga0495637_0002688_51_1184 | 377 |
| 555 | 3300046520 | Ga0495637_0024465 | Ga0495637_0024465_1464_2621 | 377 |
| 556 | 3300046524 | Ga0495648_0001134 | Ga0495648_0001134_40_1173 | 377 |
| 557 | 3300046524 | Ga0495648_0060234 | Ga0495648_0060234_1015_2172 | 377 |
| 558 | 3300046530 | Ga0495654_0001112 | Ga0495654_0001112_13458_14591 | 377 |
| 559 | 3300046530 | Ga0495654_0004113 | Ga0495654_0004113_70_1203 | 377 |
| 560 | 3300046530 | Ga0495654_0103003 | Ga0495654_0103003_136_1269 | 377 |
| 561 | 3300046538 | Ga0495609_0000247 | Ga0495609_0000247_23986_25119 | 377 |
| 562 | 3300046542 | Ga0495597_0000059 | Ga0495597_0000059_81320_82465 | 377 |
| 563 | 3300046542 | Ga0495597_0000692 | Ga0495597_0000692_301_1434 | 377 |
| 564 | 3300046558 | Ga0495633_0000468 | Ga0495633_0000468_25923_27056 | 377 |
| 565 | 3300046648 | Ga0495611_0005778 | Ga0495611_0005778_3675_4808 | 377 |
| 566 | 3300046660 | Ga0495625_0199241 | Ga0495625_0199241_66_1223 | 377 |
| 567 | 3300046664 | Ga0495659_0082318 | Ga0495659_0082318_40_1197 | 377 |
| 568 | 3300046665 | Ga0495661_0000078 | Ga0495661_0000078_25976_27109 | 377 |
| 569 | 3300046665 | Ga0495661_0000359 | Ga0495661_0000359_38522_39655 | 377 |
| 570 | 3300046665 | Ga0495661_0009655 | Ga0495661_0009655_5415_6548 | 377 |
| 571 | 3300046665 | Ga0495661_0036423 | Ga0495661_0036423_1848_2981 | 377 |
| 572 | 3300046665 | Ga0495661_0133100 | Ga0495661_0133100_63_1220 | 377 |
| 573 | 3300046691 | Ga0495670_0030209 | Ga0495670_0030209_66_1223 | 377 |
| 574 | 3300046692 | Ga0495671_0023614 | Ga0495671_0023614_101_1258 | 377 |
| 575 | 3300046692 | Ga0495671_0025413 | Ga0495671_0025413_47_1204 | 377 |
| 576 | 3300046692 | Ga0495671_0050018 | Ga0495671_0050018_666_1799 | 377 |
| 577 | 3300046794 | Ga0495589_0000534 | Ga0495589_0000534_18184_19317 | 377 |
| 578 | 3300046794 | Ga0495589_0031153 | Ga0495589_0031153_1488_2621 | 377 |
| 579 | 3300046810 | Ga0495660_0001075 | Ga0495660_0001075_18178_19335 | 377 |
| 580 | 3300046810 | Ga0495660_0001494 | Ga0495660_0001494_1512_2645 | 377 |
| 581 | 3300046810 | Ga0495660_0049842 | Ga0495660_0049842_58_1191 | 377 |
| 582 | 3300047320 | Ga0495672_0049407 | Ga0495672_0049407_1312_2445 | 377 |
| 583 | 3300047320 | Ga0495672_0120938 | Ga0495672_0120938_83_1228 | 377 |
| 584 | 3300047323 | Ga0495683_0000409 | Ga0495683_0000409_7337_8470 | 377 |
| 585 | 3300047323 | Ga0495683_0028687 | Ga0495683_0028687_1657_2814 | 377 |
| 586 | 3300047446 | Ga0495679_000417 | Ga0495679_000417_25920_27053 | 377 |
| 587 | 3300047446 | Ga0495679_004078 | Ga0495679_004078_62_1195 | 377 |
| 588 | 3300047446 | Ga0495679_017603 | Ga0495679_017603_1327_2460 | 377 |
| 589 | 3300047470 | Ga0495681_0008990 | Ga0495681_0008990_4421_5554 | 377 |
| 590 | 3300048917 | Ga0496114_0133724 | Ga0496114_0133724_210_1343 | 377 |
| 591 | 3300048920 | Ga0496117_0009811 | Ga0496117_0009811_7616_8749 | 377 |
| 592 | 3300048923 | Ga0496120_0032535 | Ga0496120_0032535_1901_3034 | 377 |
| 593 | 3300048923 | Ga0496120_0039433 | Ga0496120_0039433_1513_2646 | 377 |
| 594 | 3300048925 | Ga0496122_0029267 | Ga0496122_0029267_2879_4012 | 377 |
| 595 | 3300048926 | Ga0496123_0076428 | Ga0496123_0076428_100_1233 | 377 |
| 596 | 3300048926 | Ga0496123_0161780 | Ga0496123_0161780_31_1164 | 377 |
| 597 | 3300048927 | Ga0496124_0015829 | Ga0496124_0015829_95_1228 | 377 |
| 598 | 3300048927 | Ga0496124_0097717 | Ga0496124_0097717_151_1287 | 377 |
| 599 | 3300048928 | Ga0496125_0011496 | Ga0496125_0011496_98_1231 | 377 |
| 600 | 3300048928 | Ga0496125_0018304 | Ga0496125_0018304_61_1194 | 377 |
| 601 | 3300048928 | Ga0496125_0018409 | Ga0496125_0018409_5453_6586 | 377 |
| 602 | 3300048928 | Ga0496125_0134026 | Ga0496125_0134026_97_1230 | 377 |
| 603 | 3300048928 | Ga0496125_0222808 | Ga0496125_0222808_45_1178 | 377 |
| 604 | 3300048929 | Ga0496126_0070023 | Ga0496126_0070023_136_1269 | 377 |
| 605 | 3300049459 | Ga0495678_000081 | Ga0495678_000081_25797_26930 | 377 |
| 606 | 3300049460 | Ga0495682_0035541 | Ga0495682_0035541_45_1178 | 377 |
| 607 | 3300049853 | Ga0501226_000009 | Ga0501226_000009_6101_7246 | 377 |
| 608 | 3300053140 | Ga0500573_0061631 | Ga0500573_0061631_255_1400 | 377 |
| 609 | 3300053161 | Ga0500634_0026560 | Ga0500634_0026560_51_1184 | 377 |
| 610 | 3300046507 | Ga0495606_0000453 | Ga0495606_0000453_11917_13053 | 378 |
| 611 | 3300046694 | Ga0495649_0000610 | Ga0495649_0000610_10768_11904 | 378 |
| 612 | 3300055283 | Ga0500661_003227 | Ga0500661_003227_1007_2197 | 378 |
| 613 | 3300014497 | Ga0182008_10119219 | Ga0182008_101192191 | 379 |
| 614 | 3300046460 | Ga0495638_0076055 | Ga0495638_0076055_55_1194 | 379 |
| 615 | 3300046492 | Ga0495585_0145534 | Ga0495585_0145534_18_1157 | 379 |
| 616 | 3300046542 | Ga0495597_0046468 | Ga0495597_0046468_716_1855 | 379 |
| 617 | 2162886011 | MRS1b_contig_6976788 | MRS1b_0576.00002960 | 380 |
| 618 | 3300003781 | Ga0055536_1011927 | Ga0055536_10119271 | 380 |
| 619 | 3300003791 | Ga0055530_10011048 | Ga0055530_100110484 | 380 |
| 620 | 3300003792 | Ga0055540_1003543 | Ga0055540_100354310 | 380 |
| 621 | 3300003794 | Ga0055531_10000155 | Ga0055531_1000015568 | 380 |
| 622 | 3300005288 | Ga0065714_10003248 | Ga0065714_100032482 | 380 |
| 623 | 3300005288 | Ga0065714_10068871 | Ga0065714_100688711 | 380 |
| 624 | 3300005288 | Ga0065714_10072724 | Ga0065714_100727241 | 380 |
| 625 | 3300005353 | Ga0070669_100050275 | Ga0070669_1000502754 | 380 |
| 626 | 3300006058 | Ga0075432_10001936 | Ga0075432_100019361 | 380 |
| 627 | 3300006177 | Ga0075362_10029125 | Ga0075362_100291254 | 380 |
| 628 | 3300006914 | Ga0075436_100125576 | Ga0075436_1001255762 | 380 |
| 629 | 3300006946 | Ga0079104_1000124 | Ga0079104_100012492 | 380 |
| 630 | 3300009036 | Ga0105244_10025034 | Ga0105244_100250341 | 380 |
| 631 | 3300009036 | Ga0105244_10032220 | Ga0105244_100322201 | 380 |
| 632 | 3300009036 | Ga0105244_10044084 | Ga0105244_100440843 | 380 |
| 633 | 3300009036 | Ga0105244_10085648 | Ga0105244_100856482 | 380 |
| 634 | 3300009092 | Ga0105250_10028504 | Ga0105250_100285043 | 380 |
| 635 | 3300009092 | Ga0105250_10071089 | Ga0105250_100710891 | 380 |
| 636 | 3300009092 | Ga0105250_10088822 | Ga0105250_100888221 | 380 |
| 637 | 3300009092 | Ga0105250_10088823 | Ga0105250_100888231 | 380 |
| 638 | 3300009148 | Ga0105243_10050449 | Ga0105243_100504494 | 380 |
| 639 | 3300011119 | Ga0105246_10000120 | Ga0105246_100001204 | 380 |
| 640 | 3300012498 | Ga0157345_1000641 | Ga0157345_10006414 | 380 |
| 641 | 3300013104 | Ga0157370_10061911 | Ga0157370_100619114 | 380 |
| 642 | 3300013104 | Ga0157370_10238523 | Ga0157370_102385232 | 380 |
| 643 | 3300013105 | Ga0157369_10024274 | Ga0157369_100242749 | 380 |
| 644 | 3300013306 | Ga0163162_10084799 | Ga0163162_100847991 | 380 |
| 645 | 3300013307 | Ga0157372_10151925 | Ga0157372_101519254 | 380 |
| 646 | 3300013308 | Ga0157375_10528237 | Ga0157375_105282371 | 380 |
| 647 | 3300014497 | Ga0182008_10029330 | Ga0182008_100293301 | 380 |
| 648 | 3300014497 | Ga0182008_10120565 | Ga0182008_101205651 | 380 |
| 649 | 3300015261 | Ga0182006_1016215 | Ga0182006_10162151 | 380 |
| 650 | 3300015261 | Ga0182006_1023118 | Ga0182006_10231181 | 380 |
| 651 | 3300015265 | Ga0182005_1023978 | Ga0182005_10239782 | 380 |
| 652 | 3300015265 | Ga0182005_1027103 | Ga0182005_10271032 | 380 |
| 653 | 3300017792 | Ga0163161_10028354 | Ga0163161_100283543 | 380 |
| 654 | 3300017792 | Ga0163161_10084181 | Ga0163161_100841811 | 380 |
| 655 | 3300025230 | Ga0209563_100986 | Ga0209563_1009863 | 380 |
| 656 | 3300025292 | Ga0209676_1000010 | Ga0209676_1000010101 | 380 |
| 657 | 3300025298 | Ga0209050_1000081 | Ga0209050_1000081149 | 380 |
| 658 | 3300025303 | Ga0209051_1000104 | Ga0209051_1000104154 | 380 |
| 659 | 3300025304 | Ga0209257_1000040 | Ga0209257_1000040424 | 380 |
| 660 | 3300025711 | Ga0207696_1003722 | Ga0207696_10037224 | 380 |
| 661 | 3300025711 | Ga0207696_1014501 | Ga0207696_10145014 | 380 |
| 662 | 3300025728 | Ga0207655_1000286 | Ga0207655_100028666 | 380 |
| 663 | 3300025728 | Ga0207655_1027662 | Ga0207655_10276624 | 380 |
| 664 | 3300025735 | Ga0207713_1002221 | Ga0207713_10022212 | 380 |
| 665 | 3300025735 | Ga0207713_1005180 | Ga0207713_100518011 | 380 |
| 666 | 3300025735 | Ga0207713_1005193 | Ga0207713_100519311 | 380 |
| 667 | 3300025735 | Ga0207713_1023472 | Ga0207713_10234724 | 380 |
| 668 | 3300025935 | Ga0207709_10000035 | Ga0207709_1000003599 | 380 |
| 669 | 3300027111 | Ga0209281_1000077 | Ga0209281_100007792 | 380 |
| 670 | 3300027111 | Ga0209281_1003944 | Ga0209281_10039441 | 380 |
| 671 | 3300027907 | Ga0207428_10019213 | Ga0207428_100192131 | 380 |
| 672 | 3300027907 | Ga0207428_10047817 | Ga0207428_100478173 | 380 |
| 673 | 3300027907 | Ga0207428_10068251 | Ga0207428_100682513 | 380 |
| 674 | 3300032005 | Ga0307411_10251205 | Ga0307411_102512052 | 380 |
| 675 | 3300033180 | Ga0307510_10007567 | Ga0307510_100075674 | 380 |
| 676 | 3300038705 | Ga0237819_01237 | Ga0237819_01237_2066_3208 | 380 |
| 677 | 3300041405 | Ga0439438_012314 | Ga0439438_012314_87_1229 | 380 |
| 678 | 3300041405 | Ga0439438_012621 | Ga0439438_012621_17_1159 | 380 |
| 679 | 3300042010 | Ga0439452_010576 | Ga0439452_010576_68_1210 | 380 |
| 680 | 3300042122 | Ga0450920_003522 | Ga0450920_003522_96_1238 | 380 |
| 681 | 3300042145 | Ga0450906_008493 | Ga0450906_008493_817_1959 | 380 |
| 682 | 3300042146 | Ga0450907_006733 | Ga0450907_006733_426_1568 | 380 |
| 683 | 3300042147 | Ga0450910_002701 | Ga0450910_002701_1061_2203 | 380 |
| 684 | 3300042533 | Ga0450901_001756 | Ga0450901_001756_1226_2368 | 380 |
| 685 | 3300044656 | Ga0466969_0000928 | Ga0466969_0000928_5009_6286 | 380 |
| 686 | 3300044684 | Ga0466966_0001527 | Ga0466966_0001527_10494_11771 | 380 |
| 687 | 3300044693 | Ga0466961_0000036 | Ga0466961_0000036_60990_62267 | 380 |
| 688 | 3300045049 | Ga0466959_0049607 | Ga0466959_0049607_1719_2996 | 380 |
| 689 | 3300046452 | Ga0495617_010279 | Ga0495617_010279_53_1195 | 380 |
| 690 | 3300046452 | Ga0495617_013362 | Ga0495617_013362_67_1209 | 380 |
| 691 | 3300046452 | Ga0495617_022531 | Ga0495617_022531_56_1198 | 380 |
| 692 | 3300046453 | Ga0495627_001562 | Ga0495627_001562_10126_11268 | 380 |
| 693 | 3300046453 | Ga0495627_014275 | Ga0495627_014275_82_1224 | 380 |
| 694 | 3300046457 | Ga0495590_0041743 | Ga0495590_0041743_70_1212 | 380 |
| 695 | 3300046458 | Ga0495591_012170 | Ga0495591_012170_1716_2858 | 380 |
| 696 | 3300046458 | Ga0495591_015835 | Ga0495591_015835_1431_2573 | 380 |
| 697 | 3300046458 | Ga0495591_016211 | Ga0495591_016211_67_1209 | 380 |
| 698 | 3300046458 | Ga0495591_025130 | Ga0495591_025130_26_1168 | 380 |
| 699 | 3300046458 | Ga0495591_026266 | Ga0495591_026266_630_1772 | 380 |
| 700 | 3300046460 | Ga0495638_0034184 | Ga0495638_0034184_2047_3189 | 380 |
| 701 | 3300046460 | Ga0495638_0051465 | Ga0495638_0051465_46_1188 | 380 |
| 702 | 3300046460 | Ga0495638_0053149 | Ga0495638_0053149_1363_2505 | 380 |
| 703 | 3300046460 | Ga0495638_0157135 | Ga0495638_0157135_30_1172 | 380 |
| 704 | 3300046463 | Ga0495653_0118494 | Ga0495653_0118494_673_1815 | 380 |
| 705 | 3300046471 | Ga0495650_0027093 | Ga0495650_0027093_1436_2578 | 380 |
| 706 | 3300046474 | Ga0495605_0034785 | Ga0495605_0034785_1380_2522 | 380 |
| 707 | 3300046474 | Ga0495605_0064048 | Ga0495605_0064048_584_1726 | 380 |
| 708 | 3300046475 | Ga0495639_0001985 | Ga0495639_0001985_7699_8841 | 380 |
| 709 | 3300046491 | Ga0495584_0030085 | Ga0495584_0030085_1563_2705 | 380 |
| 710 | 3300046491 | Ga0495584_0037457 | Ga0495584_0037457_59_1201 | 380 |
| 711 | 3300046491 | Ga0495584_0071541 | Ga0495584_0071541_35_1177 | 380 |
| 712 | 3300046492 | Ga0495585_0006456 | Ga0495585_0006456_4695_5837 | 380 |
| 713 | 3300046492 | Ga0495585_0039286 | Ga0495585_0039286_1424_2566 | 380 |
| 714 | 3300046492 | Ga0495585_0071554 | Ga0495585_0071554_52_1194 | 380 |
| 715 | 3300046492 | Ga0495585_0094929 | Ga0495585_0094929_40_1182 | 380 |
| 716 | 3300046499 | Ga0495594_0057768 | Ga0495594_0057768_964_2106 | 380 |
| 717 | 3300046499 | Ga0495594_0129600 | Ga0495594_0129600_82_1224 | 380 |
| 718 | 3300046501 | Ga0495607_0007952 | Ga0495607_0007952_4875_6017 | 380 |
| 719 | 3300046501 | Ga0495607_0042760 | Ga0495607_0042760_1482_2624 | 380 |
| 720 | 3300046501 | Ga0495607_0052500 | Ga0495607_0052500_72_1214 | 380 |
| 721 | 3300046506 | Ga0495583_0016893 | Ga0495583_0016893_1033_2175 | 380 |
| 722 | 3300046506 | Ga0495583_0030622 | Ga0495583_0030622_1370_2512 | 380 |
| 723 | 3300046506 | Ga0495583_0031597 | Ga0495583_0031597_56_1198 | 380 |
| 724 | 3300046507 | Ga0495606_0016837 | Ga0495606_0016837_4316_5458 | 380 |
| 725 | 3300046507 | Ga0495606_0042856 | Ga0495606_0042856_1534_2676 | 380 |
| 726 | 3300046507 | Ga0495606_0054539 | Ga0495606_0054539_1424_2566 | 380 |
| 727 | 3300046512 | Ga0495610_0008078 | Ga0495610_0008078_101_1243 | 380 |
| 728 | 3300046512 | Ga0495610_0027799 | Ga0495610_0027799_1481_2623 | 380 |
| 729 | 3300046512 | Ga0495610_0068495 | Ga0495610_0068495_430_1572 | 380 |
| 730 | 3300046513 | Ga0495616_0034048 | Ga0495616_0034048_68_1210 | 380 |
| 731 | 3300046513 | Ga0495616_0034383 | Ga0495616_0034383_1400_2542 | 380 |
| 732 | 3300046513 | Ga0495616_0035412 | Ga0495616_0035412_1427_2569 | 380 |
| 733 | 3300046515 | Ga0495620_0004777 | Ga0495620_0004777_1528_2670 | 380 |
| 734 | 3300046515 | Ga0495620_0027861 | Ga0495620_0027861_1476_2618 | 380 |
| 735 | 3300046517 | Ga0495630_0067846 | Ga0495630_0067846_52_1194 | 380 |
| 736 | 3300046518 | Ga0495631_0025277 | Ga0495631_0025277_1498_2640 | 380 |
| 737 | 3300046518 | Ga0495631_0026745 | Ga0495631_0026745_66_1208 | 380 |
| 738 | 3300046519 | Ga0495632_0027024 | Ga0495632_0027024_83_1225 | 380 |
| 739 | 3300046519 | Ga0495632_0031356 | Ga0495632_0031356_83_1225 | 380 |
| 740 | 3300046519 | Ga0495632_0036929 | Ga0495632_0036929_1270_2412 | 380 |
| 741 | 3300046519 | Ga0495632_0039508 | Ga0495632_0039508_64_1206 | 380 |
| 742 | 3300046520 | Ga0495637_0001794 | Ga0495637_0001794_10055_11197 | 380 |
| 743 | 3300046520 | Ga0495637_0024175 | Ga0495637_0024175_72_1214 | 380 |
| 744 | 3300046520 | Ga0495637_0026566 | Ga0495637_0026566_1408_2550 | 380 |
| 745 | 3300046520 | Ga0495637_0039624 | Ga0495637_0039624_854_1996 | 380 |
| 746 | 3300046522 | Ga0495643_0041047 | Ga0495643_0041047_1331_2473 | 380 |
| 747 | 3300046523 | Ga0495644_0013275 | Ga0495644_0013275_71_1213 | 380 |
| 748 | 3300046524 | Ga0495648_0010375 | Ga0495648_0010375_1126_2268 | 380 |
| 749 | 3300046524 | Ga0495648_0010500 | Ga0495648_0010500_64_1206 | 380 |
| 750 | 3300046524 | Ga0495648_0047372 | Ga0495648_0047372_1495_2637 | 380 |
| 751 | 3300046524 | Ga0495648_0059813 | Ga0495648_0059813_64_1206 | 380 |
| 752 | 3300046524 | Ga0495648_0097238 | Ga0495648_0097238_454_1596 | 380 |
| 753 | 3300046524 | Ga0495648_0105742 | Ga0495648_0105742_40_1182 | 380 |
| 754 | 3300046526 | Ga0495666_0032996 | Ga0495666_0032996_1332_2474 | 380 |
| 755 | 3300046526 | Ga0495666_0104497 | Ga0495666_0104497_137_1279 | 380 |
| 756 | 3300046530 | Ga0495654_0022182 | Ga0495654_0022182_1714_2856 | 380 |
| 757 | 3300046530 | Ga0495654_0029783 | Ga0495654_0029783_1583_2725 | 380 |
| 758 | 3300046530 | Ga0495654_0033652 | Ga0495654_0033652_28_1170 | 380 |
| 759 | 3300046530 | Ga0495654_0037546 | Ga0495654_0037546_54_1196 | 380 |
| 760 | 3300046530 | Ga0495654_0102525 | Ga0495654_0102525_136_1278 | 380 |
| 761 | 3300046530 | Ga0495654_0112520 | Ga0495654_0112520_45_1187 | 380 |
| 762 | 3300046538 | Ga0495609_0027652 | Ga0495609_0027652_66_1208 | 380 |
| 763 | 3300046538 | Ga0495609_0080381 | Ga0495609_0080381_75_1217 | 380 |
| 764 | 3300046542 | Ga0495597_0025688 | Ga0495597_0025688_31_1173 | 380 |
| 765 | 3300046557 | Ga0495622_0019702 | Ga0495622_0019702_79_1221 | 380 |
| 766 | 3300046557 | Ga0495622_0023539 | Ga0495622_0023539_1434_2576 | 380 |
| 767 | 3300046557 | Ga0495622_0028385 | Ga0495622_0028385_71_1213 | 380 |
| 768 | 3300046557 | Ga0495622_0038923 | Ga0495622_0038923_100_1242 | 380 |
| 769 | 3300046648 | Ga0495611_0001045 | Ga0495611_0001045_1808_2950 | 380 |
| 770 | 3300046660 | Ga0495625_0021451 | Ga0495625_0021451_3739_4881 | 380 |
| 771 | 3300046664 | Ga0495659_0009531 | Ga0495659_0009531_230_1372 | 380 |
| 772 | 3300046665 | Ga0495661_0089374 | Ga0495661_0089374_54_1196 | 380 |
| 773 | 3300046679 | Ga0495623_0051655 | Ga0495623_0051655_1430_2572 | 380 |
| 774 | 3300046691 | Ga0495670_0001176 | Ga0495670_0001176_10124_11266 | 380 |
| 775 | 3300046691 | Ga0495670_0022477 | Ga0495670_0022477_97_1239 | 380 |
| 776 | 3300046691 | Ga0495670_0062205 | Ga0495670_0062205_63_1205 | 380 |
| 777 | 3300046692 | Ga0495671_0026951 | Ga0495671_0026951_1775_2917 | 380 |
| 778 | 3300046692 | Ga0495671_0032819 | Ga0495671_0032819_1451_2593 | 380 |
| 779 | 3300046692 | Ga0495671_0035802 | Ga0495671_0035802_63_1205 | 380 |
| 780 | 3300046692 | Ga0495671_0050589 | Ga0495671_0050589_80_1222 | 380 |
| 781 | 3300046694 | Ga0495649_0028085 | Ga0495649_0028085_1908_3050 | 380 |
| 782 | 3300046694 | Ga0495649_0035392 | Ga0495649_0035392_56_1198 | 380 |
| 783 | 3300046694 | Ga0495649_0058033 | Ga0495649_0058033_56_1198 | 380 |
| 784 | 3300046694 | Ga0495649_0078390 | Ga0495649_0078390_54_1196 | 380 |
| 785 | 3300046694 | Ga0495649_0106763 | Ga0495649_0106763_55_1197 | 380 |
| 786 | 3300046694 | Ga0495649_0112709 | Ga0495649_0112709_83_1225 | 380 |
| 787 | 3300046794 | Ga0495589_0029162 | Ga0495589_0029162_1575_2717 | 380 |
| 788 | 3300046794 | Ga0495589_0032200 | Ga0495589_0032200_17_1159 | 380 |
| 789 | 3300046794 | Ga0495589_0037268 | Ga0495589_0037268_1264_2406 | 380 |
| 790 | 3300046809 | Ga0495600_0090800 | Ga0495600_0090800_808_1950 | 380 |
| 791 | 3300046810 | Ga0495660_0034912 | Ga0495660_0034912_1421_2563 | 380 |
| 792 | 3300046810 | Ga0495660_0035999 | Ga0495660_0035999_101_1243 | 380 |
| 793 | 3300046810 | Ga0495660_0052180 | Ga0495660_0052180_31_1173 | 380 |
| 794 | 3300046810 | Ga0495660_0074217 | Ga0495660_0074217_37_1179 | 380 |
| 795 | 3300047315 | Ga0495581_0081596 | Ga0495581_0081596_98_1240 | 380 |
| 796 | 3300047320 | Ga0495672_0042947 | Ga0495672_0042947_55_1197 | 380 |
| 797 | 3300047320 | Ga0495672_0044092 | Ga0495672_0044092_93_1235 | 380 |
| 798 | 3300047320 | Ga0495672_0056659 | Ga0495672_0056659_1082_2224 | 380 |
| 799 | 3300047322 | Ga0495680_0123274 | Ga0495680_0123274_66_1208 | 380 |
| 800 | 3300047323 | Ga0495683_0026477 | Ga0495683_0026477_1747_2889 | 380 |
| 801 | 3300047443 | Ga0495687_021761 | Ga0495687_021761_123_1265 | 380 |
| 802 | 3300047443 | Ga0495687_023299 | Ga0495687_023299_69_1211 | 380 |
| 803 | 3300047443 | Ga0495687_029792 | Ga0495687_029792_1360_2502 | 380 |
| 804 | 3300047469 | Ga0495673_0027187 | Ga0495673_0027187_78_1220 | 380 |
| 805 | 3300047469 | Ga0495673_0038335 | Ga0495673_0038335_66_1208 | 380 |
| 806 | 3300047470 | Ga0495681_0029334 | Ga0495681_0029334_1653_2795 | 380 |
| 807 | 3300047470 | Ga0495681_0029766 | Ga0495681_0029766_1574_2716 | 380 |
| 808 | 3300047470 | Ga0495681_0029968 | Ga0495681_0029968_1575_2717 | 380 |
| 809 | 3300047470 | Ga0495681_0037465 | Ga0495681_0037465_1153_2295 | 380 |
| 810 | 3300047472 | Ga0495686_0117995 | Ga0495686_0117995_345_1487 | 380 |
| 811 | 3300047673 | Ga0495593_0067271 | Ga0495593_0067271_661_1803 | 380 |
| 812 | 3300048091 | Ga0495626_0028155 | Ga0495626_0028155_118_1260 | 380 |
| 813 | 3300048091 | Ga0495626_0028439 | Ga0495626_0028439_1513_2655 | 380 |
| 814 | 3300048091 | Ga0495626_0030485 | Ga0495626_0030485_1418_2560 | 380 |
| 815 | 3300048091 | Ga0495626_0045829 | Ga0495626_0045829_880_2022 | 380 |
| 816 | 3300048919 | Ga0496116_0008407 | Ga0496116_0008407_105_1247 | 380 |
| 817 | 3300048921 | Ga0496118_0075693 | Ga0496118_0075693_1201_2343 | 380 |
| 818 | 3300048925 | Ga0496122_0062670 | Ga0496122_0062670_69_1211 | 380 |
| 819 | 3300048925 | Ga0496122_0164285 | Ga0496122_0164285_73_1215 | 380 |
| 820 | 3300048926 | Ga0496123_0104869 | Ga0496123_0104869_453_1595 | 380 |
| 821 | 3300048926 | Ga0496123_0161524 | Ga0496123_0161524_28_1170 | 380 |
| 822 | 3300048927 | Ga0496124_0219866 | Ga0496124_0219866_217_1359 | 380 |
| 823 | 3300049459 | Ga0495678_025095 | Ga0495678_025095_23_1165 | 380 |
| 824 | 3300049459 | Ga0495678_032517 | Ga0495678_032517_920_2062 | 380 |
| 825 | 3300049460 | Ga0495682_0016504 | Ga0495682_0016504_1553_2695 | 380 |
| 826 | 3300049460 | Ga0495682_0016685 | Ga0495682_0016685_12_1154 | 380 |
| 827 | 3300049460 | Ga0495682_0033487 | Ga0495682_0033487_74_1216 | 380 |
| 828 | 3300053111 | Ga0500572_006879 | Ga0500572_006879_1370_2512 | 380 |
| 829 | 3300009011 | Ga0105251_10000125 | Ga0105251_1000012587 | 381 |
| 830 | 3300009092 | Ga0105250_10000612 | Ga0105250_1000061218 | 381 |
| 831 | 3300025711 | Ga0207696_1000191 | Ga0207696_100019125 | 381 |
| 832 | 3300025735 | Ga0207713_1000166 | Ga0207713_100016623 | 381 |
| 833 | 3300025735 | Ga0207713_1037223 | Ga0207713_10372232 | 381 |
| 834 | 3300041411 | Ga0439466_0014068 | Ga0439466_0014068_1677_2822 | 381 |
| 835 | 3300042016 | Ga0439463_001279 | Ga0439463_001279_5477_6622 | 381 |
| 836 | 3300042156 | Ga0439446_0005983 | Ga0439446_0005983_1741_2886 | 381 |
| 837 | 3300048927 | Ga0496124_0062022 | Ga0496124_0062022_1910_3055 | 381 |
| 838 | 3300049459 | Ga0495678_042255 | Ga0495678_042255_261_1406 | 381 |
| 839 | iso_pu_bacteria | 2511231016 | 2511326190 | 381 |
| 840 | iso_pu_bacteria | 2511231018 | 2511339587 | 381 |
| 841 | iso_pu_bacteria | 2511231019 | 2511344660 | 381 |
| 842 | iso_pu_bacteria | 2511231022 | 2511365753 | 381 |
| 843 | iso_pu_bacteria | 2773857670 | 2774119184 | 381 |
| 844 | iso_pu_bacteria | 2784132072 | 2784314834 | 381 |
| 845 | iso_pu_bacteria | 2808606377 | 2808930604 | 381 |
| 846 | iso_pu_bacteria | 2808606381 | 2808952726 | 381 |
| 847 | iso_pu_bacteria | 2808606382 | 2808958989 | 381 |
| 848 | iso_pu_bacteria | 2808606445 | 2809218762 | 381 |
| 849 | iso_pu_bacteria | 2860339153 | 2860340789 | 381 |
| 850 | iso_pu_bacteria | 2919456309 | 2919461079 | 381 |
| 851 | iso_pu_bacteria | 2931396565 | 2931403342 | 381 |
| 852 | iso_pu_bacteria | 3007511990 | 3007515321 | 381 |
| 853 | iso_pu_bacteria | 3007619802 | 3007620077 | 381 |
| 854 | iso_pu_bacteria | 8056177738 | 8056179480 | 381 |
| 855 | 3300042142 | Ga0450905_005198 | Ga0450905_005198_539_1687 | 382 |
| 856 | 3300046536 | Ga0495587_0085550 | Ga0495587_0085550_95_1243 | 382 |
| 857 | 3300046642 | Ga0495634_0042607 | Ga0495634_0042607_1894_3042 | 382 |
| 858 | 3300046663 | Ga0495635_0053856 | Ga0495635_0053856_57_1205 | 382 |
| 859 | 3300048929 | Ga0496126_0113263 | Ga0496126_0113263_72_1220 | 382 |
| 860 | 3300009011 | Ga0105251_10005278 | Ga0105251_100052781 | 383 |
| 861 | 3300009011 | Ga0105251_10027770 | Ga0105251_100277701 | 383 |
| 862 | 3300013100 | Ga0157373_10045585 | Ga0157373_100455851 | 383 |
| 863 | 3300015261 | Ga0182006_1017477 | Ga0182006_10174771 | 383 |
| 864 | 3300042115 | Ga0450911_002953 | Ga0450911_002953_1898_3079 | 383 |
| 865 | 3300046458 | Ga0495591_000128 | Ga0495591_000128_81288_82496 | 383 |
| 866 | 3300046529 | Ga0495652_0072802 | Ga0495652_0072802_1610_2782 | 383 |
| 867 | 3300046810 | Ga0495660_0002049 | Ga0495660_0002049_11373_12581 | 383 |
| 868 | 3300048925 | Ga0496122_0066210 | Ga0496122_0066210_1313_2581 | 383 |
| 869 | iso_pu_bacteria | 8015687852 | 8015692047 | 383 |
| 870 | iso_pu_bacteria | 2511231004 | 2511255046 | 384 |
| 871 | iso_pu_bacteria | 2511231008 | 2511276050 | 384 |
| 872 | 2124908027 | MRS2a_Contig_6176 | MRS2a_00075380 | 385 |
| 873 | 3300005288 | Ga0065714_10000759 | Ga0065714_100007592 | 385 |
| 874 | 3300005288 | Ga0065714_10024949 | Ga0065714_100249491 | 385 |
| 875 | 3300005288 | Ga0065714_10109927 | Ga0065714_101099272 | 385 |
| 876 | 3300005288 | Ga0065714_10121590 | Ga0065714_101215901 | 385 |
| 877 | 3300005293 | Ga0065715_10127901 | Ga0065715_101279012 | 385 |
| 878 | 3300009036 | Ga0105244_10071664 | Ga0105244_100716641 | 385 |
| 879 | 3300013100 | Ga0157373_10219316 | Ga0157373_102193161 | 385 |
| 880 | 3300013102 | Ga0157371_10045305 | Ga0157371_100453051 | 385 |
| 881 | 3300013104 | Ga0157370_10318808 | Ga0157370_103188081 | 385 |
| 882 | 3300015261 | Ga0182006_1030098 | Ga0182006_10300983 | 385 |
| 883 | 3300015261 | Ga0182006_1033945 | Ga0182006_10339453 | 385 |
| 884 | 3300015265 | Ga0182005_1022357 | Ga0182005_10223572 | 385 |
| 885 | 3300015265 | Ga0182005_1035494 | Ga0182005_10354942 | 385 |
| 886 | 3300017792 | Ga0163161_10036333 | Ga0163161_100363334 | 385 |
| 887 | 3300025711 | Ga0207696_1022598 | Ga0207696_10225982 | 385 |
| 888 | 3300025728 | Ga0207655_1016926 | Ga0207655_10169264 | 385 |
| 889 | 3300025735 | Ga0207713_1000530 | Ga0207713_100053028 | 385 |
| 890 | 3300041407 | Ga0439447_010218 | Ga0439447_010218_71_1237 | 385 |
| 891 | 3300041411 | Ga0439466_0026865 | Ga0439466_0026865_821_1987 | 385 |
| 892 | 3300042139 | Ga0450904_002558 | Ga0450904_002558_60_1217 | 385 |
| 893 | 3300046452 | Ga0495617_023210 | Ga0495617_023210_879_2036 | 385 |
| 894 | 3300046455 | Ga0495603_0033091 | Ga0495603_0033091_1869_3026 | 385 |
| 895 | 3300046460 | Ga0495638_0051052 | Ga0495638_0051052_66_1223 | 385 |
| 896 | 3300046471 | Ga0495650_0021504 | Ga0495650_0021504_1869_3026 | 385 |
| 897 | 3300046471 | Ga0495650_0027294 | Ga0495650_0027294_1458_2615 | 385 |
| 898 | 3300046474 | Ga0495605_0032305 | Ga0495605_0032305_57_1214 | 385 |
| 899 | 3300046474 | Ga0495605_0033551 | Ga0495605_0033551_1399_2562 | 385 |
| 900 | 3300046474 | Ga0495605_0043020 | Ga0495605_0043020_996_2153 | 385 |
| 901 | 3300046491 | Ga0495584_0023632 | Ga0495584_0023632_30_1187 | 385 |
| 902 | 3300046491 | Ga0495584_0118003 | Ga0495584_0118003_74_1231 | 385 |
| 903 | 3300046492 | Ga0495585_0036868 | Ga0495585_0036868_1553_2710 | 385 |
| 904 | 3300046492 | Ga0495585_0129452 | Ga0495585_0129452_95_1252 | 385 |
| 905 | 3300046499 | Ga0495594_0090802 | Ga0495594_0090802_132_1289 | 385 |
| 906 | 3300046501 | Ga0495607_0076053 | Ga0495607_0076053_665_1822 | 385 |
| 907 | 3300046501 | Ga0495607_0091553 | Ga0495607_0091553_47_1204 | 385 |
| 908 | 3300046506 | Ga0495583_0069941 | Ga0495583_0069941_113_1270 | 385 |
| 909 | 3300046507 | Ga0495606_0041173 | Ga0495606_0041173_26_1183 | 385 |
| 910 | 3300046512 | Ga0495610_0025493 | Ga0495610_0025493_1946_3103 | 385 |
| 911 | 3300046512 | Ga0495610_0054237 | Ga0495610_0054237_732_1889 | 385 |
| 912 | 3300046518 | Ga0495631_0019601 | Ga0495631_0019601_1921_3078 | 385 |
| 913 | 3300046519 | Ga0495632_0012549 | Ga0495632_0012549_64_1221 | 385 |
| 914 | 3300046519 | Ga0495632_0051664 | Ga0495632_0051664_48_1205 | 385 |
| 915 | 3300046520 | Ga0495637_0022802 | Ga0495637_0022802_22_1179 | 385 |
| 916 | 3300046520 | Ga0495637_0057872 | Ga0495637_0057872_70_1227 | 385 |
| 917 | 3300046528 | Ga0495642_0015737 | Ga0495642_0015737_1698_2855 | 385 |
| 918 | 3300046538 | Ga0495609_0027260 | Ga0495609_0027260_1381_2538 | 385 |
| 919 | 3300046542 | Ga0495597_0028235 | Ga0495597_0028235_1342_2499 | 385 |
| 920 | 3300046558 | Ga0495633_0022860 | Ga0495633_0022860_1920_3077 | 385 |
| 921 | 3300046615 | Ga0495656_0012220 | Ga0495656_0012220_1991_3148 | 385 |
| 922 | 3300046648 | Ga0495611_0111163 | Ga0495611_0111163_51_1208 | 385 |
| 923 | 3300046660 | Ga0495625_0111690 | Ga0495625_0111690_623_1780 | 385 |
| 924 | 3300046660 | Ga0495625_0202911 | Ga0495625_0202911_81_1238 | 385 |
| 925 | 3300046665 | Ga0495661_0068298 | Ga0495661_0068298_871_2028 | 385 |
| 926 | 3300046665 | Ga0495661_0073412 | Ga0495661_0073412_722_1879 | 385 |
| 927 | 3300046665 | Ga0495661_0088550 | Ga0495661_0088550_583_1740 | 385 |
| 928 | 3300046674 | Ga0495588_0084004 | Ga0495588_0084004_382_1539 | 385 |
| 929 | 3300046679 | Ga0495623_0041257 | Ga0495623_0041257_12_1169 | 385 |
| 930 | 3300046689 | Ga0495613_0133482 | Ga0495613_0133482_584_1741 | 385 |
| 931 | 3300046692 | Ga0495671_0060052 | Ga0495671_0060052_36_1193 | 385 |
| 932 | 3300046694 | Ga0495649_0140474 | Ga0495649_0140474_97_1254 | 385 |
| 933 | 3300047319 | Ga0495674_0072281 | Ga0495674_0072281_1794_2951 | 385 |
| 934 | 3300047322 | Ga0495680_0055198 | Ga0495680_0055198_1831_2988 | 385 |
| 935 | 3300047323 | Ga0495683_0023630 | Ga0495683_0023630_88_1245 | 385 |
| 936 | 3300047444 | Ga0495675_0066999 | Ga0495675_0066999_1057_2214 | 385 |
| 937 | 3300047445 | Ga0495677_0016142 | Ga0495677_0016142_1458_2615 | 385 |
| 938 | 3300047446 | Ga0495679_019895 | Ga0495679_019895_1137_2294 | 385 |
| 939 | 3300047447 | Ga0495685_026843 | Ga0495685_026843_742_1899 | 385 |
| 940 | 3300047469 | Ga0495673_0021249 | Ga0495673_0021249_67_1224 | 385 |
| 941 | 3300047470 | Ga0495681_0028400 | Ga0495681_0028400_60_1217 | 385 |
| 942 | 3300047470 | Ga0495681_0033268 | Ga0495681_0033268_1354_2511 | 385 |
| 943 | 3300047470 | Ga0495681_0090593 | Ga0495681_0090593_68_1225 | 385 |
| 944 | 3300047472 | Ga0495686_0045948 | Ga0495686_0045948_1557_2714 | 385 |
| 945 | 3300048905 | Ga0496102_0073025 | Ga0496102_0073025_73_1230 | 385 |
| 946 | 3300048906 | Ga0496103_0037628 | Ga0496103_0037628_60_1217 | 385 |
| 947 | 3300048919 | Ga0496116_0081774 | Ga0496116_0081774_803_1960 | 385 |
| 948 | 3300048920 | Ga0496117_0154892 | Ga0496117_0154892_147_1304 | 385 |
| 949 | 3300048921 | Ga0496118_0068523 | Ga0496118_0068523_1360_2517 | 385 |
| 950 | 3300048924 | Ga0496121_0092571 | Ga0496121_0092571_1184_2341 | 385 |
| 951 | 3300048924 | Ga0496121_0144818 | Ga0496121_0144818_82_1239 | 385 |
| 952 | 3300048927 | Ga0496124_0173931 | Ga0496124_0173931_463_1620 | 385 |
| 953 | 3300048928 | Ga0496125_0064361 | Ga0496125_0064361_1739_2896 | 385 |
| 954 | 3300049459 | Ga0495678_064892 | Ga0495678_064892_88_1245 | 385 |
| 955 | 3300049460 | Ga0495682_0015572 | Ga0495682_0015572_133_1290 | 385 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j7m-assembly2.cif.gz_C | complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p | 0.9767 | 9 | 381 |
| 6j7l-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa earp in complex with tdp | 0.9725 | 11 | 380 |
| 6j7j-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa earp | 0.9721 | 11 | 380 |
| 6j7m-assembly2.cif.gz_C | complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p | 0.964 | 9 | 381 |
| 6j7l-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa earp in complex with tdp | 0.9423 | 11 | 380 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0E1A4_2_117_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.6974 | 252 | 314 | 3.40.50.2000 |
| af_Q10B95_32_242_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.6499 | 9 | 95 | 3.40.50.150 |
| af_O15229_1_369_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.6276 | 3 | 50 | 3.50.50.60 |
| 2yjnA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.6242 | 184 | 366 | 3.40.50.2000 |
| af_I1J850_294_457_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.6006 | 186 | 360 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A109LCU4-F1-model_v4 | Protein-arginine rhamnosyltransferase (EF-P arginine rhamnosyltransferase) | 0.9905 | 193 | 381 |
GO:0106361
|
| AF-S6VRQ1-F1-model_v4 | Protein-arginine rhamnosyltransferase (EF-P arginine rhamnosyltransferase) | 0.9871 | 207 | 379 |
GO:0106361
|
| AF-A0A257D5X2-F1-model_v4 | deleted | 0.9866 | 11 | 381 |
|
| AF-U2B1T9-F1-model_v4 | Protein-arginine rhamnosyltransferase (EF-P arginine rhamnosyltransferase) | 0.9866 | 175 | 380 |
GO:0106361
|
| AF-A0A3D9EUM4-F1-model_v4 | Elongation factor P (EF-P) | 0.9842 | 11 | 380 |
GO:0003746
GO:0005737 GO:0043043 GO:0106361 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar