F486697

General Info

Members Datasets Scaffolds Average Seq Length
955 448 737 376

Family's Representative Sequence

Representative Sequence 2162886011|MRS1b_contig_6976788|MRS1b_0576.00002960
Length 432
Sequence MAGFLAGGHSVIVPCLKSVDDNRASGEYPKRALVWRRRFVLKDNHPFITLPQGARMKASWDIFCSVVDNYGDVGVTWRLARQLVAEHGLKIRLWIDDLSAFARLCPQADAHVEQQWHEGVEVCLWPKEWVSTDIPEGVIEAFACRLPAAYTDAMLQRSPRPVWLNLDYLSAEEWVTGCHGLPSLQSSGLRKFFFFPGFRDTTGGLLRENSLIEQRRAFQRDNKARLDFLSRLGVEPRIDARLISVFAYENPALGSWLDTLSGDSHATHLLVPEGRILGDLQQWLGVDHLQVGEVLRRGSLTVQVLPFVSQEDYDRVLWSCHFNVVRGEDSFVRAQWAGRPMLWHIYQQEGDAHLPKLDAFLELYLAGLSPEAGQALDAFWQAWNANQALSEXXXLLSNHWPEVQRHAEQWCDEQASRTDLAAALVQFYVNSL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231010 Pseudomonas sp. GM25 Isolate Nodule
9 2511231011 Pseudomonas sp. GM30 Isolate Nodule
10 2511231012 Pseudomonas sp. GM33 Isolate Nodule
11 2511231014 Pseudomonas sp. GM48 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231024 Pseudomonas sp. GM84 Isolate Nodule
19 2511231031 Pseudomonas sp. GM16 Isolate Nodule
20 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
21 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
22 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
23 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
24 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
25 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
26 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
27 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
28 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
29 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
30 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
31 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
32 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
33 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
34 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
35 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
36 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
37 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
38 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
39 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
40 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
41 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
42 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
43 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
44 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
45 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
46 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
47 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
48 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
49 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
50 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
51 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
52 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
53 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
54 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
55 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
56 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
57 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
58 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
59 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
60 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
61 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
62 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
63 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
64 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
65 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
66 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
67 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
68 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
69 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
70 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
71 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
72 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
73 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
74 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
75 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
76 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
77 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
78 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
79 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
80 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
81 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
82 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
83 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
84 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
85 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
86 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
87 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
88 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
89 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
90 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
91 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
92 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
93 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
94 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
95 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
96 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
97 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
98 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
99 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
100 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
101 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
102 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
103 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
104 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
105 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
106 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
107 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
108 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
109 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
110 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
111 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
112 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
113 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
114 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
115 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
116 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
117 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
118 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
119 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
120 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
121 2765235841 Pseudomonas putida AA7 Isolate Unclassified
122 2773857670 Pseudomonas sp. 478 Isolate Unclassified
123 2773857673 Pseudomonas sp. 443 Isolate Unclassified
124 2784132072 Pseudomonas sp. 460 Isolate Unclassified
125 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
126 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
127 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
128 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
129 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
130 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
131 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
132 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
133 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
134 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
135 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
136 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
137 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
138 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
139 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
140 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
141 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
142 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
143 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
144 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
145 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
146 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
147 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
148 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
149 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
150 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
151 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
152 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
153 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
154 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
155 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
156 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
157 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
158 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
159 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
160 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
161 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
162 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
163 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
164 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
165 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
166 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
167 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
168 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
169 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
170 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
171 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
172 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
173 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
174 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
175 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
176 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
177 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
178 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
179 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
180 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
181 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
182 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
183 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
184 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
185 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
186 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
187 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
188 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
189 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
190 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
191 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
192 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
193 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
194 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
195 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
196 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
197 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
198 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
199 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
200 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
201 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
202 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
203 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
204 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
205 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
206 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
207 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
208 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
209 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
210 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
211 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
212 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
213 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
214 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
215 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
216 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
217 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
218 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
219 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
220 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
221 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
222 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
223 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
224 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
225 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
226 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
227 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
228 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
229 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
230 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
231 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
232 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
233 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
234 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
235 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
236 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
237 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
238 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
239 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
240 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
241 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
242 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
243 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
244 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
245 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
246 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
247 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
248 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
249 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
250 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
256 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
257 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
259 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
261 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
262 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
279 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
281 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
283 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
284 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
285 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
286 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
287 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
288 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
289 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
290 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
291 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
292 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
293 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
294 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
295 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
296 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
297 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
298 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
299 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
300 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
301 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
302 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
303 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
304 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
305 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
306 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
307 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
308 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
309 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
310 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
311 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
312 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
313 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
314 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
315 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
316 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
317 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
318 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
319 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
320 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
321 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
322 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
323 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
326 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
327 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
328 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
329 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
330 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
331 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
332 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
333 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
334 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
335 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
338 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
339 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
340 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
341 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
342 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
343 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
344 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
345 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
346 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
349 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
350 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
351 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
352 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
353 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
354 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
355 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
358 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
359 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
360 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
361 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
362 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
363 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
364 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
365 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
366 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
367 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
370 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
373 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
374 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
383 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
386 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
387 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
388 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
389 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
390 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
391 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
392 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
393 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
394 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
395 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
396 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
397 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
398 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
399 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
400 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
401 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
402 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
405 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
406 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
407 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
408 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
409 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
410 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
411 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
412 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
413 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
414 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
415 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
416 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
417 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
418 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
419 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
420 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
421 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
422 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
423 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
424 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
425 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
426 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
427 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
428 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
429 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
430 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
431 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
432 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
433 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
434 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
435 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
436 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
437 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
438 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
439 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
440 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
441 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
442 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
443 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
444 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
445 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
446 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
447 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
448 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.17
Metatranscriptomes 0
Isolates 22.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.34
Nodule 2.3
Rhizoplane 7.33
Rhizosphere 72.88
Stem 0
Stem Tuber 0
Unclassified 12.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6176 2124908027 Bacteria 5712
2 SwRhRL2b_contig_2223659 2162886007 Bacteria 2860
3 MRS1b_contig_6976788 2162886011 Bacteria 3368
4 JGI25162J39368_1001980 3300002737 Bacteria 9178
5 JGI25163J39215_1001687 3300002771 Bacteria 3176
6 JGI25164J39214_1000968 3300002772 Bacteria 9177
7 JGI25165J46597_1000362 3300003214 Bacteria 50814
8 Ga0055539_1000134 3300003752 Bacteria 78300
9 Ga0055533_1000138 3300003756 Bacteria 78275
10 Ga0055532_1000142 3300003758 Bacteria 69999
11 Ga0055525_1000183 3300003759 Bacteria 78300
12 Ga0055535_1005240 3300003761 Bacteria 2899
13 Ga0055526_1019534 3300003771 Bacteria 2466
14 Ga0055536_1003164 3300003781 Bacteria 8924
15 Ga0055536_1011927 3300003781 Bacteria 3275
16 Ga0055536_1011959 3300003781 Bacteria 3267
17 Ga0055530_10011048 3300003791 Bacteria 3276
18 Ga0055530_10011088 3300003791 Bacteria 3268
19 Ga0055530_10037562 3300003791 Bacteria 1210
20 Ga0055540_1003543 3300003792 Bacteria 7476
21 Ga0055540_1009780 3300003792 Bacteria 3268
22 Ga0055531_10000155 3300003794 Bacteria 79002
23 Ga0055541_1000089 3300003841 Bacteria 78275
24 Ga0065714_10000759 3300005288 Bacteria 2667
25 Ga0065714_10003248 3300005288 Bacteria 11726
26 Ga0065714_10016937 3300005288 Bacteria 1359
27 Ga0065714_10024949 3300005288 Bacteria 1326
28 Ga0065714_10065661 3300005288 Bacteria 8972
29 Ga0065714_10068871 3300005288 Bacteria 4502
30 Ga0065714_10072724 3300005288 Bacteria 3313
31 Ga0065714_10073020 3300005288 Bacteria 3258
32 Ga0065714_10082358 3300005288 Bacteria 2287
33 Ga0065714_10099572 3300005288 Bacteria 1680
34 Ga0065714_10109927 3300005288 Bacteria 1493
35 Ga0065714_10121590 3300005288 Bacteria 1342
36 Ga0065704_10073943 3300005289 Bacteria 6647
37 Ga0065712_10068223 3300005290 Bacteria 12740
38 Ga0065712_10076344 3300005290 Bacteria 3680
39 Ga0065715_10127901 3300005293 Bacteria 2077
40 Ga0070670_100061378 3300005331 Bacteria 3227
41 Ga0070661_100001382 3300005344 Bacteria 16961
42 Ga0070669_100003585 3300005353 Bacteria 11204
43 Ga0070669_100050275 3300005353 Bacteria 3045
44 Ga0070662_100004011 3300005457 Bacteria 9231
45 Ga0070665_100044913 3300005548 Bacteria 4435
46 Ga0070664_100005010 3300005564 Bacteria 10613
47 Ga0068851_10000050 3300005834 Bacteria 72913
48 Ga0075432_10001936 3300006058 Bacteria 6873
49 Ga0075432_10009655 3300006058 Bacteria 3285
50 Ga0075432_10064265 3300006058 Bacteria 1310
51 Ga0075362_10029125 3300006177 Bacteria 2377
52 Ga0075436_100125576 3300006914 Bacteria 1797
53 Ga0079104_1000124 3300006946 Bacteria 110752
54 Ga0079104_1000346 3300006946 Bacteria 55624
55 Ga0105251_10000125 3300009011 Bacteria 77078
56 Ga0105251_10005278 3300009011 Bacteria 8501
57 Ga0105251_10007357 3300009011 Bacteria 6801
58 Ga0105251_10021500 3300009011 Bacteria 3367
59 Ga0105251_10027770 3300009011 Bacteria 2864
60 Ga0105251_10035119 3300009011 Bacteria 2476
61 Ga0105251_10076599 3300009011 Bacteria 1552
62 Ga0105244_10001004 3300009036 Bacteria 23633
63 Ga0105244_10001906 3300009036 Bacteria 16204
64 Ga0105244_10003260 3300009036 Bacteria 11709
65 Ga0105244_10025034 3300009036 Bacteria 3249
66 Ga0105244_10032220 3300009036 Bacteria 2776
67 Ga0105244_10044084 3300009036 Bacteria 2299
68 Ga0105244_10071664 3300009036 Bacteria 1727
69 Ga0105244_10085648 3300009036 Bacteria 1555
70 Ga0105250_10000612 3300009092 Bacteria 23290
71 Ga0105250_10028504 3300009092 Bacteria 2248
72 Ga0105250_10030721 3300009092 Bacteria 2159
73 Ga0105250_10071089 3300009092 Bacteria 1405
74 Ga0105250_10088822 3300009092 Bacteria 1256
75 Ga0105250_10088823 3300009092 Bacteria 1256
76 Ga0105243_10006610 3300009148 Bacteria 8953
77 Ga0105243_10050449 3300009148 Bacteria 3287
78 Ga0105243_10067654 3300009148 Bacteria 2876
79 Ga0105243_10186928 3300009148 Bacteria 1806
80 Ga0105242_10002363 3300009176 Bacteria 14891
81 Ga0105248_10071057 3300009177 Bacteria 3909
82 Ga0105237_10001117 3300009545 Bacteria 35949
83 Ga0105246_10000120 3300011119 Bacteria 35764
84 Ga0105246_10000955 3300011119 Bacteria 16543
85 Ga0105246_10042404 3300011119 Bacteria 3081
86 Ga0157345_1000641 3300012498 Bacteria 2926
87 Ga0157373_10045585 3300013100 Bacteria 3129
88 Ga0157373_10053495 3300013100 Bacteria 2870
89 Ga0157373_10056628 3300013100 Bacteria 2783
90 Ga0157373_10219316 3300013100 Bacteria 1342
91 Ga0157371_10000539 3300013102 Bacteria 45066
92 Ga0157371_10045305 3300013102 Bacteria 3130
93 Ga0157370_10011567 3300013104 Bacteria 9213
94 Ga0157370_10061911 3300013104 Bacteria 3551
95 Ga0157370_10238523 3300013104 Bacteria 1683
96 Ga0157370_10318808 3300013104 Bacteria 1434
97 Ga0157370_10372198 3300013104 Bacteria 1316
98 Ga0157369_10024274 3300013105 Bacteria 6747
99 Ga0157369_10027324 3300013105 Bacteria 6327
100 Ga0157369_10128942 3300013105 Bacteria 2681
101 Ga0163162_10084799 3300013306 Bacteria 3244
102 Ga0157372_10151925 3300013307 Bacteria 2673
103 Ga0157375_10091637 3300013308 Bacteria 3101
104 Ga0157375_10128203 3300013308 Bacteria 2655
105 Ga0157375_10157671 3300013308 Bacteria 2410
106 Ga0157375_10528237 3300013308 Bacteria 1343
107 Ga0182008_10000220 3300014497 Bacteria 44813
108 Ga0182008_10029330 3300014497 Bacteria 2780
109 Ga0182008_10031546 3300014497 Bacteria 2667
110 Ga0182008_10119219 3300014497 Bacteria 1311
111 Ga0182008_10120565 3300014497 Bacteria 1303
112 Ga0182006_1016215 3300015261 Bacteria 3179
113 Ga0182006_1017477 3300015261 Bacteria 3046
114 Ga0182006_1023118 3300015261 Bacteria 2576
115 Ga0182006_1030098 3300015261 Bacteria 2196
116 Ga0182006_1033945 3300015261 Bacteria 2044
117 Ga0182005_1022357 3300015265 Bacteria 1733
118 Ga0182005_1023978 3300015265 Bacteria 1668
119 Ga0182005_1027103 3300015265 Bacteria 1563
120 Ga0182005_1035494 3300015265 Bacteria 1356
121 Ga0163161_10028354 3300017792 Bacteria 3976
122 Ga0163161_10036333 3300017792 Bacteria 3528
123 Ga0163161_10053175 3300017792 Bacteria 2936
124 Ga0163161_10084181 3300017792 Bacteria 2345
125 Ga0209435_101864 3300025206 Bacteria 2539
126 Ga0209760_100266 3300025207 Bacteria 19495
127 Ga0209784_100040 3300025224 Bacteria 231812
128 Ga0209566_100051 3300025225 Bacteria 231920
129 Ga0209674_100072 3300025226 Bacteria 231812
130 Ga0209147_100067 3300025229 Bacteria 231812
131 Ga0209563_100073 3300025230 Bacteria 231920
132 Ga0209563_100986 3300025230 Bacteria 8338
133 Ga0207427_100074 3300025231 Bacteria 153455
134 Ga0209437_100006 3300025233 Bacteria 1042724
135 Ga0209258_100585 3300025242 Bacteria 30446
136 Ga0209646_1000325 3300025246 Bacteria 36642
137 Ga0209677_100121 3300025253 Bacteria 80378
138 Ga0209759_1013808 3300025256 Bacteria 2167
139 Ga0209233_1000105 3300025261 Bacteria 272035
140 Ga0209676_1000006 3300025292 Bacteria 1039588
141 Ga0209676_1000010 3300025292 Bacteria 954025
142 Ga0209676_1000223 3300025292 Bacteria 124359
143 Ga0209676_1015874 3300025292 Bacteria 2750
144 Ga0209564_1000005 3300025295 Bacteria 1147192
145 Ga0209050_1000081 3300025298 Bacteria 267533
146 Ga0209050_1000214 3300025298 Bacteria 129270
147 Ga0209050_1004712 3300025298 Bacteria 9042
148 Ga0209051_1000104 3300025303 Bacteria 161001
149 Ga0209051_1000163 3300025303 Bacteria 124249
150 Ga0209051_1021985 3300025303 Bacteria 2698
151 Ga0209257_1000040 3300025304 Bacteria 538759
152 Ga0207656_10000683 3300025321 Bacteria 11116
153 Ga0207696_1000171 3300025711 Bacteria 102599
154 Ga0207696_1000191 3300025711 Bacteria 94782
155 Ga0207696_1003722 3300025711 Bacteria 6828
156 Ga0207696_1014501 3300025711 Bacteria 2701
157 Ga0207696_1022598 3300025711 Bacteria 1996
158 Ga0207655_1000286 3300025728 Bacteria 77168
159 Ga0207655_1000654 3300025728 Bacteria 41218
160 Ga0207655_1002485 3300025728 Bacteria 14924
161 Ga0207655_1002922 3300025728 Bacteria 13144
162 Ga0207655_1003053 3300025728 Bacteria 12768
163 Ga0207655_1005310 3300025728 Bacteria 8814
164 Ga0207655_1016926 3300025728 Bacteria 3960
165 Ga0207655_1027662 3300025728 Bacteria 2696
166 Ga0207655_1065783 3300025728 Bacteria 1374
167 Ga0207713_1000166 3300025735 Bacteria 96359
168 Ga0207713_1000530 3300025735 Bacteria 38258
169 Ga0207713_1002221 3300025735 Bacteria 14387
170 Ga0207713_1002411 3300025735 Bacteria 13651
171 Ga0207713_1003362 3300025735 Bacteria 10971
172 Ga0207713_1005180 3300025735 Bacteria 8236
173 Ga0207713_1005193 3300025735 Bacteria 8222
174 Ga0207713_1018540 3300025735 Bacteria 3441
175 Ga0207713_1023472 3300025735 Bacteria 2902
176 Ga0207713_1037223 3300025735 Bacteria 2077
177 Ga0207713_1049875 3300025735 Bacteria 1675
178 Ga0207671_10000989 3300025914 Bacteria 35031
179 Ga0207649_10000041 3300025920 Bacteria 117781
180 Ga0207681_10002768 3300025923 Bacteria 11087
181 Ga0207650_10000174 3300025925 Bacteria 75634
182 Ga0207650_10001409 3300025925 Bacteria 17327
183 Ga0207706_10002445 3300025933 Bacteria 18134
184 Ga0207709_10000035 3300025935 Bacteria 300968
185 Ga0207709_10000821 3300025935 Bacteria 24022
186 Ga0207709_10067235 3300025935 Bacteria 2261
187 Ga0207679_10000018 3300025945 Bacteria 238375
188 Ga0209281_1000018 3300027111 Bacteria 579091
189 Ga0209281_1000077 3300027111 Bacteria 262887
190 Ga0209281_1003944 3300027111 Bacteria 4612
191 Ga0209371_1000237 3300027312 Bacteria 69091
192 Ga0209371_1000412 3300027312 Bacteria 44123
193 Ga0207428_10019213 3300027907 Bacteria 5827
194 Ga0207428_10047817 3300027907 Bacteria 3435
195 Ga0207428_10068251 3300027907 Bacteria 2798
196 Ga0207428_10081090 3300027907 Bacteria 2534
197 Ga0268266_10067858 3300028379 Bacteria 3087
198 Ga0268266_10201429 3300028379 Bacteria 1822
199 Ga0268256_1000485 3300030500 Bacteria 34065
200 Ga0268256_1000486 3300030500 Bacteria 33974
201 Ga0314311_1116939 3300030733 Bacteria 3490
202 Ga0316179_1034474 3300030734 Bacteria 3546
203 Ga0316178_1126744 3300030735 Bacteria 26718
204 Ga0307408_100000004 3300031548 Bacteria 572889
205 Ga0307408_100043312 3300031548 Bacteria 3202
206 Ga0307408_100057473 3300031548 Bacteria 2824
207 Ga0307405_10003193 3300031731 Bacteria 7464
208 Ga0307405_10031515 3300031731 Bacteria 3122
209 Ga0307413_10205928 3300031824 Bacteria 1424
210 Ga0307406_10034858 3300031901 Bacteria 3090
211 Ga0307412_10033335 3300031911 Bacteria 3272
212 Ga0307412_10125213 3300031911 Bacteria 1857
213 Ga0307409_100359645 3300031995 Bacteria 1376
214 Ga0307416_100121382 3300032002 Bacteria 2330
215 Ga0307414_10360013 3300032004 Bacteria 1251
216 Ga0307411_10080812 3300032005 Bacteria 2236
217 Ga0307411_10251205 3300032005 Bacteria 1390
218 Ga0307510_10007567 3300033180 Bacteria 12944
219 Ga0237819_01237 3300038705 Bacteria 7066
220 Ga0439438_003561 3300041405 Bacteria 6250
221 Ga0439438_009727 3300041405 Bacteria 3093
222 Ga0439438_012314 3300041405 Bacteria 2625
223 Ga0439438_012621 3300041405 Bacteria 2584
224 Ga0439438_025060 3300041405 Bacteria 1628
225 Ga0439438_036182 3300041405 Bacteria 1295
226 Ga0439447_010218 3300041407 Bacteria 2796
227 Ga0439447_010590 3300041407 Bacteria 2730
228 Ga0439447_016024 3300041407 Bacteria 2064
229 Ga0439466_0002783 3300041411 Bacteria 6845
230 Ga0439466_0008472 3300041411 Bacteria 3875
231 Ga0439466_0008509 3300041411 Bacteria 3869
232 Ga0439466_0014068 3300041411 Bacteria 2918
233 Ga0439466_0026865 3300041411 Bacteria 1997
234 Ga0439466_0028294 3300041411 Bacteria 1935
235 Ga0439466_0030242 3300041411 Bacteria 1858
236 Ga0439466_0033357 3300041411 Bacteria 1749
237 Ga0439466_0044018 3300041411 Bacteria 1480
238 Ga0439431_0006811 3300041997 Bacteria 2537
239 Ga0439432_017486 3300042006 Bacteria 2406
240 Ga0439432_032243 3300042006 Bacteria 1690
241 Ga0439452_001600 3300042010 Bacteria 8942
242 Ga0439452_002058 3300042010 Bacteria 7642
243 Ga0439452_008170 3300042010 Bacteria 3165
244 Ga0439452_010576 3300042010 Bacteria 2677
245 Ga0439452_021412 3300042010 Bacteria 1685
246 Ga0439456_002417 3300042013 Bacteria 3764
247 Ga0439456_004928 3300042013 Bacteria 2706
248 Ga0439456_004996 3300042013 Bacteria 2694
249 Ga0439463_001279 3300042016 Bacteria 6715
250 Ga0439463_039712 3300042016 Bacteria 1195
251 Ga0450911_000111 3300042115 Bacteria 33827
252 Ga0450911_002953 3300042115 Bacteria 3142
253 Ga0450911_003808 3300042115 Bacteria 2584
254 Ga0450920_003522 3300042122 Bacteria 2717
255 Ga0450890_007074 3300042127 Bacteria 1430
256 Ga0450902_003406 3300042137 Bacteria 2318
257 Ga0450903_013028 3300042138 Bacteria 1324
258 Ga0450904_000019 3300042139 Bacteria 39540
259 Ga0450904_002558 3300042139 Bacteria 2130
260 Ga0450905_005198 3300042142 Bacteria 1745
261 Ga0450905_006150 3300042142 Bacteria 1621
262 Ga0450906_008493 3300042145 Bacteria 1984
263 Ga0450907_002272 3300042146 Bacteria 3727
264 Ga0450907_006733 3300042146 Bacteria 1918
265 Ga0450907_011390 3300042146 Bacteria 1476
266 Ga0450910_002701 3300042147 Bacteria 2333
267 Ga0439446_0005983 3300042156 Bacteria 3151
268 Ga0439446_0006966 3300042156 Bacteria 2961
269 Ga0450908_004883 3300042184 Bacteria 2576
270 Ga0450909_000126 3300042185 Bacteria 7798
271 Ga0450909_012466 3300042185 Bacteria 1247
272 Ga0439434_0024725 3300042435 Bacteria 1812
273 Ga0439460_0010970 3300042461 Bacteria 2330
274 Ga0450901_000952 3300042533 Bacteria 3385
275 Ga0450901_001756 3300042533 Bacteria 2436
276 Ga0466969_0000928 3300044656 Bacteria 15826
277 Ga0466966_0001527 3300044684 Bacteria 14840
278 Ga0466961_0000036 3300044693 Bacteria 81498
279 Ga0466959_0002824 3300045049 Bacteria 11188
280 Ga0466959_0049607 3300045049 Bacteria 3084
281 Ga0495617_010279 3300046452 Bacteria 3204
282 Ga0495617_011394 3300046452 Bacteria 3033
283 Ga0495617_012372 3300046452 Bacteria 2907
284 Ga0495617_013362 3300046452 Bacteria 2793
285 Ga0495617_022531 3300046452 Bacteria 2129
286 Ga0495617_023210 3300046452 Bacteria 2096
287 Ga0495627_000152 3300046453 Bacteria 81535
288 Ga0495627_000169 3300046453 Bacteria 74332
289 Ga0495627_001562 3300046453 Bacteria 13009
290 Ga0495627_012091 3300046453 Bacteria 3073
291 Ga0495627_014275 3300046453 Bacteria 2776
292 Ga0495627_032110 3300046453 Bacteria 1654
293 Ga0495603_0033091 3300046455 Bacteria 3110
294 Ga0495603_0098414 3300046455 Bacteria 1708
295 Ga0495590_0013743 3300046457 Bacteria 2970
296 Ga0495590_0016521 3300046457 Bacteria 2663
297 Ga0495590_0021318 3300046457 Bacteria 2296
298 Ga0495590_0041743 3300046457 Bacteria 1599
299 Ga0495591_000128 3300046458 Bacteria 82830
300 Ga0495591_003049 3300046458 Bacteria 8898
301 Ga0495591_012170 3300046458 Bacteria 3214
302 Ga0495591_013547 3300046458 Bacteria 2972
303 Ga0495591_015710 3300046458 Bacteria 2664
304 Ga0495591_015835 3300046458 Bacteria 2648
305 Ga0495591_016211 3300046458 Bacteria 2606
306 Ga0495591_021436 3300046458 Bacteria 2108
307 Ga0495591_025130 3300046458 Bacteria 1873
308 Ga0495591_026266 3300046458 Bacteria 1812
309 Ga0495629_0056079 3300046459 Bacteria 2755
310 Ga0495638_0007628 3300046460 Bacteria 7733
311 Ga0495638_0007670 3300046460 Bacteria 7713
312 Ga0495638_0034184 3300046460 Bacteria 3246
313 Ga0495638_0051052 3300046460 Bacteria 2580
314 Ga0495638_0051465 3300046460 Bacteria 2568
315 Ga0495638_0053149 3300046460 Bacteria 2521
316 Ga0495638_0062437 3300046460 Bacteria 2300
317 Ga0495638_0071359 3300046460 Bacteria 2124
318 Ga0495638_0076055 3300046460 Bacteria 2045
319 Ga0495638_0099319 3300046460 Bacteria 1742
320 Ga0495638_0157135 3300046460 Bacteria 1314
321 Ga0495653_0013920 3300046463 Bacteria 6558
322 Ga0495653_0054158 3300046463 Bacteria 3066
323 Ga0495653_0071195 3300046463 Bacteria 2600
324 Ga0495653_0118494 3300046463 Bacteria 1890
325 Ga0495650_0003022 3300046471 Bacteria 12692
326 Ga0495650_0020793 3300046471 Bacteria 3190
327 Ga0495650_0021504 3300046471 Bacteria 3115
328 Ga0495650_0025175 3300046471 Bacteria 2794
329 Ga0495650_0027093 3300046471 Bacteria 2654
330 Ga0495650_0027294 3300046471 Bacteria 2640
331 Ga0495650_0038777 3300046471 Bacteria 2061
332 Ga0495650_0081331 3300046471 Bacteria 1248
333 Ga0495582_0025982 3300046473 Bacteria 3208
334 Ga0495605_0000088 3300046474 Bacteria 119191
335 Ga0495605_0001002 3300046474 Bacteria 19067
336 Ga0495605_0024557 3300046474 Bacteria 3152
337 Ga0495605_0032305 3300046474 Bacteria 2665
338 Ga0495605_0033551 3300046474 Bacteria 2604
339 Ga0495605_0034785 3300046474 Bacteria 2549
340 Ga0495605_0043020 3300046474 Bacteria 2241
341 Ga0495605_0064048 3300046474 Bacteria 1752
342 Ga0495605_0066926 3300046474 Bacteria 1705
343 Ga0495605_0119553 3300046474 Bacteria 1195
344 Ga0495639_0001985 3300046475 Bacteria 9063
345 Ga0495639_0102826 3300046475 Bacteria 1350
346 Ga0495584_0023632 3300046491 Bacteria 3116
347 Ga0495584_0030085 3300046491 Bacteria 2751
348 Ga0495584_0037457 3300046491 Bacteria 2451
349 Ga0495584_0048441 3300046491 Bacteria 2142
350 Ga0495584_0053964 3300046491 Bacteria 2022
351 Ga0495584_0071541 3300046491 Bacteria 1743
352 Ga0495584_0118003 3300046491 Bacteria 1343
353 Ga0495585_0006456 3300046492 Bacteria 7274
354 Ga0495585_0036868 3300046492 Bacteria 2755
355 Ga0495585_0039286 3300046492 Bacteria 2660
356 Ga0495585_0071554 3300046492 Bacteria 1890
357 Ga0495585_0094929 3300046492 Bacteria 1602
358 Ga0495585_0129452 3300046492 Bacteria 1329
359 Ga0495585_0142083 3300046492 Bacteria 1256
360 Ga0495585_0145534 3300046492 Bacteria 1238
361 Ga0495585_0151536 3300046492 Bacteria 1208
362 Ga0495594_0000262 3300046499 Bacteria 25773
363 Ga0495594_0057768 3300046499 Bacteria 2142
364 Ga0495594_0090802 3300046499 Bacteria 1711
365 Ga0495594_0129600 3300046499 Bacteria 1428
366 Ga0495596_0002947 3300046500 Bacteria 8830
367 Ga0495607_0000186 3300046501 Bacteria 66578
368 Ga0495607_0000827 3300046501 Bacteria 29265
369 Ga0495607_0007952 3300046501 Bacteria 7289
370 Ga0495607_0015142 3300046501 Bacteria 5007
371 Ga0495607_0015749 3300046501 Bacteria 4892
372 Ga0495607_0033580 3300046501 Bacteria 3121
373 Ga0495607_0042760 3300046501 Bacteria 2684
374 Ga0495607_0044154 3300046501 Bacteria 2629
375 Ga0495607_0047676 3300046501 Bacteria 2508
376 Ga0495607_0052500 3300046501 Bacteria 2361
377 Ga0495607_0063758 3300046501 Bacteria 2083
378 Ga0495607_0076053 3300046501 Bacteria 1858
379 Ga0495607_0089208 3300046501 Bacteria 1674
380 Ga0495607_0091553 3300046501 Bacteria 1646
381 Ga0495583_0000135 3300046506 Bacteria 123916
382 Ga0495583_0001024 3300046506 Bacteria 31772
383 Ga0495583_0002277 3300046506 Bacteria 16828
384 Ga0495583_0016893 3300046506 Bacteria 3898
385 Ga0495583_0028151 3300046506 Bacteria 2766
386 Ga0495583_0030622 3300046506 Bacteria 2617
387 Ga0495583_0031597 3300046506 Bacteria 2565
388 Ga0495583_0058271 3300046506 Bacteria 1734
389 Ga0495583_0069941 3300046506 Bacteria 1544
390 Ga0495606_0000453 3300046507 Bacteria 67136
391 Ga0495606_0012586 3300046507 Bacteria 6769
392 Ga0495606_0016837 3300046507 Bacteria 5554
393 Ga0495606_0041173 3300046507 Bacteria 3099
394 Ga0495606_0042856 3300046507 Bacteria 3023
395 Ga0495606_0048759 3300046507 Bacteria 2782
396 Ga0495606_0054539 3300046507 Bacteria 2588
397 Ga0495606_0073204 3300046507 Bacteria 2150
398 Ga0495610_0008078 3300046512 Bacteria 6884
399 Ga0495610_0025493 3300046512 Bacteria 3172
400 Ga0495610_0027799 3300046512 Bacteria 3000
401 Ga0495610_0028924 3300046512 Bacteria 2925
402 Ga0495610_0034224 3300046512 Bacteria 2618
403 Ga0495610_0035818 3300046512 Bacteria 2542
404 Ga0495610_0038040 3300046512 Bacteria 2444
405 Ga0495610_0054237 3300046512 Bacteria 1937
406 Ga0495610_0068495 3300046512 Bacteria 1662
407 Ga0495616_0002292 3300046513 Bacteria 12801
408 Ga0495616_0008007 3300046513 Bacteria 6294
409 Ga0495616_0034048 3300046513 Bacteria 2648
410 Ga0495616_0034383 3300046513 Bacteria 2632
411 Ga0495616_0035412 3300046513 Bacteria 2583
412 Ga0495616_0036932 3300046513 Bacteria 2517
413 Ga0495616_0047867 3300046513 Bacteria 2151
414 Ga0495620_0000034 3300046515 Bacteria 117942
415 Ga0495620_0004777 3300046515 Bacteria 7618
416 Ga0495620_0020775 3300046515 Bacteria 3199
417 Ga0495620_0027861 3300046515 Bacteria 2636
418 Ga0495620_0060996 3300046515 Bacteria 1570
419 Ga0495630_0067846 3300046517 Bacteria 2681
420 Ga0495631_0006409 3300046518 Bacteria 6074
421 Ga0495631_0019601 3300046518 Bacteria 3170
422 Ga0495631_0025277 3300046518 Bacteria 2736
423 Ga0495631_0026689 3300046518 Bacteria 2648
424 Ga0495631_0026745 3300046518 Bacteria 2645
425 Ga0495632_0000496 3300046519 Bacteria 37085
426 Ga0495632_0006673 3300046519 Bacteria 7381
427 Ga0495632_0012549 3300046519 Bacteria 4882
428 Ga0495632_0027024 3300046519 Bacteria 3011
429 Ga0495632_0030378 3300046519 Bacteria 2804
430 Ga0495632_0031356 3300046519 Bacteria 2748
431 Ga0495632_0032027 3300046519 Bacteria 2712
432 Ga0495632_0034011 3300046519 Bacteria 2611
433 Ga0495632_0035114 3300046519 Bacteria 2560
434 Ga0495632_0036929 3300046519 Bacteria 2482
435 Ga0495632_0039508 3300046519 Bacteria 2381
436 Ga0495632_0050009 3300046519 Bacteria 2063
437 Ga0495632_0051664 3300046519 Bacteria 2022
438 Ga0495637_0001794 3300046520 Bacteria 12293
439 Ga0495637_0002688 3300046520 Bacteria 9705
440 Ga0495637_0012771 3300046520 Bacteria 4007
441 Ga0495637_0022802 3300046520 Bacteria 2851
442 Ga0495637_0024175 3300046520 Bacteria 2749
443 Ga0495637_0024465 3300046520 Bacteria 2732
444 Ga0495637_0026566 3300046520 Bacteria 2596
445 Ga0495637_0039624 3300046520 Bacteria 2032
446 Ga0495637_0057872 3300046520 Bacteria 1599
447 Ga0495637_0085121 3300046520 Bacteria 1254
448 Ga0495643_0000291 3300046522 Bacteria 71440
449 Ga0495643_0009520 3300046522 Bacteria 6035
450 Ga0495643_0041047 3300046522 Bacteria 2524
451 Ga0495643_0046697 3300046522 Bacteria 2346
452 Ga0495643_0068118 3300046522 Bacteria 1873
453 Ga0495644_0013275 3300046523 Bacteria 3162
454 Ga0495644_0017742 3300046523 Bacteria 2719
455 Ga0495644_0024244 3300046523 Bacteria 2307
456 Ga0495644_0076928 3300046523 Bacteria 1257
457 Ga0495648_0001134 3300046524 Bacteria 26952
458 Ga0495648_0010375 3300046524 Bacteria 7098
459 Ga0495648_0010500 3300046524 Bacteria 7046
460 Ga0495648_0047372 3300046524 Bacteria 2657
461 Ga0495648_0059813 3300046524 Bacteria 2270
462 Ga0495648_0060234 3300046524 Bacteria 2260
463 Ga0495648_0097238 3300046524 Bacteria 1633
464 Ga0495648_0105742 3300046524 Bacteria 1542
465 Ga0495666_0007305 3300046526 Bacteria 5543
466 Ga0495666_0032996 3300046526 Bacteria 2531
467 Ga0495666_0104497 3300046526 Bacteria 1333
468 Ga0495642_0000932 3300046528 Bacteria 13693
469 Ga0495642_0015737 3300046528 Bacteria 2944
470 Ga0495642_0018110 3300046528 Bacteria 2754
471 Ga0495652_0072802 3300046529 Bacteria 2863
472 Ga0495654_0001112 3300046530 Bacteria 19430
473 Ga0495654_0004113 3300046530 Bacteria 8729
474 Ga0495654_0011415 3300046530 Bacteria 4808
475 Ga0495654_0022182 3300046530 Bacteria 3299
476 Ga0495654_0026029 3300046530 Bacteria 3011
477 Ga0495654_0027203 3300046530 Bacteria 2934
478 Ga0495654_0029783 3300046530 Bacteria 2782
479 Ga0495654_0033652 3300046530 Bacteria 2592
480 Ga0495654_0037546 3300046530 Bacteria 2427
481 Ga0495654_0042259 3300046530 Bacteria 2263
482 Ga0495654_0048286 3300046530 Bacteria 2089
483 Ga0495654_0073295 3300046530 Bacteria 1619
484 Ga0495654_0102525 3300046530 Bacteria 1315
485 Ga0495654_0103003 3300046530 Bacteria 1311
486 Ga0495654_0112520 3300046530 Bacteria 1240
487 Ga0495654_0112826 3300046530 Bacteria 1238
488 Ga0495587_0043389 3300046536 Bacteria 2678
489 Ga0495587_0085550 3300046536 Bacteria 1825
490 Ga0495609_0000247 3300046538 Bacteria 51172
491 Ga0495609_0027260 3300046538 Bacteria 2611
492 Ga0495609_0027652 3300046538 Bacteria 2590
493 Ga0495609_0029080 3300046538 Bacteria 2518
494 Ga0495609_0080381 3300046538 Bacteria 1425
495 Ga0495597_0000059 3300046542 Bacteria 92644
496 Ga0495597_0000692 3300046542 Bacteria 27121
497 Ga0495597_0023082 3300046542 Bacteria 2879
498 Ga0495597_0025688 3300046542 Bacteria 2710
499 Ga0495597_0028235 3300046542 Bacteria 2568
500 Ga0495597_0046468 3300046542 Bacteria 1923
501 Ga0495597_0069795 3300046542 Bacteria 1515
502 Ga0495622_0019702 3300046557 Bacteria 3141
503 Ga0495622_0023539 3300046557 Bacteria 2872
504 Ga0495622_0028385 3300046557 Bacteria 2613
505 Ga0495622_0038923 3300046557 Bacteria 2213
506 Ga0495633_0000468 3300046558 Bacteria 41323
507 Ga0495633_0022860 3300046558 Bacteria 3102
508 Ga0495656_0012220 3300046615 Bacteria 3163
509 Ga0495668_0117634 3300046616 Bacteria 1453
510 Ga0495634_0042607 3300046642 Bacteria 3078
511 Ga0495611_0001045 3300046648 Bacteria 14647
512 Ga0495611_0005778 3300046648 Bacteria 5279
513 Ga0495611_0024210 3300046648 Bacteria 2640
514 Ga0495611_0068989 3300046648 Bacteria 1614
515 Ga0495611_0111163 3300046648 Bacteria 1275
516 Ga0495625_0021451 3300046660 Bacteria 4975
517 Ga0495625_0111690 3300046660 Bacteria 1867
518 Ga0495625_0199241 3300046660 Bacteria 1322
519 Ga0495625_0202911 3300046660 Bacteria 1307
520 Ga0495635_0040084 3300046663 Bacteria 3237
521 Ga0495635_0053856 3300046663 Bacteria 2771
522 Ga0495659_0009531 3300046664 Bacteria 3101
523 Ga0495659_0082318 3300046664 Bacteria 1223
524 Ga0495661_0000078 3300046665 Bacteria 119097
525 Ga0495661_0000359 3300046665 Bacteria 49499
526 Ga0495661_0009655 3300046665 Bacteria 6610
527 Ga0495661_0036423 3300046665 Bacteria 3081
528 Ga0495661_0068298 3300046665 Bacteria 2085
529 Ga0495661_0073412 3300046665 Bacteria 1993
530 Ga0495661_0088550 3300046665 Bacteria 1767
531 Ga0495661_0089374 3300046665 Bacteria 1756
532 Ga0495661_0104859 3300046665 Bacteria 1584
533 Ga0495661_0133100 3300046665 Bacteria 1360
534 Ga0495661_0159655 3300046665 Bacteria 1211
535 Ga0495588_0084004 3300046674 Bacteria 1663
536 Ga0495588_0140771 3300046674 Bacteria 1274
537 Ga0495623_0041257 3300046679 Bacteria 2944
538 Ga0495623_0051655 3300046679 Bacteria 2599
539 Ga0495646_0033608 3300046680 Bacteria 3188
540 Ga0495669_0037429 3300046684 Bacteria 2147
541 Ga0495613_0059030 3300046689 Bacteria 2813
542 Ga0495613_0133482 3300046689 Bacteria 1777
543 Ga0495624_0050948 3300046690 Bacteria 2621
544 Ga0495670_0001176 3300046691 Bacteria 12714
545 Ga0495670_0022477 3300046691 Bacteria 3113
546 Ga0495670_0030209 3300046691 Bacteria 2691
547 Ga0495670_0039117 3300046691 Bacteria 2365
548 Ga0495670_0062205 3300046691 Bacteria 1878
549 Ga0495671_0002181 3300046692 Bacteria 12475
550 Ga0495671_0004069 3300046692 Bacteria 8827
551 Ga0495671_0009691 3300046692 Bacteria 5371
552 Ga0495671_0023614 3300046692 Bacteria 3211
553 Ga0495671_0025413 3300046692 Bacteria 3078
554 Ga0495671_0026951 3300046692 Bacteria 2972
555 Ga0495671_0032819 3300046692 Bacteria 2648
556 Ga0495671_0035802 3300046692 Bacteria 2519
557 Ga0495671_0040740 3300046692 Bacteria 2341
558 Ga0495671_0046838 3300046692 Bacteria 2161
559 Ga0495671_0050018 3300046692 Bacteria 2082
560 Ga0495671_0050589 3300046692 Bacteria 2068
561 Ga0495671_0060052 3300046692 Bacteria 1877
562 Ga0495649_0000610 3300046694 Bacteria 29797
563 Ga0495649_0008901 3300046694 Bacteria 6007
564 Ga0495649_0028085 3300046694 Bacteria 3118
565 Ga0495649_0031677 3300046694 Bacteria 2914
566 Ga0495649_0035392 3300046694 Bacteria 2746
567 Ga0495649_0036931 3300046694 Bacteria 2683
568 Ga0495649_0058033 3300046694 Bacteria 2086
569 Ga0495649_0078390 3300046694 Bacteria 1767
570 Ga0495649_0094930 3300046694 Bacteria 1587
571 Ga0495649_0106763 3300046694 Bacteria 1486
572 Ga0495649_0112709 3300046694 Bacteria 1441
573 Ga0495649_0140474 3300046694 Bacteria 1271
574 Ga0495589_0000534 3300046794 Bacteria 26598
575 Ga0495589_0003758 3300046794 Bacteria 8168
576 Ga0495589_0029162 3300046794 Bacteria 2781
577 Ga0495589_0031153 3300046794 Bacteria 2685
578 Ga0495589_0032200 3300046794 Bacteria 2636
579 Ga0495589_0037268 3300046794 Bacteria 2436
580 Ga0495589_0039260 3300046794 Bacteria 2366
581 Ga0495600_0090800 3300046809 Bacteria 1992
582 Ga0495660_0001075 3300046810 Bacteria 19588
583 Ga0495660_0001494 3300046810 Bacteria 15817
584 Ga0495660_0002049 3300046810 Bacteria 13106
585 Ga0495660_0034912 3300046810 Bacteria 2811
586 Ga0495660_0035999 3300046810 Bacteria 2762
587 Ga0495660_0049842 3300046810 Bacteria 2283
588 Ga0495660_0052180 3300046810 Bacteria 2222
589 Ga0495660_0069648 3300046810 Bacteria 1869
590 Ga0495660_0074217 3300046810 Bacteria 1797
591 Ga0495660_0075495 3300046810 Bacteria 1778
592 Ga0495660_0095243 3300046810 Bacteria 1540
593 Ga0495581_0081596 3300047315 Bacteria 1872
594 Ga0495581_0155488 3300047315 Bacteria 1336
595 Ga0495604_0055239 3300047317 Bacteria 3061
596 Ga0495636_0014202 3300047318 Bacteria 3166
597 Ga0495674_0072281 3300047319 Bacteria 2975
598 Ga0495672_0006371 3300047320 Bacteria 9167
599 Ga0495672_0042947 3300047320 Bacteria 2721
600 Ga0495672_0044092 3300047320 Bacteria 2677
601 Ga0495672_0044515 3300047320 Bacteria 2663
602 Ga0495672_0045485 3300047320 Bacteria 2626
603 Ga0495672_0049407 3300047320 Bacteria 2489
604 Ga0495672_0056659 3300047320 Bacteria 2278
605 Ga0495672_0060693 3300047320 Bacteria 2182
606 Ga0495672_0069889 3300047320 Bacteria 1992
607 Ga0495672_0120938 3300047320 Bacteria 1392
608 Ga0495680_0009294 3300047322 Bacteria 8855
609 Ga0495680_0055198 3300047322 Bacteria 3082
610 Ga0495680_0123274 3300047322 Bacteria 1911
611 Ga0495680_0180363 3300047322 Bacteria 1524
612 Ga0495683_0000409 3300047323 Bacteria 34478
613 Ga0495683_0023630 3300047323 Bacteria 3158
614 Ga0495683_0026477 3300047323 Bacteria 2967
615 Ga0495683_0028687 3300047323 Bacteria 2844
616 Ga0495683_0032346 3300047323 Bacteria 2664
617 Ga0495687_017772 3300047443 Bacteria 3532
618 Ga0495687_021761 3300047443 Bacteria 3092
619 Ga0495687_023299 3300047443 Bacteria 2958
620 Ga0495687_029792 3300047443 Bacteria 2520
621 Ga0495675_0066999 3300047444 Bacteria 2269
622 Ga0495677_0016142 3300047445 Bacteria 2709
623 Ga0495679_000417 3300047446 Bacteria 31474
624 Ga0495679_004078 3300047446 Bacteria 6846
625 Ga0495679_017603 3300047446 Bacteria 2555
626 Ga0495679_019895 3300047446 Bacteria 2348
627 Ga0495685_017632 3300047447 Bacteria 2446
628 Ga0495685_026843 3300047447 Bacteria 1981
629 Ga0495673_0007780 3300047469 Bacteria 6108
630 Ga0495673_0021249 3300047469 Bacteria 3210
631 Ga0495673_0022309 3300047469 Bacteria 3105
632 Ga0495673_0023833 3300047469 Bacteria 2968
633 Ga0495673_0025187 3300047469 Bacteria 2860
634 Ga0495673_0027187 3300047469 Bacteria 2725
635 Ga0495673_0038335 3300047469 Bacteria 2181
636 Ga0495673_0084558 3300047469 Bacteria 1307
637 Ga0495681_0006487 3300047470 Bacteria 7684
638 Ga0495681_0008990 3300047470 Bacteria 6199
639 Ga0495681_0028400 3300047470 Bacteria 2878
640 Ga0495681_0029334 3300047470 Bacteria 2816
641 Ga0495681_0029766 3300047470 Bacteria 2789
642 Ga0495681_0029932 3300047470 Bacteria 2780
643 Ga0495681_0029968 3300047470 Bacteria 2777
644 Ga0495681_0033212 3300047470 Bacteria 2588
645 Ga0495681_0033268 3300047470 Bacteria 2584
646 Ga0495681_0034761 3300047470 Bacteria 2508
647 Ga0495681_0037465 3300047470 Bacteria 2387
648 Ga0495681_0038664 3300047470 Bacteria 2336
649 Ga0495681_0039112 3300047470 Bacteria 2318
650 Ga0495681_0090593 3300047470 Bacteria 1351
651 Ga0495686_0035868 3300047472 Bacteria 3185
652 Ga0495686_0041293 3300047472 Bacteria 2937
653 Ga0495686_0045948 3300047472 Bacteria 2762
654 Ga0495686_0117995 3300047472 Bacteria 1584
655 Ga0495686_0189450 3300047472 Bacteria 1186
656 Ga0495593_0036920 3300047673 Bacteria 2646
657 Ga0495593_0067271 3300047673 Bacteria 1865
658 Ga0495602_0087996 3300048088 Bacteria 2586
659 Ga0495626_0004242 3300048091 Bacteria 8859
660 Ga0495626_0005262 3300048091 Bacteria 7647
661 Ga0495626_0023401 3300048091 Bacteria 3042
662 Ga0495626_0028155 3300048091 Bacteria 2726
663 Ga0495626_0028439 3300048091 Bacteria 2710
664 Ga0495626_0030485 3300048091 Bacteria 2601
665 Ga0495626_0045829 3300048091 Bacteria 2039
666 Ga0496102_0073025 3300048905 Bacteria 3153
667 Ga0496103_0037628 3300048906 Bacteria 2965
668 Ga0496110_0011753 3300048913 Bacteria 7184
669 Ga0496111_0130941 3300048914 Bacteria 1856
670 Ga0496114_0133724 3300048917 Bacteria 2143
671 Ga0496116_0000532 3300048919 Bacteria 51124
672 Ga0496116_0004803 3300048919 Bacteria 12755
673 Ga0496116_0008407 3300048919 Bacteria 8960
674 Ga0496116_0081774 3300048919 Bacteria 2001
675 Ga0496117_0009614 3300048920 Bacteria 8953
676 Ga0496117_0009811 3300048920 Bacteria 8823
677 Ga0496117_0154892 3300048920 Bacteria 1351
678 Ga0496118_0031718 3300048921 Bacteria 4373
679 Ga0496118_0068523 3300048921 Bacteria 2576
680 Ga0496118_0075693 3300048921 Bacteria 2399
681 Ga0496118_0079743 3300048921 Bacteria 2308
682 Ga0496120_0032535 3300048923 Bacteria 3143
683 Ga0496120_0039433 3300048923 Bacteria 2786
684 Ga0496121_0001218 3300048924 Bacteria 44832
685 Ga0496121_0092571 3300048924 Bacteria 2356
686 Ga0496121_0144818 3300048924 Bacteria 1757
687 Ga0496121_0301302 3300048924 Bacteria 1087
688 Ga0496122_0011822 3300048925 Bacteria 8777
689 Ga0496122_0029267 3300048925 Bacteria 4649
690 Ga0496122_0062670 3300048925 Bacteria 2720
691 Ga0496122_0066210 3300048925 Bacteria 2612
692 Ga0496122_0081146 3300048925 Bacteria 2259
693 Ga0496122_0164285 3300048925 Bacteria 1348
694 Ga0496123_0009410 3300048926 Bacteria 8801
695 Ga0496123_0076428 3300048926 Bacteria 2061
696 Ga0496123_0104869 3300048926 Bacteria 1633
697 Ga0496123_0161524 3300048926 Bacteria 1194
698 Ga0496123_0161780 3300048926 Bacteria 1192
699 Ga0496124_0000658 3300048927 Bacteria 56989
700 Ga0496124_0006635 3300048927 Bacteria 12557
701 Ga0496124_0015829 3300048927 Bacteria 7205
702 Ga0496124_0017179 3300048927 Bacteria 6833
703 Ga0496124_0062022 3300048927 Bacteria 3130
704 Ga0496124_0097717 3300048927 Bacteria 2384
705 Ga0496124_0173931 3300048927 Bacteria 1664
706 Ga0496124_0219866 3300048927 Bacteria 1429
707 Ga0496125_0011496 3300048928 Bacteria 8849
708 Ga0496125_0018304 3300048928 Bacteria 6656
709 Ga0496125_0018409 3300048928 Bacteria 6634
710 Ga0496125_0061391 3300048928 Bacteria 3014
711 Ga0496125_0064361 3300048928 Bacteria 2914
712 Ga0496125_0081711 3300048928 Bacteria 2467
713 Ga0496125_0134026 3300048928 Bacteria 1737
714 Ga0496125_0222808 3300048928 Bacteria 1213
715 Ga0496126_0037424 3300048929 Bacteria 4528
716 Ga0496126_0070023 3300048929 Bacteria 3126
717 Ga0496126_0113263 3300048929 Bacteria 2361
718 Ga0495678_000081 3300049459 Bacteria 118700
719 Ga0495678_020360 3300049459 Bacteria 2940
720 Ga0495678_025095 3300049459 Bacteria 2564
721 Ga0495678_032517 3300049459 Bacteria 2162
722 Ga0495678_033009 3300049459 Bacteria 2140
723 Ga0495678_038527 3300049459 Bacteria 1933
724 Ga0495678_042255 3300049459 Bacteria 1818
725 Ga0495678_064892 3300049459 Bacteria 1357
726 Ga0495682_0015572 3300049460 Bacteria 2880
727 Ga0495682_0016504 3300049460 Bacteria 2794
728 Ga0495682_0016685 3300049460 Bacteria 2778
729 Ga0495682_0033487 3300049460 Bacteria 1896
730 Ga0495682_0035541 3300049460 Bacteria 1835
731 Ga0501226_000009 3300049853 Bacteria 194138
732 Ga0500650_0000086 3300053098 Bacteria 26596
733 Ga0500572_006879 3300053111 Bacteria 2616
734 Ga0500573_0061631 3300053140 Bacteria 2148
735 Ga0500622_0003419 3300053156 Bacteria 10646
736 Ga0500634_0026560 3300053161 Bacteria 3153
737 Ga0500661_003227 3300055283 Bacteria 3071

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047470 Ga0495681_0029932 Ga0495681_0029932_333_1277 314
2 3300048924 Ga0496121_0301302 Ga0496121_0301302_21_1070 331
3 3300048913 Ga0496110_0011753 Ga0496110_0011753_5478_6701 335
4 3300048927 Ga0496124_0006635 Ga0496124_0006635_11095_12318 335
5 3300048928 Ga0496125_0081711 Ga0496125_0081711_157_1380 335
6 3300048929 Ga0496126_0037424 Ga0496126_0037424_3131_4354 335
7 3300053156 Ga0500622_0003419 Ga0500622_0003419_7322_8380 340
8 3300003771 Ga0055526_1019534 Ga0055526_10195342 346
9 3300025295 Ga0209564_1000005 Ga0209564_1000005814 346
10 3300002737 JGI25162J39368_1001980 JGI25162J39368_10019801 347
11 3300002771 JGI25163J39215_1001687 JGI25163J39215_10016871 347
12 3300002772 JGI25164J39214_1000968 JGI25164J39214_10009681 347
13 3300003214 JGI25165J46597_1000362 JGI25165J46597_100036252 347
14 3300009148 Ga0105243_10006610 Ga0105243_100066101 347
15 3300014497 Ga0182008_10000220 Ga0182008_100002201 347
16 3300025207 Ga0209760_100266 Ga0209760_10026614 347
17 3300025231 Ga0207427_100074 Ga0207427_100074120 347
18 3300025233 Ga0209437_100006 Ga0209437_100006121 347
19 3300025261 Ga0209233_1000105 Ga0209233_1000105102 347
20 3300025935 Ga0207709_10000821 Ga0207709_100008215 347
21 3300048919 Ga0496116_0000532 Ga0496116_0000532_49898_51031 347
22 3300048920 Ga0496117_0009614 Ga0496117_0009614_7728_8861 347
23 3300048921 Ga0496118_0031718 Ga0496118_0031718_3157_4290 347
24 3300048924 Ga0496121_0001218 Ga0496121_0001218_98_1231 347
25 3300048925 Ga0496122_0011822 Ga0496122_0011822_7551_8684 347
26 3300048926 Ga0496123_0009410 Ga0496123_0009410_81_1214 347
27 3300041405 Ga0439438_003561 Ga0439438_003561_254_1387 354
28 3300046474 Ga0495605_0119553 Ga0495605_0119553_11_1111 355
29 3300005344 Ga0070661_100001382 Ga0070661_10000138213 358
30 3300005564 Ga0070664_100005010 Ga0070664_10000501011 358
31 3300009036 Ga0105244_10001906 Ga0105244_1000190611 358
32 3300009176 Ga0105242_10002363 Ga0105242_1000236314 358
33 3300009545 Ga0105237_10001117 Ga0105237_1000111728 358
34 3300011119 Ga0105246_10042404 Ga0105246_100424043 358
35 3300013104 Ga0157370_10011567 Ga0157370_1001156710 358
36 3300013105 Ga0157369_10027324 Ga0157369_100273244 358
37 3300013308 Ga0157375_10128203 Ga0157375_101282034 358
38 3300025728 Ga0207655_1000654 Ga0207655_100065428 358
39 3300025914 Ga0207671_10000989 Ga0207671_1000098928 358
40 3300025920 Ga0207649_10000041 Ga0207649_1000004111 358
41 3300025945 Ga0207679_10000018 Ga0207679_1000001828 358
42 3300030733 Ga0314311_1116939 Ga0314311_11169393 358
43 3300031548 Ga0307408_100043312 Ga0307408_1000433124 358
44 3300031731 Ga0307405_10003193 Ga0307405_100031939 358
45 3300031824 Ga0307413_10205928 Ga0307413_102059281 358
46 3300031911 Ga0307412_10125213 Ga0307412_101252132 358
47 3300031995 Ga0307409_100359645 Ga0307409_1003596452 358
48 3300032002 Ga0307416_100121382 Ga0307416_1001213824 358
49 3300048928 Ga0496125_0061391 Ga0496125_0061391_1701_2834 358
50 3300005288 Ga0065714_10073020 Ga0065714_100730201 359
51 3300009148 Ga0105243_10067654 Ga0105243_100676543 359
52 3300013100 Ga0157373_10053495 Ga0157373_100534951 359
53 3300046453 Ga0495627_000169 Ga0495627_000169_1390_2553 359
54 3300046460 Ga0495638_0007628 Ga0495638_0007628_17_1159 359
55 3300046471 Ga0495650_0038777 Ga0495650_0038777_805_1968 359
56 3300046471 Ga0495650_0081331 Ga0495650_0081331_89_1231 359
57 3300046518 Ga0495631_0006409 Ga0495631_0006409_4719_5882 359
58 3300046530 Ga0495654_0011415 Ga0495654_0011415_248_1411 359
59 3300046692 Ga0495671_0004069 Ga0495671_0004069_3581_4744 359
60 3300047470 Ga0495681_0034761 Ga0495681_0034761_1255_2397 359
61 3300047320 Ga0495672_0069889 Ga0495672_0069889_438_1601 360
62 3300005290 Ga0065712_10076344 Ga0065712_100763442 362
63 3300009011 Ga0105251_10076599 Ga0105251_100765992 362
64 3300025735 Ga0207713_1003362 Ga0207713_10033624 362
65 3300028379 Ga0268266_10201429 Ga0268266_102014292 362
66 3300031731 Ga0307405_10031515 Ga0307405_100315154 362
67 iso_pu_bacteria 2823421272 2823423605 362
68 iso_pu_bacteria 2919501602 2919503452 362
69 iso_pu_bacteria 2926063275 2926065977 362
70 3300009092 Ga0105250_10030721 Ga0105250_100307211 363
71 3300048914 Ga0496111_0130941 Ga0496111_0130941_50_1165 363
72 3300013102 Ga0157371_10000539 Ga0157371_1000053948 364
73 3300013308 Ga0157375_10091637 Ga0157375_100916374 364
74 3300046455 Ga0495603_0098414 Ga0495603_0098414_44_1186 364
75 3300046457 Ga0495590_0016521 Ga0495590_0016521_1465_2607 364
76 3300046474 Ga0495605_0024557 Ga0495605_0024557_1906_3048 364
77 3300046512 Ga0495610_0034224 Ga0495610_0034224_1404_2546 364
78 3300046523 Ga0495644_0076928 Ga0495644_0076928_46_1188 364
79 3300046528 Ga0495642_0000932 Ga0495642_0000932_1485_2627 364
80 3300046530 Ga0495654_0073295 Ga0495654_0073295_61_1203 364
81 3300046616 Ga0495668_0117634 Ga0495668_0117634_90_1232 364
82 3300046674 Ga0495588_0140771 Ga0495588_0140771_56_1198 364
83 3300046684 Ga0495669_0037429 Ga0495669_0037429_71_1213 364
84 3300046694 Ga0495649_0036931 Ga0495649_0036931_1459_2601 364
85 3300046794 Ga0495589_0039260 Ga0495589_0039260_55_1197 364
86 3300047320 Ga0495672_0044515 Ga0495672_0044515_1421_2563 364
87 3300047469 Ga0495673_0023833 Ga0495673_0023833_1804_2946 364
88 iso_pu_bacteria 2738541276 2738715570 365
89 3300031901 Ga0307406_10034858 Ga0307406_100348581 366
90 3300032005 Ga0307411_10080812 Ga0307411_100808123 366
91 3300046692 Ga0495671_0002181 Ga0495671_0002181_7758_8870 366
92 3300046492 Ga0495585_0142083 Ga0495585_0142083_136_1239 367
93 3300046492 Ga0495585_0151536 Ga0495585_0151536_88_1191 367
94 3300003781 Ga0055536_1003164 Ga0055536_10031641 368
95 3300025292 Ga0209676_1000223 Ga0209676_100022355 368
96 3300030734 Ga0316179_1034474 Ga0316179_10344744 368
97 3300030735 Ga0316178_1126744 Ga0316178_112674429 368
98 3300032004 Ga0307414_10360013 Ga0307414_103600131 368
99 3300042016 Ga0439463_039712 Ga0439463_039712_12_1154 368
100 3300046459 Ga0495629_0056079 Ga0495629_0056079_71_1213 368
101 3300046463 Ga0495653_0054158 Ga0495653_0054158_95_1237 368
102 3300046473 Ga0495582_0025982 Ga0495582_0025982_2034_3176 368
103 3300046475 Ga0495639_0102826 Ga0495639_0102826_60_1202 368
104 3300046526 Ga0495666_0007305 Ga0495666_0007305_4330_5472 368
105 3300046536 Ga0495587_0043389 Ga0495587_0043389_1437_2579 368
106 3300046663 Ga0495635_0040084 Ga0495635_0040084_65_1207 368
107 3300046680 Ga0495646_0033608 Ga0495646_0033608_1948_3090 368
108 3300046689 Ga0495613_0059030 Ga0495613_0059030_1637_2779 368
109 3300047315 Ga0495581_0155488 Ga0495581_0155488_169_1311 368
110 3300047317 Ga0495604_0055239 Ga0495604_0055239_1860_3002 368
111 3300047322 Ga0495680_0009294 Ga0495680_0009294_7610_8752 368
112 3300005548 Ga0070665_100044913 Ga0070665_1000449132 369
113 3300006058 Ga0075432_10009655 Ga0075432_100096552 369
114 3300009011 Ga0105251_10007357 Ga0105251_100073579 369
115 3300027907 Ga0207428_10081090 Ga0207428_100810904 369
116 3300028379 Ga0268266_10067858 Ga0268266_100678583 369
117 3300046460 Ga0495638_0007670 Ga0495638_0007670_6490_7623 369
118 3300046519 Ga0495632_0032027 Ga0495632_0032027_1500_2633 369
119 3300046692 Ga0495671_0009691 Ga0495671_0009691_95_1228 369
120 3300047323 Ga0495683_0032346 Ga0495683_0032346_70_1203 369
121 3300047469 Ga0495673_0025187 Ga0495673_0025187_1655_2788 369
122 3300048927 Ga0496124_0017179 Ga0496124_0017179_5598_6731 369
123 3300053098 Ga0500650_0000086 Ga0500650_0000086_6064_7245 369
124 3300013105 Ga0157369_10128942 Ga0157369_101289421 370
125 3300046458 Ga0495591_015710 Ga0495591_015710_1440_2582 370
126 iso_pu_bacteria 2606217733 2608381904 370
127 iso_pu_bacteria 2738543020 2739285316 370
128 iso_pu_bacteria 2738543021 2739290630 370
129 iso_pu_bacteria 3007252601 3007253080 370
130 iso_pu_bacteria 3007315729 3007318243 370
131 3300041405 Ga0439438_025060 Ga0439438_025060_396_1538 371
132 3300041405 Ga0439438_036182 Ga0439438_036182_80_1222 371
133 3300041411 Ga0439466_0002783 Ga0439466_0002783_5627_6769 371
134 3300041411 Ga0439466_0033357 Ga0439466_0033357_48_1190 371
135 3300042010 Ga0439452_001600 Ga0439452_001600_66_1247 371
136 3300042010 Ga0439452_002058 Ga0439452_002058_6464_7606 371
137 3300042013 Ga0439456_004996 Ga0439456_004996_58_1239 371
138 3300042137 Ga0450902_003406 Ga0450902_003406_1146_2288 371
139 3300046460 Ga0495638_0099319 Ga0495638_0099319_539_1681 371
140 3300046501 Ga0495607_0033580 Ga0495607_0033580_1951_3093 371
141 3300046519 Ga0495632_0050009 Ga0495632_0050009_64_1206 371
142 3300046522 Ga0495643_0009520 Ga0495643_0009520_100_1242 371
143 3300046542 Ga0495597_0023082 Ga0495597_0023082_54_1196 371
144 3300046665 Ga0495661_0159655 Ga0495661_0159655_30_1172 371
145 3300046810 Ga0495660_0075495 Ga0495660_0075495_603_1745 371
146 3300046810 Ga0495660_0095243 Ga0495660_0095243_340_1482 371
147 3300047470 Ga0495681_0033212 Ga0495681_0033212_1426_2568 371
148 3300047472 Ga0495686_0189450 Ga0495686_0189450_33_1175 371
149 3300049459 Ga0495678_020360 Ga0495678_020360_1752_2894 371
150 iso_pu_bacteria 2811994881 2812366277 371
151 iso_pu_bacteria 2923519811 2923520301 371
152 iso_pu_bacteria 8011350971 8011351807 371
153 3300003791 Ga0055530_10037562 Ga0055530_100375621 372
154 3300006058 Ga0075432_10064265 Ga0075432_100642651 372
155 3300009148 Ga0105243_10186928 Ga0105243_101869282 372
156 3300014497 Ga0182008_10031546 Ga0182008_100315462 372
157 3300025292 Ga0209676_1015874 Ga0209676_10158744 372
158 3300025298 Ga0209050_1004712 Ga0209050_10047121 372
159 3300025303 Ga0209051_1021985 Ga0209051_10219851 372
160 3300025728 Ga0207655_1005310 Ga0207655_10053105 372
161 3300025728 Ga0207655_1065783 Ga0207655_10657831 372
162 3300025735 Ga0207713_1049875 Ga0207713_10498752 372
163 3300025935 Ga0207709_10067235 Ga0207709_100672353 372
164 3300041411 Ga0439466_0044018 Ga0439466_0044018_293_1435 372
165 3300042010 Ga0439452_008170 Ga0439452_008170_82_1224 372
166 3300042013 Ga0439456_004928 Ga0439456_004928_1499_2641 372
167 3300042142 Ga0450905_006150 Ga0450905_006150_417_1559 372
168 3300042185 Ga0450909_012466 Ga0450909_012466_38_1180 372
169 3300042461 Ga0439460_0010970 Ga0439460_0010970_1150_2292 372
170 3300046452 Ga0495617_012372 Ga0495617_012372_68_1210 372
171 3300046453 Ga0495627_032110 Ga0495627_032110_450_1592 372
172 3300046457 Ga0495590_0013743 Ga0495590_0013743_1765_2907 372
173 3300046458 Ga0495591_003049 Ga0495591_003049_7655_8797 372
174 3300046458 Ga0495591_021436 Ga0495591_021436_876_2018 372
175 3300046460 Ga0495638_0062437 Ga0495638_0062437_91_1233 372
176 3300046460 Ga0495638_0071359 Ga0495638_0071359_916_2058 372
177 3300046463 Ga0495653_0071195 Ga0495653_0071195_1434_2576 372
178 3300046471 Ga0495650_0020793 Ga0495650_0020793_90_1232 372
179 3300046491 Ga0495584_0048441 Ga0495584_0048441_46_1188 372
180 3300046491 Ga0495584_0053964 Ga0495584_0053964_63_1205 372
181 3300046500 Ga0495596_0002947 Ga0495596_0002947_101_1243 372
182 3300046501 Ga0495607_0015142 Ga0495607_0015142_93_1235 372
183 3300046501 Ga0495607_0044154 Ga0495607_0044154_1436_2578 372
184 3300046501 Ga0495607_0047676 Ga0495607_0047676_25_1167 372
185 3300046501 Ga0495607_0063758 Ga0495607_0063758_911_2053 372
186 3300046506 Ga0495583_0058271 Ga0495583_0058271_66_1208 372
187 3300046507 Ga0495606_0012586 Ga0495606_0012586_5561_6703 372
188 3300046507 Ga0495606_0073204 Ga0495606_0073204_84_1226 372
189 3300046512 Ga0495610_0028924 Ga0495610_0028924_1718_2860 372
190 3300046512 Ga0495610_0035818 Ga0495610_0035818_42_1184 372
191 3300046513 Ga0495616_0008007 Ga0495616_0008007_4844_5986 372
192 3300046513 Ga0495616_0036932 Ga0495616_0036932_1323_2465 372
193 3300046513 Ga0495616_0047867 Ga0495616_0047867_943_2085 372
194 3300046515 Ga0495620_0060996 Ga0495620_0060996_67_1209 372
195 3300046518 Ga0495631_0026689 Ga0495631_0026689_1174_2316 372
196 3300046519 Ga0495632_0006673 Ga0495632_0006673_5562_6704 372
197 3300046519 Ga0495632_0034011 Ga0495632_0034011_80_1222 372
198 3300046520 Ga0495637_0012771 Ga0495637_0012771_2254_3396 372
199 3300046520 Ga0495637_0085121 Ga0495637_0085121_45_1187 372
200 3300046523 Ga0495644_0017742 Ga0495644_0017742_86_1228 372
201 3300046523 Ga0495644_0024244 Ga0495644_0024244_91_1233 372
202 3300046530 Ga0495654_0026029 Ga0495654_0026029_1814_2956 372
203 3300046530 Ga0495654_0042259 Ga0495654_0042259_54_1196 372
204 3300046530 Ga0495654_0048286 Ga0495654_0048286_876_2018 372
205 3300046530 Ga0495654_0112826 Ga0495654_0112826_52_1194 372
206 3300046648 Ga0495611_0068989 Ga0495611_0068989_452_1594 372
207 3300046665 Ga0495661_0104859 Ga0495661_0104859_67_1209 372
208 3300046691 Ga0495670_0039117 Ga0495670_0039117_64_1206 372
209 3300046692 Ga0495671_0040740 Ga0495671_0040740_101_1243 372
210 3300046692 Ga0495671_0046838 Ga0495671_0046838_925_2067 372
211 3300046694 Ga0495649_0031677 Ga0495649_0031677_1701_2843 372
212 3300046694 Ga0495649_0094930 Ga0495649_0094930_84_1226 372
213 3300046810 Ga0495660_0069648 Ga0495660_0069648_56_1198 372
214 3300047320 Ga0495672_0060693 Ga0495672_0060693_56_1198 372
215 3300047469 Ga0495673_0007780 Ga0495673_0007780_4882_6024 372
216 3300047469 Ga0495673_0022309 Ga0495673_0022309_1916_3058 372
217 3300047469 Ga0495673_0084558 Ga0495673_0084558_96_1238 372
218 3300047470 Ga0495681_0006487 Ga0495681_0006487_6442_7584 372
219 3300047470 Ga0495681_0038664 Ga0495681_0038664_1153_2295 372
220 3300047470 Ga0495681_0039112 Ga0495681_0039112_64_1206 372
221 3300047472 Ga0495686_0035868 Ga0495686_0035868_85_1227 372
222 3300048091 Ga0495626_0004242 Ga0495626_0004242_101_1243 372
223 3300048091 Ga0495626_0005262 Ga0495626_0005262_84_1226 372
224 3300048091 Ga0495626_0023401 Ga0495626_0023401_73_1215 372
225 3300048921 Ga0496118_0079743 Ga0496118_0079743_30_1172 372
226 3300049459 Ga0495678_033009 Ga0495678_033009_64_1206 372
227 3300049459 Ga0495678_038527 Ga0495678_038527_61_1203 372
228 iso_pu_bacteria 2600254954 2600444739 372
229 iso_pu_bacteria 2600255389 2602011968 372
230 iso_pu_bacteria 8034962539 8034964730 372
231 3300046463 Ga0495653_0013920 Ga0495653_0013920_3997_5139 373
232 3300046690 Ga0495624_0050948 Ga0495624_0050948_1419_2561 373
233 3300047320 Ga0495672_0045485 Ga0495672_0045485_1424_2566 373
234 3300047322 Ga0495680_0180363 Ga0495680_0180363_318_1460 373
235 3300047673 Ga0495593_0036920 Ga0495593_0036920_1469_2611 373
236 3300048088 Ga0495602_0087996 Ga0495602_0087996_40_1182 373
237 iso_pu_bacteria 2511231006 2511268421 373
238 iso_pu_bacteria 2511231024 2511374427 373
239 iso_pu_bacteria 2511231156 2511823683 373
240 iso_pu_bacteria 2512047018 2512324012 373
241 iso_pu_bacteria 2554235341 2555671275 373
242 iso_pu_bacteria 2582580891 2583793684 373
243 iso_pu_bacteria 2597489887 2597859344 373
244 iso_pu_bacteria 2597489889 2597868791 373
245 iso_pu_bacteria 2599185155 2599327040 373
246 iso_pu_bacteria 2599185160 2599354566 373
247 iso_pu_bacteria 2599185161 2599359721 373
248 iso_pu_bacteria 2599185162 2599366043 373
249 iso_pu_bacteria 2599185163 2599372833 373
250 iso_pu_bacteria 2599185164 2599379673 373
251 iso_pu_bacteria 2599185165 2599385348 373
252 iso_pu_bacteria 2599185166 2599391692 373
253 iso_pu_bacteria 2599185167 2599401578 373
254 iso_pu_bacteria 2599185168 2599403458 373
255 iso_pu_bacteria 2599185179 2599451881 373
256 iso_pu_bacteria 2599185181 2599461400 373
257 iso_pu_bacteria 2599185182 2599469943 373
258 iso_pu_bacteria 2599185185 2599482174 373
259 iso_pu_bacteria 2599185186 2599490419 373
260 iso_pu_bacteria 2599185189 2599509648 373
261 iso_pu_bacteria 2599185190 2599514822 373
262 iso_pu_bacteria 2599185191 2599520920 373
263 iso_pu_bacteria 2599185212 2599611629 373
264 iso_pu_bacteria 2599185248 2599770276 373
265 iso_pu_bacteria 2599185257 2599804108 373
266 iso_pu_bacteria 2599185288 2599882167 373
267 iso_pu_bacteria 2599185289 2599887515 373
268 iso_pu_bacteria 2599185290 2599894381 373
269 iso_pu_bacteria 2599185291 2599900006 373
270 iso_pu_bacteria 2599185302 2599941789 373
271 iso_pu_bacteria 2599185303 2599951589 373
272 iso_pu_bacteria 2599185304 2599952691 373
273 iso_pu_bacteria 2599185305 2599960582 373
274 iso_pu_bacteria 2599185306 2599964876 373
275 iso_pu_bacteria 2599185308 2599976011 373
276 iso_pu_bacteria 2599185309 2599981958 373
277 iso_pu_bacteria 2599185310 2599987867 373
278 iso_pu_bacteria 2599185311 2599995570 373
279 iso_pu_bacteria 2599185312 2599998241 373
280 iso_pu_bacteria 2599185313 2600005405 373
281 iso_pu_bacteria 2599185314 2600010108 373
282 iso_pu_bacteria 2599185315 2600017377 373
283 iso_pu_bacteria 2599185316 2600022600 373
284 iso_pu_bacteria 2599185317 2600027620 373
285 iso_pu_bacteria 2599185318 2600034404 373
286 iso_pu_bacteria 2599185319 2600039900 373
287 iso_pu_bacteria 2599185320 2600046197 373
288 iso_pu_bacteria 2599185321 2600052200 373
289 iso_pu_bacteria 2599185322 2600057577 373
290 iso_pu_bacteria 2599185323 2600068811 373
291 iso_pu_bacteria 2599185324 2600072315 373
292 iso_pu_bacteria 2599185325 2600075875 373
293 iso_pu_bacteria 2599185356 2600214018 373
294 iso_pu_bacteria 2600254930 2600356671 373
295 iso_pu_bacteria 2600254931 2600364252 373
296 iso_pu_bacteria 2600255296 2601694292 373
297 iso_pu_bacteria 2600255313 2601774184 373
298 iso_pu_bacteria 2619619299 2621300930 373
299 iso_pu_bacteria 2643221571 2643871665 373
300 iso_pu_bacteria 2643221650 2644284861 373
301 iso_pu_bacteria 2643221713 2644623542 373
302 iso_pu_bacteria 2651869719 2652543838 373
303 iso_pu_bacteria 2667528170 2671090174 373
304 iso_pu_bacteria 2667528171 2671097147 373
305 iso_pu_bacteria 2667528176 2671126010 373
306 iso_pu_bacteria 2671180172 2671770324 373
307 iso_pu_bacteria 2675903420 2677896836 373
308 iso_pu_bacteria 2675903515 2678262615 373
309 iso_pu_bacteria 2721755607 2723247815 373
310 iso_pu_bacteria 2738541265 2738670445 373
311 iso_pu_bacteria 2738541271 2738689061 373
312 iso_pu_bacteria 2738541282 2738748838 373
313 iso_pu_bacteria 2738541294 2738810820 373
314 iso_pu_bacteria 2738541303 2738857880 373
315 iso_pu_bacteria 2738541309 2738898180 373
316 iso_pu_bacteria 2738543016 2739264448 373
317 iso_pu_bacteria 2740892503 2743738876 373
318 iso_pu_bacteria 2744054620 2745008955 373
319 iso_pu_bacteria 2765235841 2765585329 373
320 iso_pu_bacteria 2791355520 2794596419 373
321 iso_pu_bacteria 2808606373 2808907659 373
322 iso_pu_bacteria 2808606379 2808943382 373
323 iso_pu_bacteria 2808606385 2808979466 373
324 iso_pu_bacteria 2808606388 2808995390 373
325 iso_pu_bacteria 2816332298 2817489769 373
326 iso_pu_bacteria 2818991464 2819702244 373
327 iso_pu_bacteria 2825651385 2825653020 373
328 iso_pu_bacteria 2826581358 2826585903 373
329 iso_pu_bacteria 2834028612 2834029646 373
330 iso_pu_bacteria 2842815866 2842818936 373
331 iso_pu_bacteria 2842826826 2842831990 373
332 iso_pu_bacteria 2842837860 2842841574 373
333 iso_pu_bacteria 2842849001 2842853907 373
334 iso_pu_bacteria 2842854478 2842854669 373
335 iso_pu_bacteria 2844665904 2844671799 373
336 iso_pu_bacteria 2852612431 2852618473 373
337 iso_pu_bacteria 2852667396 2852673391 373
338 iso_pu_bacteria 2860867994 2860869640 373
339 iso_pu_bacteria 2908446538 2908448561 373
340 iso_pu_bacteria 2913036834 2913038594 373
341 iso_pu_bacteria 2917070673 2917075136 373
342 iso_pu_bacteria 2919481497 2919481869 373
343 iso_pu_bacteria 2923153595 2923157949 373
344 iso_pu_bacteria 2923586266 2923587294 373
345 iso_pu_bacteria 2929144301 2929146046 373
346 iso_pu_bacteria 2929189879 2929191616 373
347 iso_pu_bacteria 2931369376 2931370616 373
348 iso_pu_bacteria 2931390751 2931392713 373
349 iso_pu_bacteria 2935353572 2935356124 373
350 iso_pu_bacteria 2945928738 2945928952 373
351 iso_pu_bacteria 2945961074 2945962251 373
352 iso_pu_bacteria 2946006987 2946011175 373
353 iso_pu_bacteria 2946027586 2946029898 373
354 iso_pu_bacteria 2947233263 2947236469 373
355 iso_pu_bacteria 2984286254 2984288224 373
356 iso_pu_bacteria 3007395558 3007397258 373
357 iso_pu_bacteria 3007419365 3007424285 373
358 iso_pu_bacteria 637000220 637321602 373
359 iso_pu_bacteria 8019769354 8019775173 373
360 iso_pu_bacteria 8054285046 8054288270 373
361 iso_pu_bacteria 8054347763 8054352078 373
362 iso_pu_bacteria 8054503363 8054505217 373
363 iso_pu_bacteria 8055817908 8055819757 373
364 iso_pu_bacteria 8055878733 8055878809 373
365 iso_pu_bacteria 8056115690 8056117774 373
366 iso_pu_bacteria 8056120720 8056124551 373
367 iso_pu_bacteria 8056131705 8056133543 373
368 iso_pu_bacteria 8056143049 8056147245 373
369 iso_pu_bacteria 8056148874 8056150450 373
370 iso_pu_bacteria 8056161164 8056164966 373
371 iso_pu_bacteria 8057798959 8057804084 373
372 3300027312 Ga0209371_1000412 Ga0209371_100041237 374
373 3300030500 Ga0268256_1000486 Ga0268256_100048629 374
374 3300042006 Ga0439432_032243 Ga0439432_032243_475_1623 374
375 3300042115 Ga0450911_003808 Ga0450911_003808_71_1213 374
376 3300046522 Ga0495643_0000291 Ga0495643_0000291_43909_45045 374
377 3300048925 Ga0496122_0081146 Ga0496122_0081146_805_1929 374
378 3300046452 Ga0495617_011394 Ga0495617_011394_103_1260 375
379 3300046457 Ga0495590_0021318 Ga0495590_0021318_85_1242 375
380 3300046471 Ga0495650_0025175 Ga0495650_0025175_77_1234 375
381 3300046474 Ga0495605_0001002 Ga0495605_0001002_10004_11161 375
382 3300046501 Ga0495607_0015749 Ga0495607_0015749_3298_4455 375
383 3300046513 Ga0495616_0002292 Ga0495616_0002292_4694_5851 375
384 3300046519 Ga0495632_0030378 Ga0495632_0030378_1540_2697 375
385 3300046522 Ga0495643_0046697 Ga0495643_0046697_74_1231 375
386 3300046522 Ga0495643_0068118 Ga0495643_0068118_300_1427 375
387 3300046528 Ga0495642_0018110 Ga0495642_0018110_105_1262 375
388 3300046530 Ga0495654_0027203 Ga0495654_0027203_100_1257 375
389 3300046538 Ga0495609_0029080 Ga0495609_0029080_74_1231 375
390 3300046542 Ga0495597_0069795 Ga0495597_0069795_100_1257 375
391 3300046648 Ga0495611_0024210 Ga0495611_0024210_1421_2578 375
392 3300046694 Ga0495649_0008901 Ga0495649_0008901_4795_5952 375
393 3300046794 Ga0495589_0003758 Ga0495589_0003758_6756_7913 375
394 3300047318 Ga0495636_0014202 Ga0495636_0014202_1919_3076 375
395 3300047320 Ga0495672_0006371 Ga0495672_0006371_7955_9112 375
396 3300047443 Ga0495687_017772 Ga0495687_017772_2339_3496 375
397 3300047447 Ga0495685_017632 Ga0495685_017632_1226_2383 375
398 3300047472 Ga0495686_0041293 Ga0495686_0041293_1701_2843 375
399 3300048919 Ga0496116_0004803 Ga0496116_0004803_9850_10992 375
400 3300048927 Ga0496124_0000658 Ga0496124_0000658_42814_43959 375
401 3300027312 Ga0209371_1000237 Ga0209371_100023730 376
402 3300030500 Ga0268256_1000485 Ga0268256_100048513 376
403 3300031548 Ga0307408_100000004 Ga0307408_100000004345 376
404 iso_pu_bacteria 2511231007 2511273067 376
405 iso_pu_bacteria 2511231010 2511290570 376
406 iso_pu_bacteria 2511231011 2511295948 376
407 iso_pu_bacteria 2511231012 2511301104 376
408 iso_pu_bacteria 2511231014 2511312287 376
409 iso_pu_bacteria 2511231020 2511349822 376
410 iso_pu_bacteria 2511231021 2511355264 376
411 iso_pu_bacteria 2511231031 2511410847 376
412 iso_pu_bacteria 2600255318 2601796260 376
413 iso_pu_bacteria 2603880185 2606073409 376
414 iso_pu_bacteria 2603880199 2606126945 376
415 iso_pu_bacteria 2623620443 2624481909 376
416 iso_pu_bacteria 2623620446 2624491005 376
417 iso_pu_bacteria 2643221565 2643845611 376
418 iso_pu_bacteria 2643221589 2643956488 376
419 iso_pu_bacteria 2643221602 2644025470 376
420 iso_pu_bacteria 2643221633 2644185491 376
421 iso_pu_bacteria 2713897148 2715751212 376
422 iso_pu_bacteria 2713897149 2715758212 376
423 iso_pu_bacteria 2718217725 2718635160 376
424 iso_pu_bacteria 2738543004 2739201948 376
425 iso_pu_bacteria 2738543015 2739259249 376
426 iso_pu_bacteria 2738543025 2739314079 376
427 iso_pu_bacteria 2773857673 2774132819 376
428 iso_pu_bacteria 2818991456 2819655653 376
429 iso_pu_bacteria 2842832357 2842836504 376
430 iso_pu_bacteria 2842843487 2842844617 376
431 iso_pu_bacteria 2878029506 2878033893 376
432 iso_pu_bacteria 2880230671 2880234518 376
433 iso_pu_bacteria 2904518522 2904521341 376
434 iso_pu_bacteria 2904550169 2904555123 376
435 iso_pu_bacteria 2919063839 2919068879 376
436 iso_pu_bacteria 2919385768 2919387986 376
437 iso_pu_bacteria 2919487758 2919489832 376
438 iso_pu_bacteria 2919697872 2919702020 376
439 iso_pu_bacteria 2939636861 2939637634 376
440 iso_pu_bacteria 2969304461 2969308668 376
441 iso_pu_bacteria 2974289157 2974289958 376
442 iso_pu_bacteria 2998139840 2998143973 376
443 iso_pu_bacteria 3007614139 3007616879 376
444 iso_pu_bacteria 3007718800 3007718899 376
445 iso_pu_bacteria 3007855910 3007857879 376
446 iso_pu_bacteria 3007861166 3007865403 376
447 iso_pu_bacteria 8019775933 8019780976 376
448 iso_pu_bacteria 8029995093 8029996904 376
449 iso_pu_bacteria 8056125926 8056127585 376
450 iso_pu_bacteria 8056155041 8056157353 376
451 iso_pu_bacteria 8056166840 8056167302 376
452 iso_pu_bacteria 8056172158 8056173287 376
453 2162886007 SwRhRL2b_contig_2223659 SwRhRL2b_0170.00007830 377
454 3300003752 Ga0055539_1000134 Ga0055539_100013455 377
455 3300003756 Ga0055533_1000138 Ga0055533_100013827 377
456 3300003758 Ga0055532_1000142 Ga0055532_100014255 377
457 3300003759 Ga0055525_1000183 Ga0055525_100018355 377
458 3300003761 Ga0055535_1005240 Ga0055535_10052404 377
459 3300003781 Ga0055536_1011959 Ga0055536_10119591 377
460 3300003791 Ga0055530_10011088 Ga0055530_100110884 377
461 3300003792 Ga0055540_1009780 Ga0055540_10097801 377
462 3300003841 Ga0055541_1000089 Ga0055541_100008955 377
463 3300005288 Ga0065714_10016937 Ga0065714_100169371 377
464 3300005288 Ga0065714_10065661 Ga0065714_1006566111 377
465 3300005288 Ga0065714_10082358 Ga0065714_100823583 377
466 3300005288 Ga0065714_10099572 Ga0065714_100995722 377
467 3300005289 Ga0065704_10073943 Ga0065704_100739434 377
468 3300005290 Ga0065712_10068223 Ga0065712_100682235 377
469 3300005331 Ga0070670_100061378 Ga0070670_1000613781 377
470 3300005353 Ga0070669_100003585 Ga0070669_1000035854 377
471 3300005457 Ga0070662_100004011 Ga0070662_10000401111 377
472 3300005834 Ga0068851_10000050 Ga0068851_100000501 377
473 3300006946 Ga0079104_1000346 Ga0079104_100034657 377
474 3300009011 Ga0105251_10021500 Ga0105251_100215002 377
475 3300009011 Ga0105251_10035119 Ga0105251_100351194 377
476 3300009036 Ga0105244_10001004 Ga0105244_1000100412 377
477 3300009036 Ga0105244_10003260 Ga0105244_1000326011 377
478 3300009177 Ga0105248_10071057 Ga0105248_100710573 377
479 3300011119 Ga0105246_10000955 Ga0105246_1000095512 377
480 3300013100 Ga0157373_10056628 Ga0157373_100566281 377
481 3300013104 Ga0157370_10372198 Ga0157370_103721981 377
482 3300013308 Ga0157375_10157671 Ga0157375_101576714 377
483 3300017792 Ga0163161_10053175 Ga0163161_100531754 377
484 3300025206 Ga0209435_101864 Ga0209435_1018641 377
485 3300025224 Ga0209784_100040 Ga0209784_100040202 377
486 3300025225 Ga0209566_100051 Ga0209566_100051202 377
487 3300025226 Ga0209674_100072 Ga0209674_100072202 377
488 3300025229 Ga0209147_100067 Ga0209147_100067202 377
489 3300025230 Ga0209563_100073 Ga0209563_100073202 377
490 3300025242 Ga0209258_100585 Ga0209258_10058517 377
491 3300025246 Ga0209646_1000325 Ga0209646_100032527 377
492 3300025253 Ga0209677_100121 Ga0209677_10012155 377
493 3300025256 Ga0209759_1013808 Ga0209759_10138082 377
494 3300025292 Ga0209676_1000006 Ga0209676_1000006100 377
495 3300025298 Ga0209050_1000214 Ga0209050_1000214100 377
496 3300025303 Ga0209051_1000163 Ga0209051_10001631 377
497 3300025321 Ga0207656_10000683 Ga0207656_100006832 377
498 3300025711 Ga0207696_1000171 Ga0207696_100017182 377
499 3300025728 Ga0207655_1002485 Ga0207655_10024858 377
500 3300025728 Ga0207655_1002922 Ga0207655_10029223 377
501 3300025728 Ga0207655_1003053 Ga0207655_10030534 377
502 3300025735 Ga0207713_1002411 Ga0207713_100241113 377
503 3300025735 Ga0207713_1018540 Ga0207713_10185405 377
504 3300025923 Ga0207681_10002768 Ga0207681_100027684 377
505 3300025925 Ga0207650_10000174 Ga0207650_1000017476 377
506 3300025925 Ga0207650_10001409 Ga0207650_100014099 377
507 3300025933 Ga0207706_10002445 Ga0207706_1000244517 377
508 3300027111 Ga0209281_1000018 Ga0209281_1000018339 377
509 3300031548 Ga0307408_100057473 Ga0307408_1000574731 377
510 3300031911 Ga0307412_10033335 Ga0307412_100333351 377
511 3300041405 Ga0439438_009727 Ga0439438_009727_36_1169 377
512 3300041407 Ga0439447_010590 Ga0439447_010590_1468_2625 377
513 3300041407 Ga0439447_016024 Ga0439447_016024_96_1253 377
514 3300041411 Ga0439466_0008472 Ga0439466_0008472_792_1925 377
515 3300041411 Ga0439466_0008509 Ga0439466_0008509_1430_2563 377
516 3300041411 Ga0439466_0028294 Ga0439466_0028294_765_1898 377
517 3300041411 Ga0439466_0030242 Ga0439466_0030242_120_1277 377
518 3300041997 Ga0439431_0006811 Ga0439431_0006811_32_1165 377
519 3300042006 Ga0439432_017486 Ga0439432_017486_130_1287 377
520 3300042010 Ga0439452_021412 Ga0439452_021412_219_1352 377
521 3300042013 Ga0439456_002417 Ga0439456_002417_120_1277 377
522 3300042115 Ga0450911_000111 Ga0450911_000111_4765_5910 377
523 3300042127 Ga0450890_007074 Ga0450890_007074_85_1242 377
524 3300042138 Ga0450903_013028 Ga0450903_013028_66_1223 377
525 3300042139 Ga0450904_000019 Ga0450904_000019_5729_6874 377
526 3300042146 Ga0450907_002272 Ga0450907_002272_54_1211 377
527 3300042146 Ga0450907_011390 Ga0450907_011390_88_1245 377
528 3300042156 Ga0439446_0006966 Ga0439446_0006966_377_1522 377
529 3300042184 Ga0450908_004883 Ga0450908_004883_1294_2451 377
530 3300042185 Ga0450909_000126 Ga0450909_000126_6550_7707 377
531 3300042435 Ga0439434_0024725 Ga0439434_0024725_591_1748 377
532 3300042533 Ga0450901_000952 Ga0450901_000952_2065_3291 377
533 3300045049 Ga0466959_0002824 Ga0466959_0002824_7672_8835 377
534 3300046453 Ga0495627_000152 Ga0495627_000152_21538_22683 377
535 3300046453 Ga0495627_012091 Ga0495627_012091_96_1229 377
536 3300046458 Ga0495591_013547 Ga0495591_013547_1779_2912 377
537 3300046471 Ga0495650_0003022 Ga0495650_0003022_561_1694 377
538 3300046474 Ga0495605_0000088 Ga0495605_0000088_26079_27212 377
539 3300046474 Ga0495605_0066926 Ga0495605_0066926_103_1248 377
540 3300046499 Ga0495594_0000262 Ga0495594_0000262_24168_25301 377
541 3300046501 Ga0495607_0000186 Ga0495607_0000186_21604_22749 377
542 3300046501 Ga0495607_0000827 Ga0495607_0000827_6464_7609 377
543 3300046501 Ga0495607_0089208 Ga0495607_0089208_524_1657 377
544 3300046506 Ga0495583_0000135 Ga0495583_0000135_26046_27179 377
545 3300046506 Ga0495583_0001024 Ga0495583_0001024_20857_21990 377
546 3300046506 Ga0495583_0002277 Ga0495583_0002277_15589_16722 377
547 3300046506 Ga0495583_0028151 Ga0495583_0028151_1581_2714 377
548 3300046507 Ga0495606_0048759 Ga0495606_0048759_78_1211 377
549 3300046512 Ga0495610_0038040 Ga0495610_0038040_1239_2372 377
550 3300046515 Ga0495620_0000034 Ga0495620_0000034_90844_91977 377
551 3300046515 Ga0495620_0020775 Ga0495620_0020775_2031_3164 377
552 3300046519 Ga0495632_0000496 Ga0495632_0000496_5675_6808 377
553 3300046519 Ga0495632_0035114 Ga0495632_0035114_23_1156 377
554 3300046520 Ga0495637_0002688 Ga0495637_0002688_51_1184 377
555 3300046520 Ga0495637_0024465 Ga0495637_0024465_1464_2621 377
556 3300046524 Ga0495648_0001134 Ga0495648_0001134_40_1173 377
557 3300046524 Ga0495648_0060234 Ga0495648_0060234_1015_2172 377
558 3300046530 Ga0495654_0001112 Ga0495654_0001112_13458_14591 377
559 3300046530 Ga0495654_0004113 Ga0495654_0004113_70_1203 377
560 3300046530 Ga0495654_0103003 Ga0495654_0103003_136_1269 377
561 3300046538 Ga0495609_0000247 Ga0495609_0000247_23986_25119 377
562 3300046542 Ga0495597_0000059 Ga0495597_0000059_81320_82465 377
563 3300046542 Ga0495597_0000692 Ga0495597_0000692_301_1434 377
564 3300046558 Ga0495633_0000468 Ga0495633_0000468_25923_27056 377
565 3300046648 Ga0495611_0005778 Ga0495611_0005778_3675_4808 377
566 3300046660 Ga0495625_0199241 Ga0495625_0199241_66_1223 377
567 3300046664 Ga0495659_0082318 Ga0495659_0082318_40_1197 377
568 3300046665 Ga0495661_0000078 Ga0495661_0000078_25976_27109 377
569 3300046665 Ga0495661_0000359 Ga0495661_0000359_38522_39655 377
570 3300046665 Ga0495661_0009655 Ga0495661_0009655_5415_6548 377
571 3300046665 Ga0495661_0036423 Ga0495661_0036423_1848_2981 377
572 3300046665 Ga0495661_0133100 Ga0495661_0133100_63_1220 377
573 3300046691 Ga0495670_0030209 Ga0495670_0030209_66_1223 377
574 3300046692 Ga0495671_0023614 Ga0495671_0023614_101_1258 377
575 3300046692 Ga0495671_0025413 Ga0495671_0025413_47_1204 377
576 3300046692 Ga0495671_0050018 Ga0495671_0050018_666_1799 377
577 3300046794 Ga0495589_0000534 Ga0495589_0000534_18184_19317 377
578 3300046794 Ga0495589_0031153 Ga0495589_0031153_1488_2621 377
579 3300046810 Ga0495660_0001075 Ga0495660_0001075_18178_19335 377
580 3300046810 Ga0495660_0001494 Ga0495660_0001494_1512_2645 377
581 3300046810 Ga0495660_0049842 Ga0495660_0049842_58_1191 377
582 3300047320 Ga0495672_0049407 Ga0495672_0049407_1312_2445 377
583 3300047320 Ga0495672_0120938 Ga0495672_0120938_83_1228 377
584 3300047323 Ga0495683_0000409 Ga0495683_0000409_7337_8470 377
585 3300047323 Ga0495683_0028687 Ga0495683_0028687_1657_2814 377
586 3300047446 Ga0495679_000417 Ga0495679_000417_25920_27053 377
587 3300047446 Ga0495679_004078 Ga0495679_004078_62_1195 377
588 3300047446 Ga0495679_017603 Ga0495679_017603_1327_2460 377
589 3300047470 Ga0495681_0008990 Ga0495681_0008990_4421_5554 377
590 3300048917 Ga0496114_0133724 Ga0496114_0133724_210_1343 377
591 3300048920 Ga0496117_0009811 Ga0496117_0009811_7616_8749 377
592 3300048923 Ga0496120_0032535 Ga0496120_0032535_1901_3034 377
593 3300048923 Ga0496120_0039433 Ga0496120_0039433_1513_2646 377
594 3300048925 Ga0496122_0029267 Ga0496122_0029267_2879_4012 377
595 3300048926 Ga0496123_0076428 Ga0496123_0076428_100_1233 377
596 3300048926 Ga0496123_0161780 Ga0496123_0161780_31_1164 377
597 3300048927 Ga0496124_0015829 Ga0496124_0015829_95_1228 377
598 3300048927 Ga0496124_0097717 Ga0496124_0097717_151_1287 377
599 3300048928 Ga0496125_0011496 Ga0496125_0011496_98_1231 377
600 3300048928 Ga0496125_0018304 Ga0496125_0018304_61_1194 377
601 3300048928 Ga0496125_0018409 Ga0496125_0018409_5453_6586 377
602 3300048928 Ga0496125_0134026 Ga0496125_0134026_97_1230 377
603 3300048928 Ga0496125_0222808 Ga0496125_0222808_45_1178 377
604 3300048929 Ga0496126_0070023 Ga0496126_0070023_136_1269 377
605 3300049459 Ga0495678_000081 Ga0495678_000081_25797_26930 377
606 3300049460 Ga0495682_0035541 Ga0495682_0035541_45_1178 377
607 3300049853 Ga0501226_000009 Ga0501226_000009_6101_7246 377
608 3300053140 Ga0500573_0061631 Ga0500573_0061631_255_1400 377
609 3300053161 Ga0500634_0026560 Ga0500634_0026560_51_1184 377
610 3300046507 Ga0495606_0000453 Ga0495606_0000453_11917_13053 378
611 3300046694 Ga0495649_0000610 Ga0495649_0000610_10768_11904 378
612 3300055283 Ga0500661_003227 Ga0500661_003227_1007_2197 378
613 3300014497 Ga0182008_10119219 Ga0182008_101192191 379
614 3300046460 Ga0495638_0076055 Ga0495638_0076055_55_1194 379
615 3300046492 Ga0495585_0145534 Ga0495585_0145534_18_1157 379
616 3300046542 Ga0495597_0046468 Ga0495597_0046468_716_1855 379
617 2162886011 MRS1b_contig_6976788 MRS1b_0576.00002960 380
618 3300003781 Ga0055536_1011927 Ga0055536_10119271 380
619 3300003791 Ga0055530_10011048 Ga0055530_100110484 380
620 3300003792 Ga0055540_1003543 Ga0055540_100354310 380
621 3300003794 Ga0055531_10000155 Ga0055531_1000015568 380
622 3300005288 Ga0065714_10003248 Ga0065714_100032482 380
623 3300005288 Ga0065714_10068871 Ga0065714_100688711 380
624 3300005288 Ga0065714_10072724 Ga0065714_100727241 380
625 3300005353 Ga0070669_100050275 Ga0070669_1000502754 380
626 3300006058 Ga0075432_10001936 Ga0075432_100019361 380
627 3300006177 Ga0075362_10029125 Ga0075362_100291254 380
628 3300006914 Ga0075436_100125576 Ga0075436_1001255762 380
629 3300006946 Ga0079104_1000124 Ga0079104_100012492 380
630 3300009036 Ga0105244_10025034 Ga0105244_100250341 380
631 3300009036 Ga0105244_10032220 Ga0105244_100322201 380
632 3300009036 Ga0105244_10044084 Ga0105244_100440843 380
633 3300009036 Ga0105244_10085648 Ga0105244_100856482 380
634 3300009092 Ga0105250_10028504 Ga0105250_100285043 380
635 3300009092 Ga0105250_10071089 Ga0105250_100710891 380
636 3300009092 Ga0105250_10088822 Ga0105250_100888221 380
637 3300009092 Ga0105250_10088823 Ga0105250_100888231 380
638 3300009148 Ga0105243_10050449 Ga0105243_100504494 380
639 3300011119 Ga0105246_10000120 Ga0105246_100001204 380
640 3300012498 Ga0157345_1000641 Ga0157345_10006414 380
641 3300013104 Ga0157370_10061911 Ga0157370_100619114 380
642 3300013104 Ga0157370_10238523 Ga0157370_102385232 380
643 3300013105 Ga0157369_10024274 Ga0157369_100242749 380
644 3300013306 Ga0163162_10084799 Ga0163162_100847991 380
645 3300013307 Ga0157372_10151925 Ga0157372_101519254 380
646 3300013308 Ga0157375_10528237 Ga0157375_105282371 380
647 3300014497 Ga0182008_10029330 Ga0182008_100293301 380
648 3300014497 Ga0182008_10120565 Ga0182008_101205651 380
649 3300015261 Ga0182006_1016215 Ga0182006_10162151 380
650 3300015261 Ga0182006_1023118 Ga0182006_10231181 380
651 3300015265 Ga0182005_1023978 Ga0182005_10239782 380
652 3300015265 Ga0182005_1027103 Ga0182005_10271032 380
653 3300017792 Ga0163161_10028354 Ga0163161_100283543 380
654 3300017792 Ga0163161_10084181 Ga0163161_100841811 380
655 3300025230 Ga0209563_100986 Ga0209563_1009863 380
656 3300025292 Ga0209676_1000010 Ga0209676_1000010101 380
657 3300025298 Ga0209050_1000081 Ga0209050_1000081149 380
658 3300025303 Ga0209051_1000104 Ga0209051_1000104154 380
659 3300025304 Ga0209257_1000040 Ga0209257_1000040424 380
660 3300025711 Ga0207696_1003722 Ga0207696_10037224 380
661 3300025711 Ga0207696_1014501 Ga0207696_10145014 380
662 3300025728 Ga0207655_1000286 Ga0207655_100028666 380
663 3300025728 Ga0207655_1027662 Ga0207655_10276624 380
664 3300025735 Ga0207713_1002221 Ga0207713_10022212 380
665 3300025735 Ga0207713_1005180 Ga0207713_100518011 380
666 3300025735 Ga0207713_1005193 Ga0207713_100519311 380
667 3300025735 Ga0207713_1023472 Ga0207713_10234724 380
668 3300025935 Ga0207709_10000035 Ga0207709_1000003599 380
669 3300027111 Ga0209281_1000077 Ga0209281_100007792 380
670 3300027111 Ga0209281_1003944 Ga0209281_10039441 380
671 3300027907 Ga0207428_10019213 Ga0207428_100192131 380
672 3300027907 Ga0207428_10047817 Ga0207428_100478173 380
673 3300027907 Ga0207428_10068251 Ga0207428_100682513 380
674 3300032005 Ga0307411_10251205 Ga0307411_102512052 380
675 3300033180 Ga0307510_10007567 Ga0307510_100075674 380
676 3300038705 Ga0237819_01237 Ga0237819_01237_2066_3208 380
677 3300041405 Ga0439438_012314 Ga0439438_012314_87_1229 380
678 3300041405 Ga0439438_012621 Ga0439438_012621_17_1159 380
679 3300042010 Ga0439452_010576 Ga0439452_010576_68_1210 380
680 3300042122 Ga0450920_003522 Ga0450920_003522_96_1238 380
681 3300042145 Ga0450906_008493 Ga0450906_008493_817_1959 380
682 3300042146 Ga0450907_006733 Ga0450907_006733_426_1568 380
683 3300042147 Ga0450910_002701 Ga0450910_002701_1061_2203 380
684 3300042533 Ga0450901_001756 Ga0450901_001756_1226_2368 380
685 3300044656 Ga0466969_0000928 Ga0466969_0000928_5009_6286 380
686 3300044684 Ga0466966_0001527 Ga0466966_0001527_10494_11771 380
687 3300044693 Ga0466961_0000036 Ga0466961_0000036_60990_62267 380
688 3300045049 Ga0466959_0049607 Ga0466959_0049607_1719_2996 380
689 3300046452 Ga0495617_010279 Ga0495617_010279_53_1195 380
690 3300046452 Ga0495617_013362 Ga0495617_013362_67_1209 380
691 3300046452 Ga0495617_022531 Ga0495617_022531_56_1198 380
692 3300046453 Ga0495627_001562 Ga0495627_001562_10126_11268 380
693 3300046453 Ga0495627_014275 Ga0495627_014275_82_1224 380
694 3300046457 Ga0495590_0041743 Ga0495590_0041743_70_1212 380
695 3300046458 Ga0495591_012170 Ga0495591_012170_1716_2858 380
696 3300046458 Ga0495591_015835 Ga0495591_015835_1431_2573 380
697 3300046458 Ga0495591_016211 Ga0495591_016211_67_1209 380
698 3300046458 Ga0495591_025130 Ga0495591_025130_26_1168 380
699 3300046458 Ga0495591_026266 Ga0495591_026266_630_1772 380
700 3300046460 Ga0495638_0034184 Ga0495638_0034184_2047_3189 380
701 3300046460 Ga0495638_0051465 Ga0495638_0051465_46_1188 380
702 3300046460 Ga0495638_0053149 Ga0495638_0053149_1363_2505 380
703 3300046460 Ga0495638_0157135 Ga0495638_0157135_30_1172 380
704 3300046463 Ga0495653_0118494 Ga0495653_0118494_673_1815 380
705 3300046471 Ga0495650_0027093 Ga0495650_0027093_1436_2578 380
706 3300046474 Ga0495605_0034785 Ga0495605_0034785_1380_2522 380
707 3300046474 Ga0495605_0064048 Ga0495605_0064048_584_1726 380
708 3300046475 Ga0495639_0001985 Ga0495639_0001985_7699_8841 380
709 3300046491 Ga0495584_0030085 Ga0495584_0030085_1563_2705 380
710 3300046491 Ga0495584_0037457 Ga0495584_0037457_59_1201 380
711 3300046491 Ga0495584_0071541 Ga0495584_0071541_35_1177 380
712 3300046492 Ga0495585_0006456 Ga0495585_0006456_4695_5837 380
713 3300046492 Ga0495585_0039286 Ga0495585_0039286_1424_2566 380
714 3300046492 Ga0495585_0071554 Ga0495585_0071554_52_1194 380
715 3300046492 Ga0495585_0094929 Ga0495585_0094929_40_1182 380
716 3300046499 Ga0495594_0057768 Ga0495594_0057768_964_2106 380
717 3300046499 Ga0495594_0129600 Ga0495594_0129600_82_1224 380
718 3300046501 Ga0495607_0007952 Ga0495607_0007952_4875_6017 380
719 3300046501 Ga0495607_0042760 Ga0495607_0042760_1482_2624 380
720 3300046501 Ga0495607_0052500 Ga0495607_0052500_72_1214 380
721 3300046506 Ga0495583_0016893 Ga0495583_0016893_1033_2175 380
722 3300046506 Ga0495583_0030622 Ga0495583_0030622_1370_2512 380
723 3300046506 Ga0495583_0031597 Ga0495583_0031597_56_1198 380
724 3300046507 Ga0495606_0016837 Ga0495606_0016837_4316_5458 380
725 3300046507 Ga0495606_0042856 Ga0495606_0042856_1534_2676 380
726 3300046507 Ga0495606_0054539 Ga0495606_0054539_1424_2566 380
727 3300046512 Ga0495610_0008078 Ga0495610_0008078_101_1243 380
728 3300046512 Ga0495610_0027799 Ga0495610_0027799_1481_2623 380
729 3300046512 Ga0495610_0068495 Ga0495610_0068495_430_1572 380
730 3300046513 Ga0495616_0034048 Ga0495616_0034048_68_1210 380
731 3300046513 Ga0495616_0034383 Ga0495616_0034383_1400_2542 380
732 3300046513 Ga0495616_0035412 Ga0495616_0035412_1427_2569 380
733 3300046515 Ga0495620_0004777 Ga0495620_0004777_1528_2670 380
734 3300046515 Ga0495620_0027861 Ga0495620_0027861_1476_2618 380
735 3300046517 Ga0495630_0067846 Ga0495630_0067846_52_1194 380
736 3300046518 Ga0495631_0025277 Ga0495631_0025277_1498_2640 380
737 3300046518 Ga0495631_0026745 Ga0495631_0026745_66_1208 380
738 3300046519 Ga0495632_0027024 Ga0495632_0027024_83_1225 380
739 3300046519 Ga0495632_0031356 Ga0495632_0031356_83_1225 380
740 3300046519 Ga0495632_0036929 Ga0495632_0036929_1270_2412 380
741 3300046519 Ga0495632_0039508 Ga0495632_0039508_64_1206 380
742 3300046520 Ga0495637_0001794 Ga0495637_0001794_10055_11197 380
743 3300046520 Ga0495637_0024175 Ga0495637_0024175_72_1214 380
744 3300046520 Ga0495637_0026566 Ga0495637_0026566_1408_2550 380
745 3300046520 Ga0495637_0039624 Ga0495637_0039624_854_1996 380
746 3300046522 Ga0495643_0041047 Ga0495643_0041047_1331_2473 380
747 3300046523 Ga0495644_0013275 Ga0495644_0013275_71_1213 380
748 3300046524 Ga0495648_0010375 Ga0495648_0010375_1126_2268 380
749 3300046524 Ga0495648_0010500 Ga0495648_0010500_64_1206 380
750 3300046524 Ga0495648_0047372 Ga0495648_0047372_1495_2637 380
751 3300046524 Ga0495648_0059813 Ga0495648_0059813_64_1206 380
752 3300046524 Ga0495648_0097238 Ga0495648_0097238_454_1596 380
753 3300046524 Ga0495648_0105742 Ga0495648_0105742_40_1182 380
754 3300046526 Ga0495666_0032996 Ga0495666_0032996_1332_2474 380
755 3300046526 Ga0495666_0104497 Ga0495666_0104497_137_1279 380
756 3300046530 Ga0495654_0022182 Ga0495654_0022182_1714_2856 380
757 3300046530 Ga0495654_0029783 Ga0495654_0029783_1583_2725 380
758 3300046530 Ga0495654_0033652 Ga0495654_0033652_28_1170 380
759 3300046530 Ga0495654_0037546 Ga0495654_0037546_54_1196 380
760 3300046530 Ga0495654_0102525 Ga0495654_0102525_136_1278 380
761 3300046530 Ga0495654_0112520 Ga0495654_0112520_45_1187 380
762 3300046538 Ga0495609_0027652 Ga0495609_0027652_66_1208 380
763 3300046538 Ga0495609_0080381 Ga0495609_0080381_75_1217 380
764 3300046542 Ga0495597_0025688 Ga0495597_0025688_31_1173 380
765 3300046557 Ga0495622_0019702 Ga0495622_0019702_79_1221 380
766 3300046557 Ga0495622_0023539 Ga0495622_0023539_1434_2576 380
767 3300046557 Ga0495622_0028385 Ga0495622_0028385_71_1213 380
768 3300046557 Ga0495622_0038923 Ga0495622_0038923_100_1242 380
769 3300046648 Ga0495611_0001045 Ga0495611_0001045_1808_2950 380
770 3300046660 Ga0495625_0021451 Ga0495625_0021451_3739_4881 380
771 3300046664 Ga0495659_0009531 Ga0495659_0009531_230_1372 380
772 3300046665 Ga0495661_0089374 Ga0495661_0089374_54_1196 380
773 3300046679 Ga0495623_0051655 Ga0495623_0051655_1430_2572 380
774 3300046691 Ga0495670_0001176 Ga0495670_0001176_10124_11266 380
775 3300046691 Ga0495670_0022477 Ga0495670_0022477_97_1239 380
776 3300046691 Ga0495670_0062205 Ga0495670_0062205_63_1205 380
777 3300046692 Ga0495671_0026951 Ga0495671_0026951_1775_2917 380
778 3300046692 Ga0495671_0032819 Ga0495671_0032819_1451_2593 380
779 3300046692 Ga0495671_0035802 Ga0495671_0035802_63_1205 380
780 3300046692 Ga0495671_0050589 Ga0495671_0050589_80_1222 380
781 3300046694 Ga0495649_0028085 Ga0495649_0028085_1908_3050 380
782 3300046694 Ga0495649_0035392 Ga0495649_0035392_56_1198 380
783 3300046694 Ga0495649_0058033 Ga0495649_0058033_56_1198 380
784 3300046694 Ga0495649_0078390 Ga0495649_0078390_54_1196 380
785 3300046694 Ga0495649_0106763 Ga0495649_0106763_55_1197 380
786 3300046694 Ga0495649_0112709 Ga0495649_0112709_83_1225 380
787 3300046794 Ga0495589_0029162 Ga0495589_0029162_1575_2717 380
788 3300046794 Ga0495589_0032200 Ga0495589_0032200_17_1159 380
789 3300046794 Ga0495589_0037268 Ga0495589_0037268_1264_2406 380
790 3300046809 Ga0495600_0090800 Ga0495600_0090800_808_1950 380
791 3300046810 Ga0495660_0034912 Ga0495660_0034912_1421_2563 380
792 3300046810 Ga0495660_0035999 Ga0495660_0035999_101_1243 380
793 3300046810 Ga0495660_0052180 Ga0495660_0052180_31_1173 380
794 3300046810 Ga0495660_0074217 Ga0495660_0074217_37_1179 380
795 3300047315 Ga0495581_0081596 Ga0495581_0081596_98_1240 380
796 3300047320 Ga0495672_0042947 Ga0495672_0042947_55_1197 380
797 3300047320 Ga0495672_0044092 Ga0495672_0044092_93_1235 380
798 3300047320 Ga0495672_0056659 Ga0495672_0056659_1082_2224 380
799 3300047322 Ga0495680_0123274 Ga0495680_0123274_66_1208 380
800 3300047323 Ga0495683_0026477 Ga0495683_0026477_1747_2889 380
801 3300047443 Ga0495687_021761 Ga0495687_021761_123_1265 380
802 3300047443 Ga0495687_023299 Ga0495687_023299_69_1211 380
803 3300047443 Ga0495687_029792 Ga0495687_029792_1360_2502 380
804 3300047469 Ga0495673_0027187 Ga0495673_0027187_78_1220 380
805 3300047469 Ga0495673_0038335 Ga0495673_0038335_66_1208 380
806 3300047470 Ga0495681_0029334 Ga0495681_0029334_1653_2795 380
807 3300047470 Ga0495681_0029766 Ga0495681_0029766_1574_2716 380
808 3300047470 Ga0495681_0029968 Ga0495681_0029968_1575_2717 380
809 3300047470 Ga0495681_0037465 Ga0495681_0037465_1153_2295 380
810 3300047472 Ga0495686_0117995 Ga0495686_0117995_345_1487 380
811 3300047673 Ga0495593_0067271 Ga0495593_0067271_661_1803 380
812 3300048091 Ga0495626_0028155 Ga0495626_0028155_118_1260 380
813 3300048091 Ga0495626_0028439 Ga0495626_0028439_1513_2655 380
814 3300048091 Ga0495626_0030485 Ga0495626_0030485_1418_2560 380
815 3300048091 Ga0495626_0045829 Ga0495626_0045829_880_2022 380
816 3300048919 Ga0496116_0008407 Ga0496116_0008407_105_1247 380
817 3300048921 Ga0496118_0075693 Ga0496118_0075693_1201_2343 380
818 3300048925 Ga0496122_0062670 Ga0496122_0062670_69_1211 380
819 3300048925 Ga0496122_0164285 Ga0496122_0164285_73_1215 380
820 3300048926 Ga0496123_0104869 Ga0496123_0104869_453_1595 380
821 3300048926 Ga0496123_0161524 Ga0496123_0161524_28_1170 380
822 3300048927 Ga0496124_0219866 Ga0496124_0219866_217_1359 380
823 3300049459 Ga0495678_025095 Ga0495678_025095_23_1165 380
824 3300049459 Ga0495678_032517 Ga0495678_032517_920_2062 380
825 3300049460 Ga0495682_0016504 Ga0495682_0016504_1553_2695 380
826 3300049460 Ga0495682_0016685 Ga0495682_0016685_12_1154 380
827 3300049460 Ga0495682_0033487 Ga0495682_0033487_74_1216 380
828 3300053111 Ga0500572_006879 Ga0500572_006879_1370_2512 380
829 3300009011 Ga0105251_10000125 Ga0105251_1000012587 381
830 3300009092 Ga0105250_10000612 Ga0105250_1000061218 381
831 3300025711 Ga0207696_1000191 Ga0207696_100019125 381
832 3300025735 Ga0207713_1000166 Ga0207713_100016623 381
833 3300025735 Ga0207713_1037223 Ga0207713_10372232 381
834 3300041411 Ga0439466_0014068 Ga0439466_0014068_1677_2822 381
835 3300042016 Ga0439463_001279 Ga0439463_001279_5477_6622 381
836 3300042156 Ga0439446_0005983 Ga0439446_0005983_1741_2886 381
837 3300048927 Ga0496124_0062022 Ga0496124_0062022_1910_3055 381
838 3300049459 Ga0495678_042255 Ga0495678_042255_261_1406 381
839 iso_pu_bacteria 2511231016 2511326190 381
840 iso_pu_bacteria 2511231018 2511339587 381
841 iso_pu_bacteria 2511231019 2511344660 381
842 iso_pu_bacteria 2511231022 2511365753 381
843 iso_pu_bacteria 2773857670 2774119184 381
844 iso_pu_bacteria 2784132072 2784314834 381
845 iso_pu_bacteria 2808606377 2808930604 381
846 iso_pu_bacteria 2808606381 2808952726 381
847 iso_pu_bacteria 2808606382 2808958989 381
848 iso_pu_bacteria 2808606445 2809218762 381
849 iso_pu_bacteria 2860339153 2860340789 381
850 iso_pu_bacteria 2919456309 2919461079 381
851 iso_pu_bacteria 2931396565 2931403342 381
852 iso_pu_bacteria 3007511990 3007515321 381
853 iso_pu_bacteria 3007619802 3007620077 381
854 iso_pu_bacteria 8056177738 8056179480 381
855 3300042142 Ga0450905_005198 Ga0450905_005198_539_1687 382
856 3300046536 Ga0495587_0085550 Ga0495587_0085550_95_1243 382
857 3300046642 Ga0495634_0042607 Ga0495634_0042607_1894_3042 382
858 3300046663 Ga0495635_0053856 Ga0495635_0053856_57_1205 382
859 3300048929 Ga0496126_0113263 Ga0496126_0113263_72_1220 382
860 3300009011 Ga0105251_10005278 Ga0105251_100052781 383
861 3300009011 Ga0105251_10027770 Ga0105251_100277701 383
862 3300013100 Ga0157373_10045585 Ga0157373_100455851 383
863 3300015261 Ga0182006_1017477 Ga0182006_10174771 383
864 3300042115 Ga0450911_002953 Ga0450911_002953_1898_3079 383
865 3300046458 Ga0495591_000128 Ga0495591_000128_81288_82496 383
866 3300046529 Ga0495652_0072802 Ga0495652_0072802_1610_2782 383
867 3300046810 Ga0495660_0002049 Ga0495660_0002049_11373_12581 383
868 3300048925 Ga0496122_0066210 Ga0496122_0066210_1313_2581 383
869 iso_pu_bacteria 8015687852 8015692047 383
870 iso_pu_bacteria 2511231004 2511255046 384
871 iso_pu_bacteria 2511231008 2511276050 384
872 2124908027 MRS2a_Contig_6176 MRS2a_00075380 385
873 3300005288 Ga0065714_10000759 Ga0065714_100007592 385
874 3300005288 Ga0065714_10024949 Ga0065714_100249491 385
875 3300005288 Ga0065714_10109927 Ga0065714_101099272 385
876 3300005288 Ga0065714_10121590 Ga0065714_101215901 385
877 3300005293 Ga0065715_10127901 Ga0065715_101279012 385
878 3300009036 Ga0105244_10071664 Ga0105244_100716641 385
879 3300013100 Ga0157373_10219316 Ga0157373_102193161 385
880 3300013102 Ga0157371_10045305 Ga0157371_100453051 385
881 3300013104 Ga0157370_10318808 Ga0157370_103188081 385
882 3300015261 Ga0182006_1030098 Ga0182006_10300983 385
883 3300015261 Ga0182006_1033945 Ga0182006_10339453 385
884 3300015265 Ga0182005_1022357 Ga0182005_10223572 385
885 3300015265 Ga0182005_1035494 Ga0182005_10354942 385
886 3300017792 Ga0163161_10036333 Ga0163161_100363334 385
887 3300025711 Ga0207696_1022598 Ga0207696_10225982 385
888 3300025728 Ga0207655_1016926 Ga0207655_10169264 385
889 3300025735 Ga0207713_1000530 Ga0207713_100053028 385
890 3300041407 Ga0439447_010218 Ga0439447_010218_71_1237 385
891 3300041411 Ga0439466_0026865 Ga0439466_0026865_821_1987 385
892 3300042139 Ga0450904_002558 Ga0450904_002558_60_1217 385
893 3300046452 Ga0495617_023210 Ga0495617_023210_879_2036 385
894 3300046455 Ga0495603_0033091 Ga0495603_0033091_1869_3026 385
895 3300046460 Ga0495638_0051052 Ga0495638_0051052_66_1223 385
896 3300046471 Ga0495650_0021504 Ga0495650_0021504_1869_3026 385
897 3300046471 Ga0495650_0027294 Ga0495650_0027294_1458_2615 385
898 3300046474 Ga0495605_0032305 Ga0495605_0032305_57_1214 385
899 3300046474 Ga0495605_0033551 Ga0495605_0033551_1399_2562 385
900 3300046474 Ga0495605_0043020 Ga0495605_0043020_996_2153 385
901 3300046491 Ga0495584_0023632 Ga0495584_0023632_30_1187 385
902 3300046491 Ga0495584_0118003 Ga0495584_0118003_74_1231 385
903 3300046492 Ga0495585_0036868 Ga0495585_0036868_1553_2710 385
904 3300046492 Ga0495585_0129452 Ga0495585_0129452_95_1252 385
905 3300046499 Ga0495594_0090802 Ga0495594_0090802_132_1289 385
906 3300046501 Ga0495607_0076053 Ga0495607_0076053_665_1822 385
907 3300046501 Ga0495607_0091553 Ga0495607_0091553_47_1204 385
908 3300046506 Ga0495583_0069941 Ga0495583_0069941_113_1270 385
909 3300046507 Ga0495606_0041173 Ga0495606_0041173_26_1183 385
910 3300046512 Ga0495610_0025493 Ga0495610_0025493_1946_3103 385
911 3300046512 Ga0495610_0054237 Ga0495610_0054237_732_1889 385
912 3300046518 Ga0495631_0019601 Ga0495631_0019601_1921_3078 385
913 3300046519 Ga0495632_0012549 Ga0495632_0012549_64_1221 385
914 3300046519 Ga0495632_0051664 Ga0495632_0051664_48_1205 385
915 3300046520 Ga0495637_0022802 Ga0495637_0022802_22_1179 385
916 3300046520 Ga0495637_0057872 Ga0495637_0057872_70_1227 385
917 3300046528 Ga0495642_0015737 Ga0495642_0015737_1698_2855 385
918 3300046538 Ga0495609_0027260 Ga0495609_0027260_1381_2538 385
919 3300046542 Ga0495597_0028235 Ga0495597_0028235_1342_2499 385
920 3300046558 Ga0495633_0022860 Ga0495633_0022860_1920_3077 385
921 3300046615 Ga0495656_0012220 Ga0495656_0012220_1991_3148 385
922 3300046648 Ga0495611_0111163 Ga0495611_0111163_51_1208 385
923 3300046660 Ga0495625_0111690 Ga0495625_0111690_623_1780 385
924 3300046660 Ga0495625_0202911 Ga0495625_0202911_81_1238 385
925 3300046665 Ga0495661_0068298 Ga0495661_0068298_871_2028 385
926 3300046665 Ga0495661_0073412 Ga0495661_0073412_722_1879 385
927 3300046665 Ga0495661_0088550 Ga0495661_0088550_583_1740 385
928 3300046674 Ga0495588_0084004 Ga0495588_0084004_382_1539 385
929 3300046679 Ga0495623_0041257 Ga0495623_0041257_12_1169 385
930 3300046689 Ga0495613_0133482 Ga0495613_0133482_584_1741 385
931 3300046692 Ga0495671_0060052 Ga0495671_0060052_36_1193 385
932 3300046694 Ga0495649_0140474 Ga0495649_0140474_97_1254 385
933 3300047319 Ga0495674_0072281 Ga0495674_0072281_1794_2951 385
934 3300047322 Ga0495680_0055198 Ga0495680_0055198_1831_2988 385
935 3300047323 Ga0495683_0023630 Ga0495683_0023630_88_1245 385
936 3300047444 Ga0495675_0066999 Ga0495675_0066999_1057_2214 385
937 3300047445 Ga0495677_0016142 Ga0495677_0016142_1458_2615 385
938 3300047446 Ga0495679_019895 Ga0495679_019895_1137_2294 385
939 3300047447 Ga0495685_026843 Ga0495685_026843_742_1899 385
940 3300047469 Ga0495673_0021249 Ga0495673_0021249_67_1224 385
941 3300047470 Ga0495681_0028400 Ga0495681_0028400_60_1217 385
942 3300047470 Ga0495681_0033268 Ga0495681_0033268_1354_2511 385
943 3300047470 Ga0495681_0090593 Ga0495681_0090593_68_1225 385
944 3300047472 Ga0495686_0045948 Ga0495686_0045948_1557_2714 385
945 3300048905 Ga0496102_0073025 Ga0496102_0073025_73_1230 385
946 3300048906 Ga0496103_0037628 Ga0496103_0037628_60_1217 385
947 3300048919 Ga0496116_0081774 Ga0496116_0081774_803_1960 385
948 3300048920 Ga0496117_0154892 Ga0496117_0154892_147_1304 385
949 3300048921 Ga0496118_0068523 Ga0496118_0068523_1360_2517 385
950 3300048924 Ga0496121_0092571 Ga0496121_0092571_1184_2341 385
951 3300048924 Ga0496121_0144818 Ga0496121_0144818_82_1239 385
952 3300048927 Ga0496124_0173931 Ga0496124_0173931_463_1620 385
953 3300048928 Ga0496125_0064361 Ga0496125_0064361_1739_2896 385
954 3300049459 Ga0495678_064892 Ga0495678_064892_88_1245 385
955 3300049460 Ga0495682_0015572 Ga0495682_0015572_133_1290 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10093

EarP

Elongation-Factor P (EF-P) rhamnosyltransferase EarP

60

429

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j7m-assembly2.cif.gz_C complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p 0.9767 9 381
6j7l-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa earp in complex with tdp 0.9725 11 380
6j7j-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa earp 0.9721 11 380
6j7m-assembly2.cif.gz_C complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p 0.964 9 381
6j7l-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa earp in complex with tdp 0.9423 11 380
ID Description Score Start End Superfamily
af_Q0E1A4_2_117_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6974 252 314 3.40.50.2000
af_Q10B95_32_242_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6499 9 95 3.40.50.150
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6276 3 50 3.50.50.60
2yjnA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6242 184 366 3.40.50.2000
af_I1J850_294_457_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6006 186 360 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A109LCU4-F1-model_v4 Protein-arginine rhamnosyltransferase (EF-P arginine rhamnosyltransferase) 0.9905 193 381 GO:0106361
AF-S6VRQ1-F1-model_v4 Protein-arginine rhamnosyltransferase (EF-P arginine rhamnosyltransferase) 0.9871 207 379 GO:0106361
AF-A0A257D5X2-F1-model_v4 deleted 0.9866 11 381
AF-U2B1T9-F1-model_v4 Protein-arginine rhamnosyltransferase (EF-P arginine rhamnosyltransferase) 0.9866 175 380 GO:0106361
AF-A0A3D9EUM4-F1-model_v4 Elongation factor P (EF-P) 0.9842 11 380 GO:0003746
GO:0005737
GO:0043043
GO:0106361

Feature Viewer

pLDDT pTM Quality
93.23 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map