F486464

General Info

Members Datasets Scaffolds Average Seq Length
946 362 788 226

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0055404|Ga0495648_0055404_43_732
Length 223
Sequence MDKQHKASIDGDQWAQCVRDHGWLWDAASGEASATLILAHGAGAPMDSDWMNDMAGRLAGLGINVLRFEFPYMAQRRVDGVKRPPNPAAKLQACWREVYAEVRRHVAGGLAIGRMASLLADELGADALVCLGYPFYALGKPEKPRVEHLASLQTRTLIVQGERDALGNREAVEAYTLSPSIEVAWLAAGDHDLKPLKVSGFTHEQHLASAAERVSGFLRGRSS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231020 Pseudomonas sp. GM74 Isolate Nodule
15 2511231022 Pseudomonas sp. GM79 Isolate Nodule
16 2511231023 Pseudomonas sp. GM80 Isolate Nodule
17 2511231031 Pseudomonas sp. GM16 Isolate Nodule
18 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
19 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
20 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
21 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
22 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
23 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
24 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
25 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
26 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
27 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
28 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
29 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
30 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
31 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
32 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
33 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
34 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
35 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
36 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
37 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
38 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
39 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
40 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
41 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
42 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
43 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
44 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
45 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
46 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
47 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
48 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
49 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
50 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
51 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
52 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
53 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
54 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
55 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
56 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
57 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
58 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
59 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
60 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
61 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
62 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
63 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
64 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
65 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
66 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
67 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
68 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
69 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
70 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
71 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
72 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
73 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
74 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
75 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
76 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
77 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
78 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
79 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
80 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
81 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
82 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
83 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
84 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
85 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
86 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
87 2773857670 Pseudomonas sp. 478 Isolate Unclassified
88 2773857673 Pseudomonas sp. 443 Isolate Unclassified
89 2784132063 Pseudomonas sp. 424 Isolate Unclassified
90 2784132072 Pseudomonas sp. 460 Isolate Unclassified
91 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
92 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
93 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
94 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
95 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
96 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
97 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
98 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
99 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
100 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
101 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
102 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
103 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
104 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
105 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
106 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
107 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
108 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
109 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
110 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
111 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
112 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
113 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
114 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
115 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
116 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
117 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
118 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
119 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
120 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
121 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
122 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
123 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
124 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
125 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
126 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
127 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
128 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
129 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
130 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
131 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
132 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
133 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
134 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
135 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
136 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
137 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
138 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
139 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
140 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
141 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
142 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
143 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
144 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
145 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
146 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
147 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
148 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
149 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
150 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
151 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
152 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
153 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
154 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
155 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
156 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
157 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
158 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
159 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
160 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
161 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
162 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
163 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
164 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
165 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
166 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
167 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
168 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
169 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
170 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
171 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
172 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
173 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
174 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
175 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
176 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
177 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
178 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
179 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
180 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
181 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
182 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
183 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
188 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
198 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
202 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
203 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
204 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
205 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
215 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
216 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
219 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
220 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
221 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
222 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
223 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
224 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
225 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
226 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
227 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
228 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
229 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
230 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
231 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
232 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
235 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
236 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
237 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
238 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
239 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
240 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
241 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
242 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
243 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
258 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
259 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
268 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
269 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
286 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
298 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
299 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
310 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
330 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
335 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
338 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
344 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
345 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
346 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
347 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
348 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
349 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
350 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
351 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
352 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
353 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
354 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
355 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
356 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
357 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
358 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
359 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
360 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
361 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
362 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.3
Metatranscriptomes 0
Isolates 16.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.5
Nodule 2.64
Rhizoplane 5.71
Rhizosphere 78.54
Stem 0
Stem Tuber 0
Unclassified 7.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_7 2124908027 Bacteria 72867
2 SwRhRL2b_contig_1954139 2162886007 Bacteria 1368
3 JGI25162J39368_1000667 3300002737 Bacteria 24256
4 JGI25162J39368_1000717 3300002737 Bacteria 22916
5 JGI25163J39215_1000323 3300002771 Bacteria 15993
6 JGI25163J39215_1003173 3300002771 Bacteria 1399
7 JGI25164J39214_1000414 3300002772 Bacteria 24256
8 JGI25164J39214_1000434 3300002772 Bacteria 22916
9 JGI25165J46597_1000779 3300003214 Bacteria 24256
10 JGI25165J46597_1000834 3300003214 Bacteria 22916
11 Ga0055536_1019778 3300003781 Bacteria 2104
12 Ga0055530_10001093 3300003791 Bacteria 21270
13 Ga0055530_10001673 3300003791 Bacteria 15735
14 Ga0055530_10018747 3300003791 Bacteria 2120
15 Ga0055540_1000839 3300003792 Bacteria 20650
16 Ga0055540_1000934 3300003792 Bacteria 19048
17 Ga0055540_1016471 3300003792 Bacteria 2103
18 Ga0055531_10004245 3300003794 Bacteria 8814
19 Ga0065714_10002759 3300005288 Bacteria 15661
20 Ga0065714_10005124 3300005288 Bacteria 5569
21 Ga0065714_10011720 3300005288 Bacteria 2225
22 Ga0065714_10026665 3300005288 Bacteria 1118
23 Ga0065714_10067363 3300005288 Bacteria 5603
24 Ga0065714_10071353 3300005288 Bacteria 3599
25 Ga0065714_10089809 3300005288 Bacteria 1966
26 Ga0065714_10181245 3300005288 Bacteria 962
27 Ga0065704_10129708 3300005289 Bacteria 1645
28 Ga0065712_10002774 3300005290 Bacteria 13095
29 Ga0065715_10305746 3300005293 Bacteria 1031
30 Ga0070669_100014368 3300005353 Bacteria 5634
31 Ga0070665_100083340 3300005548 Bacteria 3202
32 Ga0075364_10064529 3300006051 Bacteria 2404
33 Ga0075364_10160475 3300006051 Bacteria 1517
34 Ga0075432_10022319 3300006058 Bacteria 2164
35 Ga0075432_10042359 3300006058 Bacteria 1592
36 Ga0075432_10226694 3300006058 Bacteria 750
37 Ga0075362_10149438 3300006177 Bacteria 1120
38 Ga0075362_10214533 3300006177 Bacteria 939
39 Ga0075369_10162197 3300006186 Bacteria 1025
40 Ga0075436_100204477 3300006914 Bacteria 1399
41 Ga0075436_100413585 3300006914 Bacteria 978
42 Ga0079104_1000962 3300006946 Bacteria 22589
43 Ga0079104_1001782 3300006946 Bacteria 13452
44 Ga0079104_1008164 3300006946 Bacteria 3701
45 Ga0099826_10016236 3300006948 Bacteria 5620
46 Ga0105251_10026046 3300009011 Bacteria 2982
47 Ga0105251_10033672 3300009011 Bacteria 2541
48 Ga0105251_10146011 3300009011 Bacteria 1069
49 Ga0105251_10148579 3300009011 Bacteria 1059
50 Ga0105251_10153202 3300009011 Bacteria 1040
51 Ga0105251_10180025 3300009011 Bacteria 952
52 Ga0105244_10023037 3300009036 Bacteria 3422
53 Ga0105244_10042750 3300009036 Bacteria 2341
54 Ga0105244_10080734 3300009036 Bacteria 1610
55 Ga0105244_10128711 3300009036 Bacteria 1222
56 Ga0105244_10140711 3300009036 Bacteria 1161
57 Ga0105250_10066760 3300009092 Bacteria 1451
58 Ga0105243_10000161 3300009148 Bacteria 76138
59 Ga0105243_10241119 3300009148 Bacteria 1609
60 Ga0105249_10245357 3300009553 Bacteria 1773
61 Ga0105246_10005198 3300011119 Bacteria 7913
62 Ga0105246_10218582 3300011119 Bacteria 1492
63 Ga0157345_1000424 3300012498 Bacteria 4348
64 Ga0157373_10030084 3300013100 Bacteria 3908
65 Ga0157373_10305191 3300013100 Bacteria 1130
66 Ga0157373_10311170 3300013100 Bacteria 1119
67 Ga0157371_10000714 3300013102 Bacteria 38837
68 Ga0157371_10201127 3300013102 Bacteria 1428
69 Ga0157371_10227535 3300013102 Bacteria 1340
70 Ga0157371_10295259 3300013102 Bacteria 1172
71 Ga0157371_10332415 3300013102 Bacteria 1104
72 Ga0157371_10371306 3300013102 Bacteria 1043
73 Ga0157370_10021665 3300013104 Bacteria 6402
74 Ga0157370_10056938 3300013104 Bacteria 3719
75 Ga0157370_10231763 3300013104 Bacteria 1709
76 Ga0157370_10457983 3300013104 Bacteria 1172
77 Ga0157369_10293458 3300013105 Bacteria 1692
78 Ga0157369_10408484 3300013105 Bacteria 1408
79 Ga0157369_10523389 3300013105 Bacteria 1227
80 Ga0163162_10180066 3300013306 Bacteria 2240
81 Ga0163162_10193187 3300013306 Bacteria 2163
82 Ga0163162_10436799 3300013306 Bacteria 1441
83 Ga0157372_10356177 3300013307 Bacteria 1705
84 Ga0182008_10002147 3300014497 Bacteria 12574
85 Ga0182008_10042120 3300014497 Bacteria 2275
86 Ga0182008_10096985 3300014497 Bacteria 1455
87 Ga0182008_10145794 3300014497 Bacteria 1186
88 Ga0182008_10175292 3300014497 Bacteria 1084
89 Ga0182006_1006820 3300015261 Bacteria 5269
90 Ga0182006_1025377 3300015261 Bacteria 2435
91 Ga0182006_1036603 3300015261 Bacteria 1950
92 Ga0182006_1038991 3300015261 Bacteria 1877
93 Ga0182006_1063279 3300015261 Bacteria 1390
94 Ga0182006_1110170 3300015261 Bacteria 967
95 Ga0182006_1147213 3300015261 Bacteria 801
96 Ga0182007_10001015 3300015262 Bacteria 15379
97 Ga0182007_10017151 3300015262 Bacteria 2653
98 Ga0182005_1002471 3300015265 Bacteria 6580
99 Ga0182005_1006435 3300015265 Bacteria 3591
100 Ga0182005_1010621 3300015265 Bacteria 2643
101 Ga0182005_1010905 3300015265 Bacteria 2605
102 Ga0182005_1022047 3300015265 Bacteria 1745
103 Ga0163161_10007942 3300017792 Bacteria 7345
104 Ga0163161_10035069 3300017792 Bacteria 3590
105 Ga0163161_10079242 3300017792 Bacteria 2415
106 Ga0163161_10714987 3300017792 Bacteria 835
107 Ga0209760_100130 3300025207 Bacteria 49371
108 Ga0209760_100143 3300025207 Bacteria 45169
109 Ga0209563_110929 3300025230 Bacteria 1302
110 Ga0207427_100001 3300025231 Bacteria 1410763
111 Ga0207427_100008 3300025231 Bacteria 740731
112 Ga0209437_100003 3300025233 Bacteria 1517827
113 Ga0209437_100014 3300025233 Bacteria 740714
114 Ga0209233_1000007 3300025261 Bacteria 1411234
115 Ga0209233_1000008 3300025261 Bacteria 1356712
116 Ga0209676_1000021 3300025292 Bacteria 609534
117 Ga0209676_1000055 3300025292 Bacteria 361565
118 Ga0209676_1000127 3300025292 Bacteria 189701
119 Ga0209676_1043467 3300025292 Bacteria 1239
120 Ga0209676_1043836 3300025292 Bacteria 1231
121 Ga0209050_1000009 3300025298 Bacteria 1047265
122 Ga0209050_1000120 3300025298 Bacteria 198658
123 Ga0209050_1000395 3300025298 Bacteria 81719
124 Ga0209050_1000972 3300025298 Bacteria 36685
125 Ga0209051_1000008 3300025303 Bacteria 706935
126 Ga0209051_1000083 3300025303 Bacteria 192732
127 Ga0209051_1000745 3300025303 Bacteria 34964
128 Ga0209051_1012645 3300025303 Bacteria 4070
129 Ga0209257_1000175 3300025304 Bacteria 165070
130 Ga0207696_1000025 3300025711 Bacteria 418650
131 Ga0207696_1036046 3300025711 Bacteria 1470
132 Ga0207655_1000187 3300025728 Bacteria 109886
133 Ga0207655_1003631 3300025728 Bacteria 11395
134 Ga0207655_1005088 3300025728 Bacteria 9089
135 Ga0207655_1008110 3300025728 Bacteria 6719
136 Ga0207655_1030061 3300025728 Bacteria 2533
137 Ga0207655_1057936 3300025728 Bacteria 1518
138 Ga0207655_1064382 3300025728 Bacteria 1398
139 Ga0207713_1000176 3300025735 Bacteria 92148
140 Ga0207713_1002544 3300025735 Bacteria 13192
141 Ga0207713_1007113 3300025735 Bacteria 6691
142 Ga0207713_1009077 3300025735 Bacteria 5648
143 Ga0207713_1092279 3300025735 Bacteria 1062
144 Ga0207713_1100289 3300025735 Bacteria 1001
145 Ga0207706_10205840 3300025933 Bacteria 1725
146 Ga0207709_10000089 3300025935 Bacteria 149139
147 Ga0209281_1000011 3300027111 Bacteria 695292
148 Ga0209281_1000090 3300027111 Bacteria 242950
149 Ga0209281_1013449 3300027111 Bacteria 1767
150 Ga0209281_1020874 3300027111 Bacteria 1274
151 Ga0209281_1031452 3300027111 Bacteria 946
152 Ga0209371_1001151 3300027312 Bacteria 19348
153 Ga0207428_10189314 3300027907 Bacteria 1552
154 Ga0268266_10152927 3300028379 Bacteria 2081
155 Ga0307517_10206971 3300028786 Bacteria 1216
156 Ga0268256_1000982 3300030500 Bacteria 19348
157 Ga0314311_1188052 3300030733 Bacteria 1559
158 Ga0316178_1156030 3300030735 Bacteria 2490
159 Ga0316181_1153579 3300030744 Bacteria 1418
160 Ga0307509_10263019 3300031507 Bacteria 1499
161 Ga0307408_100224181 3300031548 Bacteria 1535
162 Ga0307408_100487519 3300031548 Bacteria 1076
163 Ga0307405_10130369 3300031731 Bacteria 1736
164 Ga0307405_10480653 3300031731 Bacteria 991
165 Ga0307406_10007496 3300031901 Bacteria 6052
166 Ga0307406_10154090 3300031901 Bacteria 1643
167 Ga0307412_10007418 3300031911 Bacteria 6222
168 Ga0307412_10007529 3300031911 Bacteria 6182
169 Ga0307412_10074036 3300031911 Bacteria 2332
170 Ga0307414_10854014 3300032004 Bacteria 832
171 Ga0307411_10088241 3300032005 Bacteria 2156
172 Ga0307411_10664681 3300032005 Bacteria 903
173 Ga0307510_10172947 3300033180 Bacteria 1735
174 Ga0439438_004171 3300041405 Bacteria 5631
175 Ga0439438_004194 3300041405 Bacteria 5605
176 Ga0439438_006039 3300041405 Bacteria 4350
177 Ga0439438_006437 3300041405 Bacteria 4138
178 Ga0439438_010631 3300041405 Bacteria 2899
179 Ga0439438_015395 3300041405 Bacteria 2252
180 Ga0439438_015956 3300041405 Bacteria 2195
181 Ga0439438_032407 3300041405 Bacteria 1385
182 Ga0439438_046787 3300041405 Bacteria 1110
183 Ga0439447_002873 3300041407 Bacteria 6177
184 Ga0439447_014799 3300041407 Bacteria 2177
185 Ga0439447_018398 3300041407 Bacteria 1883
186 Ga0439447_028748 3300041407 Bacteria 1410
187 Ga0439447_031343 3300041407 Bacteria 1334
188 Ga0439466_0001445 3300041411 Bacteria 9268
189 Ga0439466_0004658 3300041411 Bacteria 5267
190 Ga0439466_0038263 3300041411 Bacteria 1611
191 Ga0439466_0039273 3300041411 Bacteria 1587
192 Ga0439466_0040269 3300041411 Bacteria 1563
193 Ga0439466_0042300 3300041411 Bacteria 1517
194 Ga0439466_0042487 3300041411 Bacteria 1513
195 Ga0439466_0069192 3300041411 Bacteria 1126
196 Ga0439466_0074632 3300041411 Bacteria 1075
197 Ga0439466_0122037 3300041411 Bacteria 804
198 Ga0439431_0068002 3300041997 Bacteria 946
199 Ga0439432_001594 3300042006 Bacteria 8492
200 Ga0439432_010060 3300042006 Bacteria 3287
201 Ga0439432_048289 3300042006 Bacteria 1333
202 Ga0439432_088132 3300042006 Bacteria 935
203 Ga0439451_001401 3300042009 Bacteria 4769
204 Ga0439451_011452 3300042009 Bacteria 1790
205 Ga0439451_014749 3300042009 Bacteria 1577
206 Ga0439451_015202 3300042009 Bacteria 1551
207 Ga0439451_046071 3300042009 Bacteria 873
208 Ga0439451_050275 3300042009 Bacteria 835
209 Ga0439452_001423 3300042010 Bacteria 9839
210 Ga0439452_003954 3300042010 Bacteria 5071
211 Ga0439452_005700 3300042010 Bacteria 3981
212 Ga0439452_028703 3300042010 Bacteria 1385
213 Ga0439452_050859 3300042010 Bacteria 949
214 Ga0439456_001971 3300042013 Bacteria 4135
215 Ga0439456_014276 3300042013 Bacteria 1656
216 Ga0439456_024635 3300042013 Bacteria 1276
217 Ga0439456_058634 3300042013 Bacteria 845
218 Ga0439463_000847 3300042016 Bacteria 8393
219 Ga0439463_013623 3300042016 Bacteria 2002
220 Ga0439463_026234 3300042016 Bacteria 1463
221 Ga0439463_032102 3300042016 Bacteria 1327
222 Ga0439463_037056 3300042016 Bacteria 1236
223 Ga0439463_058597 3300042016 Bacteria 985
224 Ga0450911_001240 3300042115 Bacteria 6150
225 Ga0450911_002616 3300042115 Bacteria 3462
226 Ga0450911_012059 3300042115 Bacteria 1171
227 Ga0450911_018878 3300042115 Bacteria 905
228 Ga0450919_005530 3300042121 Bacteria 1515
229 Ga0450922_002100 3300042124 Bacteria 1895
230 Ga0450902_012213 3300042137 Bacteria 1372
231 Ga0450903_008008 3300042138 Bacteria 1732
232 Ga0450903_013388 3300042138 Bacteria 1304
233 Ga0450903_024833 3300042138 Bacteria 918
234 Ga0450904_004349 3300042139 Bacteria 1475
235 Ga0450905_022169 3300042142 Bacteria 942
236 Ga0450906_003943 3300042145 Bacteria 3138
237 Ga0450906_008117 3300042145 Bacteria 2044
238 Ga0450906_021077 3300042145 Bacteria 1165
239 Ga0450907_000169 3300042146 Bacteria 23912
240 Ga0450907_002704 3300042146 Bacteria 3300
241 Ga0450907_003935 3300042146 Bacteria 2591
242 Ga0450910_000282 3300042147 Bacteria 5877
243 Ga0439446_0040866 3300042156 Bacteria 1365
244 Ga0450909_004555 3300042185 Bacteria 1981
245 Ga0450909_006840 3300042185 Bacteria 1643
246 Ga0439434_0037172 3300042435 Bacteria 1490
247 Ga0439464_0126951 3300042439 Bacteria 788
248 Ga0439460_0020929 3300042461 Bacteria 1782
249 Ga0450918_020987 3300042531 Bacteria 1141
250 Ga0450893_0034086 3300042532 Bacteria 915
251 Ga0450901_002062 3300042533 Bacteria 2223
252 Ga0439440_0004274 3300042993 Bacteria 2802
253 Ga0439440_0008316 3300042993 Bacteria 2127
254 Ga0495617_000723 3300046452 Bacteria 16351
255 Ga0495617_009100 3300046452 Bacteria 3415
256 Ga0495617_009513 3300046452 Bacteria 3337
257 Ga0495617_011815 3300046452 Bacteria 2978
258 Ga0495617_053977 3300046452 Bacteria 1334
259 Ga0495617_068039 3300046452 Bacteria 1172
260 Ga0495617_078245 3300046452 Bacteria 1084
261 Ga0495617_144133 3300046452 Bacteria 759
262 Ga0495617_160503 3300046452 Bacteria 713
263 Ga0495627_001350 3300046453 Bacteria 14775
264 Ga0495627_004630 3300046453 Bacteria 5703
265 Ga0495627_037466 3300046453 Bacteria 1503
266 Ga0495627_073396 3300046453 Bacteria 997
267 Ga0495627_073469 3300046453 Bacteria 996
268 Ga0495603_0006846 3300046455 Bacteria 6838
269 Ga0495603_0022907 3300046455 Bacteria 3780
270 Ga0495603_0262400 3300046455 Bacteria 994
271 Ga0495590_0003477 3300046457 Bacteria 6427
272 Ga0495590_0009747 3300046457 Bacteria 3638
273 Ga0495590_0077780 3300046457 Bacteria 1167
274 Ga0495590_0078303 3300046457 Bacteria 1163
275 Ga0495590_0107398 3300046457 Bacteria 994
276 Ga0495590_0127606 3300046457 Bacteria 913
277 Ga0495590_0148310 3300046457 Bacteria 849
278 Ga0495591_000785 3300046458 Bacteria 22547
279 Ga0495591_005029 3300046458 Bacteria 6224
280 Ga0495591_009580 3300046458 Bacteria 3832
281 Ga0495591_010532 3300046458 Bacteria 3576
282 Ga0495591_017395 3300046458 Bacteria 2470
283 Ga0495591_040425 3300046458 Bacteria 1329
284 Ga0495591_071931 3300046458 Bacteria 896
285 Ga0495591_096882 3300046458 Bacteria 734
286 Ga0495638_0013223 3300046460 Bacteria 5630
287 Ga0495638_0014849 3300046460 Bacteria 5250
288 Ga0495638_0059733 3300046460 Bacteria 2359
289 Ga0495638_0071315 3300046460 Bacteria 2125
290 Ga0495638_0100307 3300046460 Bacteria 1732
291 Ga0495638_0119923 3300046460 Bacteria 1555
292 Ga0495638_0180073 3300046460 Bacteria 1206
293 Ga0495638_0221157 3300046460 Bacteria 1058
294 Ga0495638_0298654 3300046460 Bacteria 868
295 Ga0495638_0329207 3300046460 Bacteria 813
296 Ga0495653_0023327 3300046463 Bacteria 5001
297 Ga0495653_0164929 3300046463 Bacteria 1534
298 Ga0495653_0253930 3300046463 Bacteria 1165
299 Ga0495650_0067667 3300046471 Bacteria 1410
300 Ga0495650_0083490 3300046471 Bacteria 1227
301 Ga0495650_0103022 3300046471 Bacteria 1069
302 Ga0495650_0125100 3300046471 Bacteria 943
303 Ga0495580_0463609 3300046472 Bacteria 849
304 Ga0495582_0074671 3300046473 Bacteria 1877
305 Ga0495605_0007965 3300046474 Bacteria 5997
306 Ga0495605_0011446 3300046474 Bacteria 4943
307 Ga0495605_0020879 3300046474 Bacteria 3475
308 Ga0495605_0052211 3300046474 Bacteria 1987
309 Ga0495605_0078014 3300046474 Bacteria 1553
310 Ga0495605_0141006 3300046474 Bacteria 1081
311 Ga0495605_0184252 3300046474 Bacteria 916
312 Ga0495639_0004268 3300046475 Bacteria 6130
313 Ga0495584_0006060 3300046491 Bacteria 6365
314 Ga0495584_0007118 3300046491 Bacteria 5844
315 Ga0495584_0008338 3300046491 Bacteria 5366
316 Ga0495584_0009872 3300046491 Bacteria 4909
317 Ga0495584_0022115 3300046491 Bacteria 3227
318 Ga0495584_0030727 3300046491 Bacteria 2720
319 Ga0495584_0042771 3300046491 Bacteria 2286
320 Ga0495584_0068237 3300046491 Bacteria 1786
321 Ga0495584_0081361 3300046491 Bacteria 1630
322 Ga0495584_0175717 3300046491 Bacteria 1088
323 Ga0495584_0239016 3300046491 Bacteria 923
324 Ga0495584_0296501 3300046491 Bacteria 821
325 Ga0495584_0304525 3300046491 Bacteria 809
326 Ga0495585_0003579 3300046492 Bacteria 10426
327 Ga0495585_0010630 3300046492 Bacteria 5469
328 Ga0495585_0013653 3300046492 Bacteria 4749
329 Ga0495585_0021589 3300046492 Bacteria 3696
330 Ga0495585_0046523 3300046492 Bacteria 2419
331 Ga0495585_0062605 3300046492 Bacteria 2043
332 Ga0495585_0072148 3300046492 Bacteria 1881
333 Ga0495585_0162351 3300046492 Bacteria 1158
334 Ga0495585_0213249 3300046492 Bacteria 977
335 Ga0495585_0226729 3300046492 Bacteria 940
336 Ga0495585_0234259 3300046492 Bacteria 921
337 Ga0495585_0244930 3300046492 Bacteria 896
338 Ga0495585_0259643 3300046492 Bacteria 864
339 Ga0495594_0170937 3300046499 Bacteria 1236
340 Ga0495594_0179148 3300046499 Bacteria 1206
341 Ga0495594_0209445 3300046499 Bacteria 1111
342 Ga0495596_0040999 3300046500 Bacteria 1826
343 Ga0495607_0002157 3300046501 Bacteria 16392
344 Ga0495607_0014498 3300046501 Bacteria 5124
345 Ga0495607_0037921 3300046501 Bacteria 2890
346 Ga0495607_0042695 3300046501 Bacteria 2686
347 Ga0495607_0044290 3300046501 Bacteria 2624
348 Ga0495607_0047590 3300046501 Bacteria 2512
349 Ga0495607_0075001 3300046501 Bacteria 1875
350 Ga0495607_0106841 3300046501 Bacteria 1489
351 Ga0495607_0116585 3300046501 Bacteria 1408
352 Ga0495607_0119397 3300046501 Bacteria 1386
353 Ga0495607_0143521 3300046501 Bacteria 1229
354 Ga0495607_0201279 3300046501 Bacteria 985
355 Ga0495583_0001393 3300046506 Bacteria 24724
356 Ga0495583_0013707 3300046506 Bacteria 4502
357 Ga0495583_0043116 3300046506 Bacteria 2102
358 Ga0495583_0062398 3300046506 Bacteria 1659
359 Ga0495583_0100157 3300046506 Bacteria 1237
360 Ga0495583_0160502 3300046506 Bacteria 927
361 Ga0495606_0005050 3300046507 Bacteria 12846
362 Ga0495606_0018894 3300046507 Bacteria 5152
363 Ga0495606_0028623 3300046507 Bacteria 3926
364 Ga0495606_0031306 3300046507 Bacteria 3701
365 Ga0495606_0057752 3300046507 Bacteria 2497
366 Ga0495606_0080688 3300046507 Bacteria 2023
367 Ga0495606_0215298 3300046507 Bacteria 1085
368 Ga0495606_0278504 3300046507 Bacteria 915
369 Ga0495610_0008647 3300046512 Bacteria 6560
370 Ga0495610_0010004 3300046512 Bacteria 5927
371 Ga0495610_0020580 3300046512 Bacteria 3660
372 Ga0495610_0030034 3300046512 Bacteria 2853
373 Ga0495610_0035979 3300046512 Bacteria 2535
374 Ga0495610_0050298 3300046512 Bacteria 2035
375 Ga0495610_0072304 3300046512 Bacteria 1605
376 Ga0495610_0074998 3300046512 Bacteria 1567
377 Ga0495610_0089080 3300046512 Bacteria 1401
378 Ga0495610_0145186 3300046512 Bacteria 1017
379 Ga0495610_0175848 3300046512 Bacteria 894
380 Ga0495610_0225942 3300046512 Bacteria 753
381 Ga0495616_0009022 3300046513 Bacteria 5854
382 Ga0495616_0012143 3300046513 Bacteria 4901
383 Ga0495616_0018650 3300046513 Bacteria 3803
384 Ga0495616_0055476 3300046513 Bacteria 1961
385 Ga0495616_0058479 3300046513 Bacteria 1898
386 Ga0495616_0064492 3300046513 Bacteria 1787
387 Ga0495616_0090787 3300046513 Bacteria 1446
388 Ga0495616_0101532 3300046513 Bacteria 1348
389 Ga0495616_0164297 3300046513 Bacteria 996
390 Ga0495620_0031208 3300046515 Bacteria 2443
391 Ga0495620_0038963 3300046515 Bacteria 2105
392 Ga0495620_0046228 3300046515 Bacteria 1880
393 Ga0495620_0049167 3300046515 Bacteria 1806
394 Ga0495620_0051392 3300046515 Bacteria 1754
395 Ga0495620_0064621 3300046515 Bacteria 1512
396 Ga0495620_0133660 3300046515 Bacteria 972
397 Ga0495630_0031883 3300046517 Bacteria 3925
398 Ga0495630_0193324 3300046517 Bacteria 1552
399 Ga0495630_0486215 3300046517 Bacteria 946
400 Ga0495631_0000754 3300046518 Bacteria 20744
401 Ga0495631_0010343 3300046518 Bacteria 4617
402 Ga0495631_0071142 3300046518 Bacteria 1503
403 Ga0495631_0173100 3300046518 Bacteria 925
404 Ga0495631_0184483 3300046518 Bacteria 893
405 Ga0495632_0007597 3300046519 Bacteria 6781
406 Ga0495632_0010368 3300046519 Bacteria 5524
407 Ga0495632_0049407 3300046519 Bacteria 2079
408 Ga0495632_0051847 3300046519 Bacteria 2018
409 Ga0495632_0052885 3300046519 Bacteria 1995
410 Ga0495632_0073532 3300046519 Bacteria 1638
411 Ga0495632_0080346 3300046519 Bacteria 1555
412 Ga0495632_0083425 3300046519 Bacteria 1521
413 Ga0495632_0084367 3300046519 Bacteria 1512
414 Ga0495632_0152668 3300046519 Bacteria 1067
415 Ga0495632_0156203 3300046519 Bacteria 1052
416 Ga0495632_0179734 3300046519 Bacteria 969
417 Ga0495632_0190604 3300046519 Bacteria 936
418 Ga0495637_0003859 3300046520 Bacteria 7864
419 Ga0495637_0007516 3300046520 Bacteria 5394
420 Ga0495637_0016909 3300046520 Bacteria 3405
421 Ga0495637_0039784 3300046520 Bacteria 2026
422 Ga0495637_0040335 3300046520 Bacteria 2010
423 Ga0495637_0046085 3300046520 Bacteria 1845
424 Ga0495637_0050093 3300046520 Bacteria 1752
425 Ga0495637_0074810 3300046520 Bacteria 1359
426 Ga0495637_0097373 3300046520 Bacteria 1153
427 Ga0495637_0147260 3300046520 Bacteria 890
428 Ga0495643_0005058 3300046522 Bacteria 9024
429 Ga0495643_0012777 3300046522 Bacteria 5052
430 Ga0495643_0046236 3300046522 Bacteria 2360
431 Ga0495643_0131958 3300046522 Bacteria 1253
432 Ga0495643_0214160 3300046522 Bacteria 917
433 Ga0495643_0227847 3300046522 Bacteria 880
434 Ga0495643_0241408 3300046522 Bacteria 847
435 Ga0495644_0000097 3300046523 Bacteria 42303
436 Ga0495644_0006183 3300046523 Bacteria 4655
437 Ga0495644_0013062 3300046523 Bacteria 3191
438 Ga0495644_0077843 3300046523 Bacteria 1249
439 Ga0495644_0136463 3300046523 Bacteria 936
440 Ga0495644_0188257 3300046523 Bacteria 794
441 Ga0495648_0030916 3300046524 Bacteria 3533
442 Ga0495648_0055404 3300046524 Bacteria 2390
443 Ga0495648_0074653 3300046524 Bacteria 1952
444 Ga0495648_0081421 3300046524 Bacteria 1841
445 Ga0495648_0081483 3300046524 Bacteria 1840
446 Ga0495648_0096400 3300046524 Bacteria 1643
447 Ga0495648_0104047 3300046524 Bacteria 1559
448 Ga0495648_0192551 3300046524 Bacteria 1027
449 Ga0495648_0211401 3300046524 Bacteria 963
450 Ga0495648_0215555 3300046524 Bacteria 950
451 Ga0495648_0281202 3300046524 Bacteria 788
452 Ga0495666_0005267 3300046526 Bacteria 6524
453 Ga0495666_0020772 3300046526 Bacteria 3251
454 Ga0495666_0086194 3300046526 Bacteria 1483
455 Ga0495666_0093575 3300046526 Bacteria 1417
456 Ga0495642_0001788 3300046528 Bacteria 9256
457 Ga0495642_0014939 3300046528 Bacteria 3013
458 Ga0495642_0180137 3300046528 Bacteria 919
459 Ga0495654_0001434 3300046530 Bacteria 16403
460 Ga0495654_0007816 3300046530 Bacteria 5944
461 Ga0495654_0020523 3300046530 Bacteria 3441
462 Ga0495654_0022584 3300046530 Bacteria 3264
463 Ga0495654_0025307 3300046530 Bacteria 3058
464 Ga0495654_0026732 3300046530 Bacteria 2964
465 Ga0495654_0026755 3300046530 Bacteria 2962
466 Ga0495654_0053418 3300046530 Bacteria 1963
467 Ga0495654_0060500 3300046530 Bacteria 1820
468 Ga0495654_0080175 3300046530 Bacteria 1532
469 Ga0495654_0101056 3300046530 Bacteria 1327
470 Ga0495654_0108968 3300046530 Bacteria 1265
471 Ga0495654_0111267 3300046530 Bacteria 1249
472 Ga0495654_0114262 3300046530 Bacteria 1228
473 Ga0495654_0131651 3300046530 Bacteria 1122
474 Ga0495654_0133829 3300046530 Bacteria 1110
475 Ga0495654_0144213 3300046530 Bacteria 1058
476 Ga0495587_0062061 3300046536 Bacteria 2189
477 Ga0495587_0083736 3300046536 Bacteria 1847
478 Ga0495609_0008191 3300046538 Bacteria 5131
479 Ga0495609_0009151 3300046538 Bacteria 4805
480 Ga0495609_0068342 3300046538 Bacteria 1563
481 Ga0495609_0092982 3300046538 Bacteria 1310
482 Ga0495609_0095417 3300046538 Bacteria 1291
483 Ga0495609_0149800 3300046538 Bacteria 992
484 Ga0495609_0170145 3300046538 Bacteria 920
485 Ga0495597_0017168 3300046542 Bacteria 3411
486 Ga0495597_0018402 3300046542 Bacteria 3278
487 Ga0495597_0045110 3300046542 Bacteria 1957
488 Ga0495597_0100286 3300046542 Bacteria 1221
489 Ga0495597_0108810 3300046542 Bacteria 1163
490 Ga0495597_0169010 3300046542 Bacteria 888
491 Ga0495597_0184167 3300046542 Bacteria 842
492 Ga0495622_0010392 3300046557 Bacteria 4301
493 Ga0495622_0055244 3300046557 Bacteria 1841
494 Ga0495622_0056839 3300046557 Bacteria 1814
495 Ga0495633_0008011 3300046558 Bacteria 6018
496 Ga0495633_0111937 3300046558 Bacteria 1265
497 Ga0495633_0211844 3300046558 Bacteria 888
498 Ga0495656_0048326 3300046615 Bacteria 1807
499 Ga0495656_0115800 3300046615 Bacteria 1259
500 Ga0495656_0259189 3300046615 Bacteria 880
501 Ga0495668_0019353 3300046616 Bacteria 3925
502 Ga0495668_0066542 3300046616 Bacteria 1982
503 Ga0495668_0081241 3300046616 Bacteria 1778
504 Ga0495668_0130010 3300046616 Bacteria 1378
505 Ga0495668_0195981 3300046616 Bacteria 1106
506 Ga0495634_0062767 3300046642 Bacteria 2466
507 Ga0495634_0214921 3300046642 Bacteria 1189
508 Ga0495611_0008345 3300046648 Bacteria 4385
509 Ga0495611_0035884 3300046648 Bacteria 2198
510 Ga0495611_0151764 3300046648 Bacteria 1081
511 Ga0495611_0160020 3300046648 Bacteria 1052
512 Ga0495611_0175131 3300046648 Bacteria 1002
513 Ga0495611_0196057 3300046648 Bacteria 942
514 Ga0495625_0078866 3300046660 Bacteria 2298
515 Ga0495625_0079472 3300046660 Bacteria 2286
516 Ga0495625_0109403 3300046660 Bacteria 1890
517 Ga0495625_0121869 3300046660 Bacteria 1773
518 Ga0495625_0133435 3300046660 Bacteria 1680
519 Ga0495625_0140328 3300046660 Bacteria 1630
520 Ga0495625_0221218 3300046660 Bacteria 1240
521 Ga0495625_0266684 3300046660 Bacteria 1106
522 Ga0495625_0355055 3300046660 Bacteria 925
523 Ga0495635_0074258 3300046663 Bacteria 2329
524 Ga0495659_0001826 3300046664 Bacteria 7062
525 Ga0495659_0026319 3300046664 Bacteria 1998
526 Ga0495659_0191746 3300046664 Bacteria 835
527 Ga0495661_0002150 3300046665 Bacteria 15433
528 Ga0495661_0058382 3300046665 Bacteria 2300
529 Ga0495661_0089955 3300046665 Bacteria 1748
530 Ga0495661_0116340 3300046665 Bacteria 1483
531 Ga0495661_0151674 3300046665 Bacteria 1251
532 Ga0495661_0187413 3300046665 Bacteria 1092
533 Ga0495661_0209570 3300046665 Bacteria 1015
534 Ga0495661_0210242 3300046665 Bacteria 1013
535 Ga0495661_0279254 3300046665 Bacteria 842
536 Ga0495588_0065526 3300046674 Bacteria 1884
537 Ga0495588_0165477 3300046674 Bacteria 1169
538 Ga0495588_0198263 3300046674 Bacteria 1060
539 Ga0495657_0221931 3300046675 Bacteria 1145
540 Ga0495623_0242471 3300046679 Bacteria 1017
541 Ga0495646_0048827 3300046680 Bacteria 2569
542 Ga0495646_0076035 3300046680 Bacteria 1967
543 Ga0495646_0302672 3300046680 Bacteria 845
544 Ga0495646_0379219 3300046680 Bacteria 737
545 Ga0495669_0004597 3300046684 Bacteria 5717
546 Ga0495669_0185313 3300046684 Bacteria 992
547 Ga0495613_0002298 3300046689 Bacteria 14476
548 Ga0495613_0155817 3300046689 Bacteria 1627
549 Ga0495624_0020980 3300046690 Bacteria 4337
550 Ga0495670_0007581 3300046691 Bacteria 5334
551 Ga0495670_0008881 3300046691 Bacteria 4945
552 Ga0495670_0044941 3300046691 Bacteria 2205
553 Ga0495670_0089260 3300046691 Bacteria 1576
554 Ga0495670_0096287 3300046691 Bacteria 1519
555 Ga0495670_0107734 3300046691 Bacteria 1440
556 Ga0495670_0133414 3300046691 Bacteria 1295
557 Ga0495670_0158239 3300046691 Bacteria 1189
558 Ga0495670_0205983 3300046691 Bacteria 1042
559 Ga0495670_0275571 3300046691 Bacteria 899
560 Ga0495670_0347154 3300046691 Bacteria 798
561 Ga0495671_0002344 3300046692 Bacteria 12025
562 Ga0495671_0003790 3300046692 Bacteria 9193
563 Ga0495671_0010797 3300046692 Bacteria 5048
564 Ga0495671_0011331 3300046692 Bacteria 4913
565 Ga0495671_0018092 3300046692 Bacteria 3746
566 Ga0495671_0022388 3300046692 Bacteria 3312
567 Ga0495671_0039923 3300046692 Bacteria 2368
568 Ga0495671_0044591 3300046692 Bacteria 2222
569 Ga0495671_0060836 3300046692 Bacteria 1864
570 Ga0495671_0061420 3300046692 Bacteria 1853
571 Ga0495671_0069695 3300046692 Bacteria 1728
572 Ga0495671_0114605 3300046692 Bacteria 1316
573 Ga0495671_0153297 3300046692 Bacteria 1121
574 Ga0495671_0157248 3300046692 Bacteria 1106
575 Ga0495671_0213265 3300046692 Bacteria 935
576 Ga0495671_0315139 3300046692 Bacteria 751
577 Ga0495649_0001677 3300046694 Bacteria 16452
578 Ga0495649_0009271 3300046694 Bacteria 5862
579 Ga0495649_0024640 3300046694 Bacteria 3354
580 Ga0495649_0028158 3300046694 Bacteria 3114
581 Ga0495649_0028539 3300046694 Bacteria 3092
582 Ga0495649_0035293 3300046694 Bacteria 2750
583 Ga0495649_0056863 3300046694 Bacteria 2110
584 Ga0495649_0062158 3300046694 Bacteria 2008
585 Ga0495649_0068056 3300046694 Bacteria 1910
586 Ga0495649_0110690 3300046694 Bacteria 1456
587 Ga0495649_0136130 3300046694 Bacteria 1294
588 Ga0495649_0142778 3300046694 Bacteria 1259
589 Ga0495649_0152063 3300046694 Bacteria 1215
590 Ga0495649_0159798 3300046694 Bacteria 1181
591 Ga0495649_0203248 3300046694 Bacteria 1028
592 Ga0495649_0205263 3300046694 Bacteria 1022
593 Ga0495649_0216047 3300046694 Bacteria 992
594 Ga0495649_0237758 3300046694 Bacteria 938
595 Ga0495589_0000787 3300046794 Bacteria 20118
596 Ga0495589_0007762 3300046794 Bacteria 5615
597 Ga0495589_0009612 3300046794 Bacteria 5028
598 Ga0495589_0010382 3300046794 Bacteria 4838
599 Ga0495589_0035604 3300046794 Bacteria 2495
600 Ga0495589_0067862 3300046794 Bacteria 1745
601 Ga0495589_0099275 3300046794 Bacteria 1409
602 Ga0495589_0164681 3300046794 Bacteria 1055
603 Ga0495589_0182930 3300046794 Bacteria 993
604 Ga0495600_0009362 3300046809 Bacteria 6051
605 Ga0495600_0153606 3300046809 Bacteria 1489
606 Ga0495600_0268015 3300046809 Bacteria 1084
607 Ga0495660_0010750 3300046810 Bacteria 5318
608 Ga0495660_0023828 3300046810 Bacteria 3489
609 Ga0495660_0053727 3300046810 Bacteria 2185
610 Ga0495660_0068231 3300046810 Bacteria 1892
611 Ga0495660_0068615 3300046810 Bacteria 1886
612 Ga0495660_0069008 3300046810 Bacteria 1879
613 Ga0495660_0069469 3300046810 Bacteria 1872
614 Ga0495660_0074117 3300046810 Bacteria 1798
615 Ga0495660_0091538 3300046810 Bacteria 1579
616 Ga0495660_0107743 3300046810 Bacteria 1425
617 Ga0495660_0113007 3300046810 Bacteria 1383
618 Ga0495660_0122528 3300046810 Bacteria 1313
619 Ga0495660_0146185 3300046810 Bacteria 1171
620 Ga0495604_0228203 3300047317 Bacteria 1278
621 Ga0495604_0234841 3300047317 Bacteria 1256
622 Ga0495674_0068381 3300047319 Bacteria 3074
623 Ga0495672_0005176 3300047320 Bacteria 10408
624 Ga0495672_0019837 3300047320 Bacteria 4422
625 Ga0495672_0020810 3300047320 Bacteria 4290
626 Ga0495672_0031642 3300047320 Bacteria 3301
627 Ga0495672_0057280 3300047320 Bacteria 2264
628 Ga0495672_0058639 3300047320 Bacteria 2230
629 Ga0495672_0077342 3300047320 Bacteria 1865
630 Ga0495672_0083405 3300047320 Bacteria 1775
631 Ga0495672_0090097 3300047320 Bacteria 1686
632 Ga0495672_0105834 3300047320 Bacteria 1517
633 Ga0495672_0127487 3300047320 Bacteria 1343
634 Ga0495672_0179440 3300047320 Bacteria 1073
635 Ga0495672_0280501 3300047320 Bacteria 796
636 Ga0495676_0042823 3300047321 Bacteria 3712
637 Ga0495680_0020349 3300047322 Bacteria 5584
638 Ga0495680_0193874 3300047322 Bacteria 1460
639 Ga0495680_0211920 3300047322 Bacteria 1386
640 Ga0495680_0282510 3300047322 Bacteria 1169
641 Ga0495680_0403957 3300047322 Bacteria 943
642 Ga0495683_0001412 3300047323 Bacteria 15851
643 Ga0495683_0003997 3300047323 Bacteria 8476
644 Ga0495683_0048318 3300047323 Bacteria 2133
645 Ga0495683_0091259 3300047323 Bacteria 1475
646 Ga0495683_0114543 3300047323 Bacteria 1284
647 Ga0495683_0151187 3300047323 Bacteria 1080
648 Ga0495683_0193644 3300047323 Bacteria 921
649 Ga0495683_0210352 3300047323 Bacteria 872
650 Ga0495687_008551 3300047443 Bacteria 5848
651 Ga0495687_045196 3300047443 Bacteria 1908
652 Ga0495687_046930 3300047443 Bacteria 1861
653 Ga0495687_125108 3300047443 Bacteria 920
654 Ga0495675_0298485 3300047444 Bacteria 957
655 Ga0495677_0020676 3300047445 Bacteria 2385
656 Ga0495679_005216 3300047446 Bacteria 5803
657 Ga0495679_067994 3300047446 Bacteria 1031
658 Ga0495685_114732 3300047447 Bacteria 885
659 Ga0495673_0000658 3300047469 Bacteria 33990
660 Ga0495673_0003471 3300047469 Bacteria 10370
661 Ga0495673_0029459 3300047469 Bacteria 2590
662 Ga0495673_0032148 3300047469 Bacteria 2450
663 Ga0495673_0035849 3300047469 Bacteria 2281
664 Ga0495673_0037690 3300047469 Bacteria 2205
665 Ga0495673_0038264 3300047469 Bacteria 2184
666 Ga0495673_0041672 3300047469 Bacteria 2065
667 Ga0495673_0063649 3300047469 Bacteria 1571
668 Ga0495673_0076684 3300047469 Bacteria 1393
669 Ga0495673_0093841 3300047469 Bacteria 1222
670 Ga0495673_0125560 3300047469 Bacteria 1012
671 Ga0495673_0137593 3300047469 Bacteria 954
672 Ga0495673_0144265 3300047469 Bacteria 925
673 Ga0495673_0144773 3300047469 Bacteria 923
674 Ga0495673_0178473 3300047469 Bacteria 805
675 Ga0495681_0004848 3300047470 Bacteria 9098
676 Ga0495681_0007259 3300047470 Bacteria 7122
677 Ga0495681_0015297 3300047470 Bacteria 4347
678 Ga0495681_0032483 3300047470 Bacteria 2626
679 Ga0495681_0047054 3300047470 Bacteria 2053
680 Ga0495681_0050882 3300047470 Bacteria 1950
681 Ga0495681_0057421 3300047470 Bacteria 1808
682 Ga0495681_0061567 3300047470 Bacteria 1728
683 Ga0495681_0073459 3300047470 Bacteria 1544
684 Ga0495681_0075452 3300047470 Bacteria 1517
685 Ga0495681_0094126 3300047470 Bacteria 1318
686 Ga0495681_0111418 3300047470 Bacteria 1184
687 Ga0495681_0152527 3300047470 Bacteria 968
688 Ga0495681_0164786 3300047470 Bacteria 921
689 Ga0495681_0164860 3300047470 Bacteria 920
690 Ga0495684_0118982 3300047471 Bacteria 1990
691 Ga0495684_0371000 3300047471 Bacteria 1011
692 Ga0495686_0017880 3300047472 Bacteria 4766
693 Ga0495686_0027499 3300047472 Bacteria 3712
694 Ga0495686_0128235 3300047472 Bacteria 1506
695 Ga0495686_0164610 3300047472 Bacteria 1293
696 Ga0495686_0175716 3300047472 Bacteria 1243
697 Ga0495686_0176717 3300047472 Bacteria 1239
698 Ga0495593_0016946 3300047673 Bacteria 4099
699 Ga0495593_0033389 3300047673 Bacteria 2802
700 Ga0495593_0043589 3300047673 Bacteria 2403
701 Ga0495593_0046577 3300047673 Bacteria 2309
702 Ga0495593_0120961 3300047673 Bacteria 1332
703 Ga0495602_0042520 3300048088 Bacteria 4139
704 Ga0495626_0001427 3300048091 Bacteria 19036
705 Ga0495626_0001842 3300048091 Bacteria 15932
706 Ga0495626_0001876 3300048091 Bacteria 15724
707 Ga0495626_0007796 3300048091 Bacteria 5930
708 Ga0495626_0008142 3300048091 Bacteria 5778
709 Ga0495626_0008567 3300048091 Bacteria 5592
710 Ga0495626_0009959 3300048091 Bacteria 5106
711 Ga0495626_0047177 3300048091 Bacteria 2003
712 Ga0495626_0081799 3300048091 Bacteria 1433
713 Ga0495626_0113299 3300048091 Bacteria 1172
714 Ga0495626_0122618 3300048091 Bacteria 1115
715 Ga0495626_0132220 3300048091 Bacteria 1064
716 Ga0496102_0200586 3300048905 Bacteria 1880
717 Ga0496103_0174607 3300048906 Bacteria 1380
718 Ga0496105_0431291 3300048908 Bacteria 1042
719 Ga0496106_0145224 3300048909 Bacteria 1868
720 Ga0496111_0208709 3300048914 Bacteria 1451
721 Ga0496112_0398381 3300048915 Bacteria 1316
722 Ga0496116_0000640 3300048919 Bacteria 45686
723 Ga0496116_0027995 3300048919 Bacteria 4092
724 Ga0496116_0091684 3300048919 Bacteria 1845
725 Ga0496116_0145929 3300048919 Bacteria 1322
726 Ga0496116_0274085 3300048919 Bacteria 822
727 Ga0496117_0001555 3300048920 Bacteria 32584
728 Ga0496117_0003824 3300048920 Bacteria 17124
729 Ga0496117_0235576 3300048920 Bacteria 1008
730 Ga0496119_0264621 3300048922 Bacteria 861
731 Ga0496120_0067885 3300048923 Bacteria 1968
732 Ga0496120_0069420 3300048923 Bacteria 1940
733 Ga0496121_0003360 3300048924 Bacteria 22946
734 Ga0496121_0089893 3300048924 Bacteria 2402
735 Ga0496121_0130471 3300048924 Bacteria 1882
736 Ga0496121_0157193 3300048924 Bacteria 1667
737 Ga0496122_0052170 3300048925 Bacteria 3099
738 Ga0496122_0115944 3300048925 Bacteria 1743
739 Ga0496122_0190155 3300048925 Bacteria 1213
740 Ga0496122_0239746 3300048925 Bacteria 1023
741 Ga0496123_0022547 3300048926 Bacteria 4848
742 Ga0496123_0040682 3300048926 Bacteria 3232
743 Ga0496123_0062244 3300048926 Bacteria 2392
744 Ga0496123_0093500 3300048926 Bacteria 1775
745 Ga0496124_0005034 3300048927 Bacteria 15106
746 Ga0496124_0039561 3300048927 Bacteria 4086
747 Ga0496124_0077104 3300048927 Bacteria 2749
748 Ga0496124_0081808 3300048927 Bacteria 2652
749 Ga0496124_0226335 3300048927 Bacteria 1402
750 Ga0496124_0227733 3300048927 Bacteria 1396
751 Ga0496125_0004817 3300048928 Bacteria 15339
752 Ga0496125_0004927 3300048928 Bacteria 15113
753 Ga0496125_0191809 3300048928 Bacteria 1348
754 Ga0496125_0370750 3300048928 Bacteria 847
755 Ga0496126_0094445 3300048929 Bacteria 2624
756 Ga0495678_007396 3300049459 Bacteria 5697
757 Ga0495678_012114 3300049459 Bacteria 4096
758 Ga0495678_013512 3300049459 Bacteria 3831
759 Ga0495678_039581 3300049459 Bacteria 1900
760 Ga0495678_045153 3300049459 Bacteria 1739
761 Ga0495678_047570 3300049459 Bacteria 1678
762 Ga0495678_061389 3300049459 Bacteria 1410
763 Ga0495678_061976 3300049459 Bacteria 1401
764 Ga0495678_076960 3300049459 Bacteria 1207
765 Ga0495678_081495 3300049459 Bacteria 1160
766 Ga0495678_141949 3300049459 Bacteria 785
767 Ga0495682_0000120 3300049460 Bacteria 68718
768 Ga0495682_0009354 3300049460 Bacteria 3825
769 Ga0495682_0019109 3300049460 Bacteria 2578
770 Ga0495682_0034489 3300049460 Bacteria 1865
771 Ga0495682_0042119 3300049460 Bacteria 1673
772 Ga0495682_0089120 3300049460 Bacteria 1108
773 Ga0495682_0114912 3300049460 Bacteria 964
774 Ga0495682_0130311 3300049460 Bacteria 899
775 Ga0495682_0132715 3300049460 Bacteria 890
776 Ga0495682_0145352 3300049460 Bacteria 846
777 Ga0501037_0140801 3300049573 Bacteria 1726
778 Ga0501241_000699 3300049758 Bacteria 7242
779 Ga0501226_000003 3300049853 Bacteria 358977
780 nmdc:mga03683_234206_c1 3300050489 Bacteria 850
781 nmdc:mga03683_35162_c1 3300050489 Bacteria 2031
782 nmdc:mga00v17_293034_c1 3300050491 Bacteria 1057
783 nmdc:mga00v17_372274_c1 3300050491 Bacteria 929
784 nmdc:mga08x19_184893_c1 3300050514 Bacteria 1424
785 nmdc:mga0sz30_141131_c1 3300050516 Bacteria 1064
786 Ga0500572_043012 3300053111 Bacteria 1318
787 Ga0500618_000733 3300053125 Bacteria 18747
788 Ga0500577_0120528 3300053142 Bacteria 1091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10245357 Ga0105249_102453572 202
2 3300041411 Ga0439466_0042300 Ga0439466_0042300_25_642 202
3 3300042013 Ga0439456_058634 Ga0439456_058634_211_828 202
4 3300013104 Ga0157370_10056938 Ga0157370_100569382 204
5 3300013105 Ga0157369_10293458 Ga0157369_102934582 204
6 3300042016 Ga0439463_058597 Ga0439463_058597_32_673 208
7 3300046520 Ga0495637_0097373 Ga0495637_0097373_32_658 208
8 3300046694 Ga0495649_0203248 Ga0495649_0203248_327_1004 210
9 3300047320 Ga0495672_0090097 Ga0495672_0090097_78_755 210
10 3300041997 Ga0439431_0068002 Ga0439431_0068002_118_801 215
11 3300049853 Ga0501226_000003 Ga0501226_000003_320433_321098 215
12 3300006946 Ga0079104_1008164 Ga0079104_10081645 217
13 3300027111 Ga0209281_1013449 Ga0209281_10134494 217
14 3300006177 Ga0075362_10214533 Ga0075362_102145332 218
15 3300046515 Ga0495620_0051392 Ga0495620_0051392_175_852 218
16 3300050489 nmdc:mga03683_35162_c1 nmdc:mga03683_35162_c1_794_1471 218
17 3300013100 Ga0157373_10305191 Ga0157373_103051911 219
18 3300046492 Ga0495585_0162351 Ga0495585_0162351_182_859 219
19 3300046524 Ga0495648_0055404 Ga0495648_0055404_43_732 219
20 3300053125 Ga0500618_000733 Ga0500618_000733_2918_3589 219
21 iso_pu_bacteria 2511231007 2511274901 220
22 iso_pu_bacteria 2511231017 2511333646 220
23 iso_pu_bacteria 2511231156 2511825988 220
24 iso_pu_bacteria 2623620446 2624493296 220
25 iso_pu_bacteria 2643221633 2644188786 220
26 iso_pu_bacteria 2738543004 2739201423 220
27 iso_pu_bacteria 2919697872 2919699429 220
28 iso_pu_bacteria 8019775933 8019776299 220
29 iso_pu_bacteria 8056177738 8056183652 220
30 iso_pu_bacteria 2511231004 2511257361 221
31 iso_pu_bacteria 2511231006 2511263337 221
32 iso_pu_bacteria 2511231008 2511277214 221
33 iso_pu_bacteria 2511231010 2511293111 221
34 iso_pu_bacteria 2511231011 2511298432 221
35 iso_pu_bacteria 2511231012 2511301444 221
36 iso_pu_bacteria 2511231014 2511314190 221
37 iso_pu_bacteria 2511231015 2511320866 221
38 iso_pu_bacteria 2511231016 2511324685 221
39 iso_pu_bacteria 2511231020 2511350685 221
40 iso_pu_bacteria 2511231022 2511363857 221
41 iso_pu_bacteria 2511231023 2511369372 221
42 iso_pu_bacteria 2511231031 2511415002 221
43 iso_pu_bacteria 2512047018 2512326924 221
44 iso_pu_bacteria 2554235341 2555668908 221
45 iso_pu_bacteria 2582580891 2583793530 221
46 iso_pu_bacteria 2597489887 2597857112 221
47 iso_pu_bacteria 2599185160 2599357280 221
48 iso_pu_bacteria 2599185161 2599361908 221
49 iso_pu_bacteria 2599185162 2599368229 221
50 iso_pu_bacteria 2599185163 2599375018 221
51 iso_pu_bacteria 2599185164 2599382385 221
52 iso_pu_bacteria 2599185165 2599388832 221
53 iso_pu_bacteria 2599185166 2599393876 221
54 iso_pu_bacteria 2599185168 2599405641 221
55 iso_pu_bacteria 2599185181 2599464219 221
56 iso_pu_bacteria 2599185182 2599468515 221
57 iso_pu_bacteria 2599185185 2599484134 221
58 iso_pu_bacteria 2599185186 2599493238 221
59 iso_pu_bacteria 2599185212 2599611455 221
60 iso_pu_bacteria 2599185248 2599770434 221
61 iso_pu_bacteria 2599185257 2599801785 221
62 iso_pu_bacteria 2599185289 2599889553 221
63 iso_pu_bacteria 2599185291 2599901081 221
64 iso_pu_bacteria 2599185302 2599941659 221
65 iso_pu_bacteria 2599185304 2599952821 221
66 iso_pu_bacteria 2599185305 2599963141 221
67 iso_pu_bacteria 2599185306 2599969094 221
68 iso_pu_bacteria 2599185308 2599980311 221
69 iso_pu_bacteria 2599185309 2599981828 221
70 iso_pu_bacteria 2599185310 2599987737 221
71 iso_pu_bacteria 2599185311 2599995228 221
72 iso_pu_bacteria 2599185312 2599998371 221
73 iso_pu_bacteria 2599185313 2600005563 221
74 iso_pu_bacteria 2599185314 2600014122 221
75 iso_pu_bacteria 2599185315 2600019968 221
76 iso_pu_bacteria 2599185316 2600022443 221
77 iso_pu_bacteria 2599185318 2600034235 221
78 iso_pu_bacteria 2599185319 2600039743 221
79 iso_pu_bacteria 2599185320 2600046067 221
80 iso_pu_bacteria 2599185321 2600054607 221
81 iso_pu_bacteria 2599185322 2600057403 221
82 iso_pu_bacteria 2599185323 2600064581 221
83 iso_pu_bacteria 2599185324 2600072258 221
84 iso_pu_bacteria 2599185325 2600075718 221
85 iso_pu_bacteria 2599185356 2600216494 221
86 iso_pu_bacteria 2600254930 2600356828 221
87 iso_pu_bacteria 2600255313 2601776913 221
88 iso_pu_bacteria 2600255318 2601795748 221
89 iso_pu_bacteria 2603880185 2606075405 221
90 iso_pu_bacteria 2603880199 2606128268 221
91 iso_pu_bacteria 2623620443 2624479687 221
92 iso_pu_bacteria 2643221565 2643846290 221
93 iso_pu_bacteria 2643221571 2643869356 221
94 iso_pu_bacteria 2643221589 2643952811 221
95 iso_pu_bacteria 2643221602 2644022573 221
96 iso_pu_bacteria 2651869719 2652546900 221
97 iso_pu_bacteria 2667528170 2671093727 221
98 iso_pu_bacteria 2667528171 2671098547 221
99 iso_pu_bacteria 2671180172 2671768734 221
100 iso_pu_bacteria 2675903515 2678262749 221
101 iso_pu_bacteria 2713897148 2715753321 221
102 iso_pu_bacteria 2713897149 2715757955 221
103 iso_pu_bacteria 2738543015 2739259578 221
104 iso_pu_bacteria 2738543021 2739293581 221
105 iso_pu_bacteria 2738543025 2739315640 221
106 iso_pu_bacteria 2740892503 2743736532 221
107 iso_pu_bacteria 2744054620 2745009087 221
108 iso_pu_bacteria 2773857670 2774121104 221
109 iso_pu_bacteria 2773857673 2774135358 221
110 iso_pu_bacteria 2784132063 2784265398 221
111 iso_pu_bacteria 2784132072 2784314178 221
112 iso_pu_bacteria 2808606361 2808854457 221
113 iso_pu_bacteria 2808606376 2808926626 221
114 iso_pu_bacteria 2808606377 2808927618 221
115 iso_pu_bacteria 2808606378 2808934537 221
116 iso_pu_bacteria 2808606380 2808948797 221
117 iso_pu_bacteria 2808606381 2808949843 221
118 iso_pu_bacteria 2808606382 2808957900 221
119 iso_pu_bacteria 2808606383 2808962962 221
120 iso_pu_bacteria 2808606389 2808997621 221
121 iso_pu_bacteria 2808606445 2809216618 221
122 iso_pu_bacteria 2818991456 2819654454 221
123 iso_pu_bacteria 2818991464 2819703626 221
124 iso_pu_bacteria 2825651385 2825652890 221
125 iso_pu_bacteria 2842832357 2842832436 221
126 iso_pu_bacteria 2842854478 2842857461 221
127 iso_pu_bacteria 2844665904 2844669411 221
128 iso_pu_bacteria 2852657418 2852659178 221
129 iso_pu_bacteria 2860339153 2860339759 221
130 iso_pu_bacteria 2878029506 2878031694 221
131 iso_pu_bacteria 2880230671 2880232570 221
132 iso_pu_bacteria 2904518522 2904524042 221
133 iso_pu_bacteria 2904550169 2904552671 221
134 iso_pu_bacteria 2913036834 2913038724 221
135 iso_pu_bacteria 2917070673 2917072692 221
136 iso_pu_bacteria 2919063839 2919063840 221
137 iso_pu_bacteria 2919385768 2919386670 221
138 iso_pu_bacteria 2919456309 2919456847 221
139 iso_pu_bacteria 2919487758 2919493090 221
140 iso_pu_bacteria 2923153595 2923155546 221
141 iso_pu_bacteria 2923586266 2923587133 221
142 iso_pu_bacteria 2929144301 2929146177 221
143 iso_pu_bacteria 2929189879 2929193820 221
144 iso_pu_bacteria 2931369376 2931370455 221
145 iso_pu_bacteria 2931396565 2931400343 221
146 iso_pu_bacteria 2935353572 2935354855 221
147 iso_pu_bacteria 2939636861 2939639497 221
148 iso_pu_bacteria 2945961074 2945962003 221
149 iso_pu_bacteria 2946006987 2946008371 221
150 iso_pu_bacteria 2947233263 2947239080 221
151 iso_pu_bacteria 2969304461 2969306486 221
152 iso_pu_bacteria 2974289157 2974291818 221
153 iso_pu_bacteria 2984286254 2984290477 221
154 iso_pu_bacteria 2988728565 2988733702 221
155 iso_pu_bacteria 2998139840 2998141882 221
156 iso_pu_bacteria 3007511990 3007513275 221
157 iso_pu_bacteria 3007614139 3007617055 221
158 iso_pu_bacteria 3007619802 3007624917 221
159 iso_pu_bacteria 3007718800 3007721530 221
160 iso_pu_bacteria 3007855910 3007860746 221
161 iso_pu_bacteria 3007861166 3007862890 221
162 iso_pu_bacteria 637000220 637319265 221
163 iso_pu_bacteria 8015687852 8015689769 221
164 iso_pu_bacteria 8019769354 8019772853 221
165 iso_pu_bacteria 8029995093 8029998818 221
166 iso_pu_bacteria 8054285046 8054285520 221
167 iso_pu_bacteria 8055770955 8055772909 221
168 iso_pu_bacteria 8056125926 8056127804 221
169 iso_pu_bacteria 8056143049 8056145116 221
170 iso_pu_bacteria 8056148874 8056150332 221
171 iso_pu_bacteria 8056155041 8056156563 221
172 iso_pu_bacteria 8056161164 8056162224 221
173 iso_pu_bacteria 8056166840 8056169117 221
174 iso_pu_bacteria 8056172158 8056175268 221
175 iso_pu_bacteria 8056569372 8056571602 221
176 iso_pu_bacteria 8057798959 8057799333 221
177 3300046453 Ga0495627_001350 Ga0495627_001350_952_1632 222
178 3300046518 Ga0495631_0071142 Ga0495631_0071142_422_1102 222
179 3300046519 Ga0495632_0007597 Ga0495632_0007597_1187_1867 222
180 3300046530 Ga0495654_0001434 Ga0495654_0001434_12059_12739 222
181 3300047320 Ga0495672_0019837 Ga0495672_0019837_1062_1742 222
182 3300047470 Ga0495681_0164786 Ga0495681_0164786_146_826 222
183 3300006058 Ga0075432_10022319 Ga0075432_100223194 224
184 3300006058 Ga0075432_10042359 Ga0075432_100423592 224
185 3300006058 Ga0075432_10226694 Ga0075432_102266941 224
186 3300006914 Ga0075436_100413585 Ga0075436_1004135852 224
187 3300009036 Ga0105244_10042750 Ga0105244_100427502 224
188 3300015261 Ga0182006_1006820 Ga0182006_10068204 224
189 3300015262 Ga0182007_10001015 Ga0182007_100010152 224
190 3300015265 Ga0182005_1010621 Ga0182005_10106212 224
191 3300025728 Ga0207655_1003631 Ga0207655_10036319 224
192 3300027907 Ga0207428_10189314 Ga0207428_101893142 224
193 3300031911 Ga0307412_10007529 Ga0307412_100075294 224
194 3300041411 Ga0439466_0040269 Ga0439466_0040269_130_804 224
195 3300042006 Ga0439432_048289 Ga0439432_048289_59_733 224
196 3300042009 Ga0439451_014749 Ga0439451_014749_889_1563 224
197 3300042009 Ga0439451_015202 Ga0439451_015202_97_771 224
198 3300046452 Ga0495617_009100 Ga0495617_009100_2582_3256 224
199 3300046452 Ga0495617_160503 Ga0495617_160503_10_684 224
200 3300046453 Ga0495627_073396 Ga0495627_073396_241_915 224
201 3300046455 Ga0495603_0262400 Ga0495603_0262400_117_791 224
202 3300046457 Ga0495590_0003477 Ga0495590_0003477_4721_5395 224
203 3300046458 Ga0495591_096882 Ga0495591_096882_38_712 224
204 3300046460 Ga0495638_0329207 Ga0495638_0329207_73_747 224
205 3300046472 Ga0495580_0463609 Ga0495580_0463609_115_789 224
206 3300046474 Ga0495605_0011446 Ga0495605_0011446_193_867 224
207 3300046474 Ga0495605_0052211 Ga0495605_0052211_1142_1816 224
208 3300046474 Ga0495605_0078014 Ga0495605_0078014_862_1536 224
209 3300046475 Ga0495639_0004268 Ga0495639_0004268_832_1506 224
210 3300046491 Ga0495584_0068237 Ga0495584_0068237_162_836 224
211 3300046491 Ga0495584_0081361 Ga0495584_0081361_66_740 224
212 3300046491 Ga0495584_0296501 Ga0495584_0296501_124_798 224
213 3300046492 Ga0495585_0010630 Ga0495585_0010630_4599_5273 224
214 3300046499 Ga0495594_0170937 Ga0495594_0170937_410_1084 224
215 3300046501 Ga0495607_0143521 Ga0495607_0143521_377_1051 224
216 3300046506 Ga0495583_0043116 Ga0495583_0043116_22_696 224
217 3300046507 Ga0495606_0018894 Ga0495606_0018894_312_986 224
218 3300046512 Ga0495610_0050298 Ga0495610_0050298_537_1211 224
219 3300046512 Ga0495610_0089080 Ga0495610_0089080_189_863 224
220 3300046512 Ga0495610_0175848 Ga0495610_0175848_66_740 224
221 3300046515 Ga0495620_0049167 Ga0495620_0049167_936_1610 224
222 3300046517 Ga0495630_0031883 Ga0495630_0031883_98_772 224
223 3300046519 Ga0495632_0179734 Ga0495632_0179734_113_787 224
224 3300046520 Ga0495637_0039784 Ga0495637_0039784_75_749 224
225 3300046520 Ga0495637_0040335 Ga0495637_0040335_1278_1952 224
226 3300046520 Ga0495637_0147260 Ga0495637_0147260_176_850 224
227 3300046523 Ga0495644_0136463 Ga0495644_0136463_169_843 224
228 3300046526 Ga0495666_0093575 Ga0495666_0093575_155_829 224
229 3300046528 Ga0495642_0001788 Ga0495642_0001788_4721_5395 224
230 3300046530 Ga0495654_0022584 Ga0495654_0022584_2066_2740 224
231 3300046530 Ga0495654_0026755 Ga0495654_0026755_512_1186 224
232 3300046616 Ga0495668_0066542 Ga0495668_0066542_776_1450 224
233 3300046664 Ga0495659_0001826 Ga0495659_0001826_5936_6610 224
234 3300046665 Ga0495661_0089955 Ga0495661_0089955_901_1575 224
235 3300046684 Ga0495669_0185313 Ga0495669_0185313_165_839 224
236 3300046691 Ga0495670_0096287 Ga0495670_0096287_142_816 224
237 3300046691 Ga0495670_0107734 Ga0495670_0107734_646_1320 224
238 3300046692 Ga0495671_0157248 Ga0495671_0157248_159_833 224
239 3300046694 Ga0495649_0035293 Ga0495649_0035293_810_1484 224
240 3300046694 Ga0495649_0142778 Ga0495649_0142778_403_1077 224
241 3300046694 Ga0495649_0159798 Ga0495649_0159798_94_768 224
242 3300046694 Ga0495649_0205263 Ga0495649_0205263_123_797 224
243 3300046694 Ga0495649_0237758 Ga0495649_0237758_108_782 224
244 3300046794 Ga0495589_0010382 Ga0495589_0010382_150_824 224
245 3300046794 Ga0495589_0182930 Ga0495589_0182930_159_833 224
246 3300047320 Ga0495672_0005176 Ga0495672_0005176_9669_10343 224
247 3300047320 Ga0495672_0127487 Ga0495672_0127487_78_752 224
248 3300047320 Ga0495672_0179440 Ga0495672_0179440_356_1030 224
249 3300047323 Ga0495683_0151187 Ga0495683_0151187_190_864 224
250 3300047323 Ga0495683_0193644 Ga0495683_0193644_12_686 224
251 3300047443 Ga0495687_045196 Ga0495687_045196_501_1175 224
252 3300047446 Ga0495679_067994 Ga0495679_067994_131_805 224
253 3300047470 Ga0495681_0007259 Ga0495681_0007259_4950_5624 224
254 3300047470 Ga0495681_0073459 Ga0495681_0073459_664_1338 224
255 3300047470 Ga0495681_0094126 Ga0495681_0094126_132_806 224
256 3300047470 Ga0495681_0164860 Ga0495681_0164860_172_846 224
257 3300047673 Ga0495593_0043589 Ga0495593_0043589_193_867 224
258 3300047673 Ga0495593_0120961 Ga0495593_0120961_180_854 224
259 3300048091 Ga0495626_0001427 Ga0495626_0001427_14535_15209 224
260 3300048091 Ga0495626_0001876 Ga0495626_0001876_192_866 224
261 3300048091 Ga0495626_0007796 Ga0495626_0007796_4756_5430 224
262 3300048908 Ga0496105_0431291 Ga0496105_0431291_184_858 224
263 3300048909 Ga0496106_0145224 Ga0496106_0145224_1144_1818 224
264 3300048919 Ga0496116_0027995 Ga0496116_0027995_216_890 224
265 3300048919 Ga0496116_0274085 Ga0496116_0274085_108_782 224
266 3300048925 Ga0496122_0052170 Ga0496122_0052170_284_958 224
267 3300048927 Ga0496124_0226335 Ga0496124_0226335_709_1383 224
268 3300049459 Ga0495678_061976 Ga0495678_061976_166_840 224
269 3300049459 Ga0495678_141949 Ga0495678_141949_34_708 224
270 3300049460 Ga0495682_0000120 Ga0495682_0000120_3750_4424 224
271 3300049460 Ga0495682_0089120 Ga0495682_0089120_158_832 224
272 3300049460 Ga0495682_0132715 Ga0495682_0132715_194_868 224
273 3300050491 nmdc:mga00v17_293034_c1 nmdc:mga00v17_293034_c1_229_903 224
274 2124908027 MRS2a_Contig_7 MRS2a_00557890 225
275 2162886007 SwRhRL2b_contig_1954139 SwRhRL2b_0075.00005880 225
276 3300002737 JGI25162J39368_1000667 JGI25162J39368_10006676 225
277 3300002737 JGI25162J39368_1000717 JGI25162J39368_10007176 225
278 3300002771 JGI25163J39215_1000323 JGI25163J39215_10003231 225
279 3300002771 JGI25163J39215_1003173 JGI25163J39215_10031731 225
280 3300002772 JGI25164J39214_1000414 JGI25164J39214_10004146 225
281 3300002772 JGI25164J39214_1000434 JGI25164J39214_10004346 225
282 3300003214 JGI25165J46597_1000779 JGI25165J46597_10007796 225
283 3300003214 JGI25165J46597_1000834 JGI25165J46597_10008346 225
284 3300003781 Ga0055536_1019778 Ga0055536_10197781 225
285 3300003791 Ga0055530_10001093 Ga0055530_1000109315 225
286 3300003791 Ga0055530_10001673 Ga0055530_100016731 225
287 3300003791 Ga0055530_10018747 Ga0055530_100187471 225
288 3300003792 Ga0055540_1000839 Ga0055540_100083915 225
289 3300003792 Ga0055540_1000934 Ga0055540_100093414 225
290 3300003792 Ga0055540_1016471 Ga0055540_10164711 225
291 3300003794 Ga0055531_10004245 Ga0055531_100042452 225
292 3300005288 Ga0065714_10002759 Ga0065714_100027591 225
293 3300005288 Ga0065714_10005124 Ga0065714_100051241 225
294 3300005288 Ga0065714_10011720 Ga0065714_100117202 225
295 3300005288 Ga0065714_10026665 Ga0065714_100266651 225
296 3300005288 Ga0065714_10067363 Ga0065714_100673634 225
297 3300005288 Ga0065714_10071353 Ga0065714_100713533 225
298 3300005288 Ga0065714_10089809 Ga0065714_100898093 225
299 3300005288 Ga0065714_10181245 Ga0065714_101812451 225
300 3300005289 Ga0065704_10129708 Ga0065704_101297082 225
301 3300005290 Ga0065712_10002774 Ga0065712_100027748 225
302 3300005293 Ga0065715_10305746 Ga0065715_103057461 225
303 3300005353 Ga0070669_100014368 Ga0070669_1000143685 225
304 3300005548 Ga0070665_100083340 Ga0070665_1000833403 225
305 3300006051 Ga0075364_10064529 Ga0075364_100645292 225
306 3300006051 Ga0075364_10160475 Ga0075364_101604752 225
307 3300006177 Ga0075362_10149438 Ga0075362_101494382 225
308 3300006186 Ga0075369_10162197 Ga0075369_101621972 225
309 3300006914 Ga0075436_100204477 Ga0075436_1002044772 225
310 3300006946 Ga0079104_1000962 Ga0079104_10009622 225
311 3300006946 Ga0079104_1001782 Ga0079104_10017822 225
312 3300006948 Ga0099826_10016236 Ga0099826_100162362 225
313 3300009011 Ga0105251_10026046 Ga0105251_100260463 225
314 3300009011 Ga0105251_10033672 Ga0105251_100336722 225
315 3300009011 Ga0105251_10146011 Ga0105251_101460111 225
316 3300009011 Ga0105251_10148579 Ga0105251_101485792 225
317 3300009011 Ga0105251_10153202 Ga0105251_101532022 225
318 3300009011 Ga0105251_10180025 Ga0105251_101800252 225
319 3300009036 Ga0105244_10023037 Ga0105244_100230372 225
320 3300009036 Ga0105244_10080734 Ga0105244_100807341 225
321 3300009036 Ga0105244_10128711 Ga0105244_101287112 225
322 3300009036 Ga0105244_10140711 Ga0105244_101407112 225
323 3300009092 Ga0105250_10066760 Ga0105250_100667601 225
324 3300009148 Ga0105243_10000161 Ga0105243_1000016143 225
325 3300009148 Ga0105243_10241119 Ga0105243_102411192 225
326 3300011119 Ga0105246_10005198 Ga0105246_100051982 225
327 3300011119 Ga0105246_10218582 Ga0105246_102185822 225
328 3300012498 Ga0157345_1000424 Ga0157345_10004242 225
329 3300013100 Ga0157373_10030084 Ga0157373_100300843 225
330 3300013100 Ga0157373_10311170 Ga0157373_103111702 225
331 3300013102 Ga0157371_10000714 Ga0157371_100007142 225
332 3300013102 Ga0157371_10201127 Ga0157371_102011272 225
333 3300013102 Ga0157371_10227535 Ga0157371_102275352 225
334 3300013102 Ga0157371_10295259 Ga0157371_102952592 225
335 3300013102 Ga0157371_10332415 Ga0157371_103324152 225
336 3300013102 Ga0157371_10371306 Ga0157371_103713062 225
337 3300013104 Ga0157370_10021665 Ga0157370_100216652 225
338 3300013104 Ga0157370_10231763 Ga0157370_102317631 225
339 3300013104 Ga0157370_10457983 Ga0157370_104579831 225
340 3300013105 Ga0157369_10408484 Ga0157369_104084842 225
341 3300013105 Ga0157369_10523389 Ga0157369_105233892 225
342 3300013306 Ga0163162_10180066 Ga0163162_101800661 225
343 3300013306 Ga0163162_10193187 Ga0163162_101931871 225
344 3300013306 Ga0163162_10436799 Ga0163162_104367992 225
345 3300013307 Ga0157372_10356177 Ga0157372_103561772 225
346 3300014497 Ga0182008_10002147 Ga0182008_100021472 225
347 3300014497 Ga0182008_10042120 Ga0182008_100421202 225
348 3300014497 Ga0182008_10096985 Ga0182008_100969852 225
349 3300014497 Ga0182008_10145794 Ga0182008_101457941 225
350 3300014497 Ga0182008_10175292 Ga0182008_101752922 225
351 3300015261 Ga0182006_1025377 Ga0182006_10253772 225
352 3300015261 Ga0182006_1036603 Ga0182006_10366031 225
353 3300015261 Ga0182006_1038991 Ga0182006_10389912 225
354 3300015261 Ga0182006_1063279 Ga0182006_10632792 225
355 3300015261 Ga0182006_1110170 Ga0182006_11101702 225
356 3300015261 Ga0182006_1147213 Ga0182006_11472131 225
357 3300015262 Ga0182007_10017151 Ga0182007_100171512 225
358 3300015265 Ga0182005_1002471 Ga0182005_10024716 225
359 3300015265 Ga0182005_1006435 Ga0182005_10064352 225
360 3300015265 Ga0182005_1010905 Ga0182005_10109051 225
361 3300015265 Ga0182005_1022047 Ga0182005_10220472 225
362 3300017792 Ga0163161_10007942 Ga0163161_100079425 225
363 3300017792 Ga0163161_10035069 Ga0163161_100350692 225
364 3300017792 Ga0163161_10079242 Ga0163161_100792422 225
365 3300017792 Ga0163161_10714987 Ga0163161_107149871 225
366 3300025207 Ga0209760_100130 Ga0209760_10013033 225
367 3300025207 Ga0209760_100143 Ga0209760_1001436 225
368 3300025230 Ga0209563_110929 Ga0209563_1109291 225
369 3300025231 Ga0207427_100001 Ga0207427_1000011184 225
370 3300025231 Ga0207427_100008 Ga0207427_100008648 225
371 3300025233 Ga0209437_100003 Ga0209437_100003188 225
372 3300025233 Ga0209437_100014 Ga0209437_10001463 225
373 3300025261 Ga0209233_1000007 Ga0209233_10000071184 225
374 3300025261 Ga0209233_1000008 Ga0209233_100000863 225
375 3300025292 Ga0209676_1000021 Ga0209676_1000021495 225
376 3300025292 Ga0209676_1000055 Ga0209676_100005579 225
377 3300025292 Ga0209676_1000127 Ga0209676_100012758 225
378 3300025292 Ga0209676_1043467 Ga0209676_10434672 225
379 3300025292 Ga0209676_1043836 Ga0209676_10438362 225
380 3300025298 Ga0209050_1000009 Ga0209050_1000009517 225
381 3300025298 Ga0209050_1000120 Ga0209050_100012071 225
382 3300025298 Ga0209050_1000395 Ga0209050_10003956 225
383 3300025298 Ga0209050_1000972 Ga0209050_100097230 225
384 3300025303 Ga0209051_1000008 Ga0209051_1000008274 225
385 3300025303 Ga0209051_1000083 Ga0209051_1000083114 225
386 3300025303 Ga0209051_1000745 Ga0209051_10007452 225
387 3300025303 Ga0209051_1012645 Ga0209051_10126452 225
388 3300025304 Ga0209257_1000175 Ga0209257_100017525 225
389 3300025711 Ga0207696_1000025 Ga0207696_1000025134 225
390 3300025711 Ga0207696_1036046 Ga0207696_10360462 225
391 3300025728 Ga0207655_1000187 Ga0207655_100018743 225
392 3300025728 Ga0207655_1005088 Ga0207655_100508810 225
393 3300025728 Ga0207655_1008110 Ga0207655_10081103 225
394 3300025728 Ga0207655_1030061 Ga0207655_10300612 225
395 3300025728 Ga0207655_1057936 Ga0207655_10579362 225
396 3300025728 Ga0207655_1064382 Ga0207655_10643821 225
397 3300025735 Ga0207713_1000176 Ga0207713_100017651 225
398 3300025735 Ga0207713_1002544 Ga0207713_100254411 225
399 3300025735 Ga0207713_1007113 Ga0207713_10071135 225
400 3300025735 Ga0207713_1009077 Ga0207713_10090771 225
401 3300025735 Ga0207713_1092279 Ga0207713_10922792 225
402 3300025735 Ga0207713_1100289 Ga0207713_11002892 225
403 3300025933 Ga0207706_10205840 Ga0207706_102058402 225
404 3300025935 Ga0207709_10000089 Ga0207709_100000896 225
405 3300027111 Ga0209281_1000011 Ga0209281_100001162 225
406 3300027111 Ga0209281_1000090 Ga0209281_1000090108 225
407 3300027111 Ga0209281_1020874 Ga0209281_10208741 225
408 3300027111 Ga0209281_1031452 Ga0209281_10314522 225
409 3300027312 Ga0209371_1001151 Ga0209371_100115119 225
410 3300028379 Ga0268266_10152927 Ga0268266_101529272 225
411 3300028786 Ga0307517_10206971 Ga0307517_102069711 225
412 3300030500 Ga0268256_1000982 Ga0268256_100098219 225
413 3300030733 Ga0314311_1188052 Ga0314311_11880522 225
414 3300030735 Ga0316178_1156030 Ga0316178_11560303 225
415 3300030744 Ga0316181_1153579 Ga0316181_11535791 225
416 3300031507 Ga0307509_10263019 Ga0307509_102630191 225
417 3300031548 Ga0307408_100224181 Ga0307408_1002241812 225
418 3300031548 Ga0307408_100487519 Ga0307408_1004875192 225
419 3300031731 Ga0307405_10130369 Ga0307405_101303692 225
420 3300031731 Ga0307405_10480653 Ga0307405_104806532 225
421 3300031901 Ga0307406_10007496 Ga0307406_100074961 225
422 3300031901 Ga0307406_10154090 Ga0307406_101540901 225
423 3300031911 Ga0307412_10007418 Ga0307412_100074184 225
424 3300031911 Ga0307412_10074036 Ga0307412_100740361 225
425 3300032004 Ga0307414_10854014 Ga0307414_108540141 225
426 3300032005 Ga0307411_10088241 Ga0307411_100882412 225
427 3300032005 Ga0307411_10664681 Ga0307411_106646812 225
428 3300033180 Ga0307510_10172947 Ga0307510_101729471 225
429 3300041405 Ga0439438_004171 Ga0439438_004171_4761_5453 225
430 3300041405 Ga0439438_004194 Ga0439438_004194_191_868 225
431 3300041405 Ga0439438_006039 Ga0439438_006039_560_1240 225
432 3300041405 Ga0439438_006437 Ga0439438_006437_684_1364 225
433 3300041405 Ga0439438_010631 Ga0439438_010631_507_1193 225
434 3300041405 Ga0439438_015395 Ga0439438_015395_471_1163 225
435 3300041405 Ga0439438_015956 Ga0439438_015956_1359_2036 225
436 3300041405 Ga0439438_032407 Ga0439438_032407_692_1369 225
437 3300041405 Ga0439438_046787 Ga0439438_046787_199_876 225
438 3300041407 Ga0439447_002873 Ga0439447_002873_2485_3162 225
439 3300041407 Ga0439447_014799 Ga0439447_014799_492_1178 225
440 3300041407 Ga0439447_018398 Ga0439447_018398_1051_1728 225
441 3300041407 Ga0439447_028748 Ga0439447_028748_393_1070 225
442 3300041407 Ga0439447_031343 Ga0439447_031343_17_694 225
443 3300041411 Ga0439466_0001445 Ga0439466_0001445_8447_9124 225
444 3300041411 Ga0439466_0004658 Ga0439466_0004658_3824_4501 225
445 3300041411 Ga0439466_0038263 Ga0439466_0038263_770_1447 225
446 3300041411 Ga0439466_0039273 Ga0439466_0039273_160_840 225
447 3300041411 Ga0439466_0042487 Ga0439466_0042487_711_1388 225
448 3300041411 Ga0439466_0069192 Ga0439466_0069192_137_814 225
449 3300041411 Ga0439466_0074632 Ga0439466_0074632_53_739 225
450 3300041411 Ga0439466_0122037 Ga0439466_0122037_103_780 225
451 3300042006 Ga0439432_001594 Ga0439432_001594_3937_4614 225
452 3300042006 Ga0439432_010060 Ga0439432_010060_2427_3107 225
453 3300042006 Ga0439432_088132 Ga0439432_088132_126_803 225
454 3300042009 Ga0439451_001401 Ga0439451_001401_1455_2132 225
455 3300042009 Ga0439451_011452 Ga0439451_011452_967_1647 225
456 3300042009 Ga0439451_046071 Ga0439451_046071_29_715 225
457 3300042009 Ga0439451_050275 Ga0439451_050275_121_801 225
458 3300042010 Ga0439452_001423 Ga0439452_001423_1675_2352 225
459 3300042010 Ga0439452_003954 Ga0439452_003954_4178_4864 225
460 3300042010 Ga0439452_005700 Ga0439452_005700_189_869 225
461 3300042010 Ga0439452_028703 Ga0439452_028703_17_694 225
462 3300042010 Ga0439452_050859 Ga0439452_050859_191_868 225
463 3300042013 Ga0439456_001971 Ga0439456_001971_2865_3545 225
464 3300042013 Ga0439456_014276 Ga0439456_014276_192_884 225
465 3300042013 Ga0439456_024635 Ga0439456_024635_188_865 225
466 3300042016 Ga0439463_000847 Ga0439463_000847_6786_7463 225
467 3300042016 Ga0439463_013623 Ga0439463_013623_272_970 225
468 3300042016 Ga0439463_026234 Ga0439463_026234_177_857 225
469 3300042016 Ga0439463_032102 Ga0439463_032102_589_1275 225
470 3300042016 Ga0439463_037056 Ga0439463_037056_412_1104 225
471 3300042115 Ga0450911_001240 Ga0450911_001240_524_1201 225
472 3300042115 Ga0450911_002616 Ga0450911_002616_485_1165 225
473 3300042115 Ga0450911_012059 Ga0450911_012059_188_865 225
474 3300042115 Ga0450911_018878 Ga0450911_018878_73_750 225
475 3300042121 Ga0450919_005530 Ga0450919_005530_199_876 225
476 3300042124 Ga0450922_002100 Ga0450922_002100_618_1295 225
477 3300042137 Ga0450902_012213 Ga0450902_012213_155_841 225
478 3300042138 Ga0450903_008008 Ga0450903_008008_960_1637 225
479 3300042138 Ga0450903_013388 Ga0450903_013388_471_1148 225
480 3300042138 Ga0450903_024833 Ga0450903_024833_154_834 225
481 3300042139 Ga0450904_004349 Ga0450904_004349_159_851 225
482 3300042142 Ga0450905_022169 Ga0450905_022169_143_829 225
483 3300042145 Ga0450906_003943 Ga0450906_003943_511_1191 225
484 3300042145 Ga0450906_008117 Ga0450906_008117_324_1001 225
485 3300042145 Ga0450906_021077 Ga0450906_021077_142_819 225
486 3300042146 Ga0450907_000169 Ga0450907_000169_4623_5300 225
487 3300042146 Ga0450907_002704 Ga0450907_002704_1296_1973 225
488 3300042146 Ga0450907_003935 Ga0450907_003935_1450_2127 225
489 3300042147 Ga0450910_000282 Ga0450910_000282_3873_4550 225
490 3300042156 Ga0439446_0040866 Ga0439446_0040866_156_833 225
491 3300042185 Ga0450909_004555 Ga0450909_004555_1109_1786 225
492 3300042185 Ga0450909_006840 Ga0450909_006840_797_1474 225
493 3300042435 Ga0439434_0037172 Ga0439434_0037172_203_880 225
494 3300042439 Ga0439464_0126951 Ga0439464_0126951_87_764 225
495 3300042461 Ga0439460_0020929 Ga0439460_0020929_845_1522 225
496 3300042531 Ga0450918_020987 Ga0450918_020987_188_865 225
497 3300042532 Ga0450893_0034086 Ga0450893_0034086_171_848 225
498 3300042533 Ga0450901_002062 Ga0450901_002062_1381_2067 225
499 3300042993 Ga0439440_0004274 Ga0439440_0004274_531_1208 225
500 3300042993 Ga0439440_0008316 Ga0439440_0008316_172_849 225
501 3300046452 Ga0495617_000723 Ga0495617_000723_15631_16308 225
502 3300046452 Ga0495617_009513 Ga0495617_009513_2009_2686 225
503 3300046452 Ga0495617_011815 Ga0495617_011815_1289_1972 225
504 3300046452 Ga0495617_053977 Ga0495617_053977_195_872 225
505 3300046452 Ga0495617_068039 Ga0495617_068039_156_848 225
506 3300046452 Ga0495617_078245 Ga0495617_078245_361_1038 225
507 3300046452 Ga0495617_144133 Ga0495617_144133_44_721 225
508 3300046453 Ga0495627_004630 Ga0495627_004630_487_1167 225
509 3300046453 Ga0495627_037466 Ga0495627_037466_18_698 225
510 3300046453 Ga0495627_073469 Ga0495627_073469_265_954 225
511 3300046455 Ga0495603_0006846 Ga0495603_0006846_203_880 225
512 3300046455 Ga0495603_0022907 Ga0495603_0022907_1842_2522 225
513 3300046457 Ga0495590_0009747 Ga0495590_0009747_11_787 225
514 3300046457 Ga0495590_0077780 Ga0495590_0077780_125_805 225
515 3300046457 Ga0495590_0078303 Ga0495590_0078303_179_856 225
516 3300046457 Ga0495590_0107398 Ga0495590_0107398_154_831 225
517 3300046457 Ga0495590_0127606 Ga0495590_0127606_63_740 225
518 3300046457 Ga0495590_0148310 Ga0495590_0148310_138_815 225
519 3300046458 Ga0495591_000785 Ga0495591_000785_21013_21690 225
520 3300046458 Ga0495591_005029 Ga0495591_005029_115_864 225
521 3300046458 Ga0495591_009580 Ga0495591_009580_2744_3433 225
522 3300046458 Ga0495591_010532 Ga0495591_010532_2704_3393 225
523 3300046458 Ga0495591_017395 Ga0495591_017395_207_899 225
524 3300046458 Ga0495591_040425 Ga0495591_040425_582_1262 225
525 3300046458 Ga0495591_071931 Ga0495591_071931_162_839 225
526 3300046460 Ga0495638_0013223 Ga0495638_0013223_4894_5586 225
527 3300046460 Ga0495638_0014849 Ga0495638_0014849_4257_4937 225
528 3300046460 Ga0495638_0059733 Ga0495638_0059733_1586_2263 225
529 3300046460 Ga0495638_0071315 Ga0495638_0071315_452_1129 225
530 3300046460 Ga0495638_0100307 Ga0495638_0100307_165_848 225
531 3300046460 Ga0495638_0119923 Ga0495638_0119923_401_1078 225
532 3300046460 Ga0495638_0180073 Ga0495638_0180073_430_1107 225
533 3300046460 Ga0495638_0221157 Ga0495638_0221157_188_874 225
534 3300046460 Ga0495638_0298654 Ga0495638_0298654_54_731 225
535 3300046463 Ga0495653_0023327 Ga0495653_0023327_503_1180 225
536 3300046463 Ga0495653_0164929 Ga0495653_0164929_492_1184 225
537 3300046463 Ga0495653_0253930 Ga0495653_0253930_463_1143 225
538 3300046471 Ga0495650_0067667 Ga0495650_0067667_429_1205 225
539 3300046471 Ga0495650_0083490 Ga0495650_0083490_158_835 225
540 3300046471 Ga0495650_0103022 Ga0495650_0103022_65_742 225
541 3300046471 Ga0495650_0125100 Ga0495650_0125100_101_781 225
542 3300046473 Ga0495582_0074671 Ga0495582_0074671_729_1424 225
543 3300046474 Ga0495605_0007965 Ga0495605_0007965_5135_5815 225
544 3300046474 Ga0495605_0020879 Ga0495605_0020879_961_1638 225
545 3300046474 Ga0495605_0141006 Ga0495605_0141006_117_800 225
546 3300046474 Ga0495605_0184252 Ga0495605_0184252_64_741 225
547 3300046491 Ga0495584_0006060 Ga0495584_0006060_210_890 225
548 3300046491 Ga0495584_0007118 Ga0495584_0007118_160_837 225
549 3300046491 Ga0495584_0008338 Ga0495584_0008338_23_700 225
550 3300046491 Ga0495584_0009872 Ga0495584_0009872_3810_4490 225
551 3300046491 Ga0495584_0022115 Ga0495584_0022115_445_1122 225
552 3300046491 Ga0495584_0030727 Ga0495584_0030727_271_948 225
553 3300046491 Ga0495584_0042771 Ga0495584_0042771_1081_1758 225
554 3300046491 Ga0495584_0175717 Ga0495584_0175717_345_1022 225
555 3300046491 Ga0495584_0239016 Ga0495584_0239016_65_742 225
556 3300046491 Ga0495584_0304525 Ga0495584_0304525_91_792 225
557 3300046492 Ga0495585_0003579 Ga0495585_0003579_426_1103 225
558 3300046492 Ga0495585_0013653 Ga0495585_0013653_103_783 225
559 3300046492 Ga0495585_0021589 Ga0495585_0021589_157_837 225
560 3300046492 Ga0495585_0046523 Ga0495585_0046523_28_708 225
561 3300046492 Ga0495585_0062605 Ga0495585_0062605_132_809 225
562 3300046492 Ga0495585_0072148 Ga0495585_0072148_194_871 225
563 3300046492 Ga0495585_0213249 Ga0495585_0213249_192_869 225
564 3300046492 Ga0495585_0226729 Ga0495585_0226729_60_737 225
565 3300046492 Ga0495585_0234259 Ga0495585_0234259_203_880 225
566 3300046492 Ga0495585_0244930 Ga0495585_0244930_47_724 225
567 3300046492 Ga0495585_0259643 Ga0495585_0259643_34_711 225
568 3300046499 Ga0495594_0179148 Ga0495594_0179148_169_849 225
569 3300046499 Ga0495594_0209445 Ga0495594_0209445_198_875 225
570 3300046500 Ga0495596_0040999 Ga0495596_0040999_180_857 225
571 3300046501 Ga0495607_0002157 Ga0495607_0002157_65_742 225
572 3300046501 Ga0495607_0014498 Ga0495607_0014498_4051_4731 225
573 3300046501 Ga0495607_0037921 Ga0495607_0037921_1442_2119 225
574 3300046501 Ga0495607_0042695 Ga0495607_0042695_1827_2504 225
575 3300046501 Ga0495607_0044290 Ga0495607_0044290_382_1158 225
576 3300046501 Ga0495607_0047590 Ga0495607_0047590_1630_2307 225
577 3300046501 Ga0495607_0075001 Ga0495607_0075001_156_836 225
578 3300046501 Ga0495607_0106841 Ga0495607_0106841_192_869 225
579 3300046501 Ga0495607_0116585 Ga0495607_0116585_572_1252 225
580 3300046501 Ga0495607_0119397 Ga0495607_0119397_380_1057 225
581 3300046501 Ga0495607_0201279 Ga0495607_0201279_122_799 225
582 3300046506 Ga0495583_0001393 Ga0495583_0001393_5617_6294 225
583 3300046506 Ga0495583_0013707 Ga0495583_0013707_3393_4073 225
584 3300046506 Ga0495583_0062398 Ga0495583_0062398_829_1506 225
585 3300046506 Ga0495583_0100157 Ga0495583_0100157_375_1052 225
586 3300046506 Ga0495583_0160502 Ga0495583_0160502_61_738 225
587 3300046507 Ga0495606_0005050 Ga0495606_0005050_11459_12136 225
588 3300046507 Ga0495606_0028623 Ga0495606_0028623_177_857 225
589 3300046507 Ga0495606_0031306 Ga0495606_0031306_2941_3630 225
590 3300046507 Ga0495606_0057752 Ga0495606_0057752_356_1036 225
591 3300046507 Ga0495606_0080688 Ga0495606_0080688_752_1429 225
592 3300046507 Ga0495606_0215298 Ga0495606_0215298_347_1027 225
593 3300046507 Ga0495606_0278504 Ga0495606_0278504_14_694 225
594 3300046512 Ga0495610_0008647 Ga0495610_0008647_187_867 225
595 3300046512 Ga0495610_0010004 Ga0495610_0010004_4664_5341 225
596 3300046512 Ga0495610_0020580 Ga0495610_0020580_184_864 225
597 3300046512 Ga0495610_0030034 Ga0495610_0030034_417_1097 225
598 3300046512 Ga0495610_0035979 Ga0495610_0035979_181_861 225
599 3300046512 Ga0495610_0072304 Ga0495610_0072304_749_1426 225
600 3300046512 Ga0495610_0074998 Ga0495610_0074998_752_1429 225
601 3300046512 Ga0495610_0145186 Ga0495610_0145186_251_934 225
602 3300046512 Ga0495610_0225942 Ga0495610_0225942_39_716 225
603 3300046513 Ga0495616_0009022 Ga0495616_0009022_5010_5690 225
604 3300046513 Ga0495616_0012143 Ga0495616_0012143_193_873 225
605 3300046513 Ga0495616_0018650 Ga0495616_0018650_173_862 225
606 3300046513 Ga0495616_0055476 Ga0495616_0055476_1222_1899 225
607 3300046513 Ga0495616_0058479 Ga0495616_0058479_34_735 225
608 3300046513 Ga0495616_0064492 Ga0495616_0064492_949_1632 225
609 3300046513 Ga0495616_0090787 Ga0495616_0090787_566_1243 225
610 3300046513 Ga0495616_0101532 Ga0495616_0101532_39_716 225
611 3300046513 Ga0495616_0164297 Ga0495616_0164297_126_803 225
612 3300046515 Ga0495620_0031208 Ga0495620_0031208_498_1178 225
613 3300046515 Ga0495620_0038963 Ga0495620_0038963_1398_2075 225
614 3300046515 Ga0495620_0046228 Ga0495620_0046228_1032_1712 225
615 3300046515 Ga0495620_0064621 Ga0495620_0064621_687_1364 225
616 3300046515 Ga0495620_0133660 Ga0495620_0133660_98_775 225
617 3300046517 Ga0495630_0193324 Ga0495630_0193324_718_1395 225
618 3300046517 Ga0495630_0486215 Ga0495630_0486215_63_740 225
619 3300046518 Ga0495631_0000754 Ga0495631_0000754_15776_16453 225
620 3300046518 Ga0495631_0010343 Ga0495631_0010343_3478_4227 225
621 3300046518 Ga0495631_0173100 Ga0495631_0173100_24_701 225
622 3300046518 Ga0495631_0184483 Ga0495631_0184483_68_745 225
623 3300046519 Ga0495632_0010368 Ga0495632_0010368_4648_5325 225
624 3300046519 Ga0495632_0049407 Ga0495632_0049407_1341_2036 225
625 3300046519 Ga0495632_0051847 Ga0495632_0051847_1312_1989 225
626 3300046519 Ga0495632_0052885 Ga0495632_0052885_190_867 225
627 3300046519 Ga0495632_0073532 Ga0495632_0073532_53_730 225
628 3300046519 Ga0495632_0080346 Ga0495632_0080346_807_1487 225
629 3300046519 Ga0495632_0083425 Ga0495632_0083425_410_1090 225
630 3300046519 Ga0495632_0084367 Ga0495632_0084367_635_1315 225
631 3300046519 Ga0495632_0152668 Ga0495632_0152668_133_810 225
632 3300046519 Ga0495632_0156203 Ga0495632_0156203_320_1009 225
633 3300046519 Ga0495632_0190604 Ga0495632_0190604_123_800 225
634 3300046520 Ga0495637_0003859 Ga0495637_0003859_7062_7739 225
635 3300046520 Ga0495637_0007516 Ga0495637_0007516_462_1142 225
636 3300046520 Ga0495637_0016909 Ga0495637_0016909_2542_3222 225
637 3300046520 Ga0495637_0046085 Ga0495637_0046085_1068_1745 225
638 3300046520 Ga0495637_0050093 Ga0495637_0050093_327_1004 225
639 3300046520 Ga0495637_0074810 Ga0495637_0074810_489_1166 225
640 3300046522 Ga0495643_0005058 Ga0495643_0005058_4161_4841 225
641 3300046522 Ga0495643_0012777 Ga0495643_0012777_431_1111 225
642 3300046522 Ga0495643_0046236 Ga0495643_0046236_1643_2320 225
643 3300046522 Ga0495643_0131958 Ga0495643_0131958_96_773 225
644 3300046522 Ga0495643_0214160 Ga0495643_0214160_65_742 225
645 3300046522 Ga0495643_0227847 Ga0495643_0227847_35_712 225
646 3300046522 Ga0495643_0241408 Ga0495643_0241408_103_804 225
647 3300046523 Ga0495644_0000097 Ga0495644_0000097_41262_41945 225
648 3300046523 Ga0495644_0006183 Ga0495644_0006183_130_810 225
649 3300046523 Ga0495644_0013062 Ga0495644_0013062_519_1196 225
650 3300046523 Ga0495644_0077843 Ga0495644_0077843_192_869 225
651 3300046523 Ga0495644_0188257 Ga0495644_0188257_36_713 225
652 3300046524 Ga0495648_0030916 Ga0495648_0030916_48_728 225
653 3300046524 Ga0495648_0074653 Ga0495648_0074653_203_880 225
654 3300046524 Ga0495648_0081421 Ga0495648_0081421_207_884 225
655 3300046524 Ga0495648_0081483 Ga0495648_0081483_1004_1681 225
656 3300046524 Ga0495648_0096400 Ga0495648_0096400_798_1481 225
657 3300046524 Ga0495648_0104047 Ga0495648_0104047_184_864 225
658 3300046524 Ga0495648_0192551 Ga0495648_0192551_317_994 225
659 3300046524 Ga0495648_0211401 Ga0495648_0211401_239_919 225
660 3300046524 Ga0495648_0215555 Ga0495648_0215555_212_892 225
661 3300046524 Ga0495648_0281202 Ga0495648_0281202_89_766 225
662 3300046526 Ga0495666_0005267 Ga0495666_0005267_5443_6120 225
663 3300046526 Ga0495666_0020772 Ga0495666_0020772_2202_2879 225
664 3300046526 Ga0495666_0086194 Ga0495666_0086194_46_738 225
665 3300046528 Ga0495642_0014939 Ga0495642_0014939_185_862 225
666 3300046528 Ga0495642_0180137 Ga0495642_0180137_61_738 225
667 3300046530 Ga0495654_0007816 Ga0495654_0007816_183_863 225
668 3300046530 Ga0495654_0020523 Ga0495654_0020523_1019_1702 225
669 3300046530 Ga0495654_0025307 Ga0495654_0025307_2280_2957 225
670 3300046530 Ga0495654_0026732 Ga0495654_0026732_190_891 225
671 3300046530 Ga0495654_0053418 Ga0495654_0053418_916_1605 225
672 3300046530 Ga0495654_0060500 Ga0495654_0060500_494_1171 225
673 3300046530 Ga0495654_0080175 Ga0495654_0080175_806_1483 225
674 3300046530 Ga0495654_0101056 Ga0495654_0101056_157_834 225
675 3300046530 Ga0495654_0108968 Ga0495654_0108968_524_1201 225
676 3300046530 Ga0495654_0111267 Ga0495654_0111267_403_1080 225
677 3300046530 Ga0495654_0114262 Ga0495654_0114262_366_1043 225
678 3300046530 Ga0495654_0131651 Ga0495654_0131651_271_948 225
679 3300046530 Ga0495654_0133829 Ga0495654_0133829_368_1048 225
680 3300046530 Ga0495654_0144213 Ga0495654_0144213_309_986 225
681 3300046536 Ga0495587_0062061 Ga0495587_0062061_72_749 225
682 3300046536 Ga0495587_0083736 Ga0495587_0083736_69_746 225
683 3300046538 Ga0495609_0008191 Ga0495609_0008191_173_853 225
684 3300046538 Ga0495609_0009151 Ga0495609_0009151_43_723 225
685 3300046538 Ga0495609_0068342 Ga0495609_0068342_345_1022 225
686 3300046538 Ga0495609_0092982 Ga0495609_0092982_190_867 225
687 3300046538 Ga0495609_0095417 Ga0495609_0095417_193_870 225
688 3300046538 Ga0495609_0149800 Ga0495609_0149800_203_880 225
689 3300046538 Ga0495609_0170145 Ga0495609_0170145_59_736 225
690 3300046542 Ga0495597_0017168 Ga0495597_0017168_128_808 225
691 3300046542 Ga0495597_0018402 Ga0495597_0018402_1569_2252 225
692 3300046542 Ga0495597_0045110 Ga0495597_0045110_96_773 225
693 3300046542 Ga0495597_0100286 Ga0495597_0100286_494_1171 225
694 3300046542 Ga0495597_0108810 Ga0495597_0108810_177_857 225
695 3300046542 Ga0495597_0169010 Ga0495597_0169010_176_853 225
696 3300046542 Ga0495597_0184167 Ga0495597_0184167_86_763 225
697 3300046557 Ga0495622_0010392 Ga0495622_0010392_2168_2848 225
698 3300046557 Ga0495622_0055244 Ga0495622_0055244_476_1165 225
699 3300046557 Ga0495622_0056839 Ga0495622_0056839_409_1086 225
700 3300046558 Ga0495633_0008011 Ga0495633_0008011_4754_5431 225
701 3300046558 Ga0495633_0111937 Ga0495633_0111937_224_982 225
702 3300046558 Ga0495633_0211844 Ga0495633_0211844_89_769 225
703 3300046615 Ga0495656_0048326 Ga0495656_0048326_412_1089 225
704 3300046615 Ga0495656_0115800 Ga0495656_0115800_414_1106 225
705 3300046615 Ga0495656_0259189 Ga0495656_0259189_159_842 225
706 3300046616 Ga0495668_0019353 Ga0495668_0019353_13_690 225
707 3300046616 Ga0495668_0081241 Ga0495668_0081241_180_857 225
708 3300046616 Ga0495668_0130010 Ga0495668_0130010_359_1039 225
709 3300046616 Ga0495668_0195981 Ga0495668_0195981_131_811 225
710 3300046642 Ga0495634_0062767 Ga0495634_0062767_1208_1885 225
711 3300046642 Ga0495634_0214921 Ga0495634_0214921_375_1052 225
712 3300046648 Ga0495611_0008345 Ga0495611_0008345_3251_3931 225
713 3300046648 Ga0495611_0035884 Ga0495611_0035884_1356_2033 225
714 3300046648 Ga0495611_0151764 Ga0495611_0151764_370_1050 225
715 3300046648 Ga0495611_0160020 Ga0495611_0160020_185_862 225
716 3300046648 Ga0495611_0175131 Ga0495611_0175131_63_740 225
717 3300046648 Ga0495611_0196057 Ga0495611_0196057_244_921 225
718 3300046660 Ga0495625_0078866 Ga0495625_0078866_295_972 225
719 3300046660 Ga0495625_0079472 Ga0495625_0079472_1081_1761 225
720 3300046660 Ga0495625_0109403 Ga0495625_0109403_150_827 225
721 3300046660 Ga0495625_0121869 Ga0495625_0121869_508_1185 225
722 3300046660 Ga0495625_0133435 Ga0495625_0133435_553_1230 225
723 3300046660 Ga0495625_0140328 Ga0495625_0140328_771_1454 225
724 3300046660 Ga0495625_0221218 Ga0495625_0221218_386_1066 225
725 3300046660 Ga0495625_0266684 Ga0495625_0266684_178_855 225
726 3300046660 Ga0495625_0355055 Ga0495625_0355055_97_774 225
727 3300046663 Ga0495635_0074258 Ga0495635_0074258_1169_1846 225
728 3300046664 Ga0495659_0026319 Ga0495659_0026319_812_1489 225
729 3300046664 Ga0495659_0191746 Ga0495659_0191746_56_733 225
730 3300046665 Ga0495661_0002150 Ga0495661_0002150_14694_15389 225
731 3300046665 Ga0495661_0058382 Ga0495661_0058382_1456_2136 225
732 3300046665 Ga0495661_0116340 Ga0495661_0116340_376_1053 225
733 3300046665 Ga0495661_0151674 Ga0495661_0151674_427_1104 225
734 3300046665 Ga0495661_0187413 Ga0495661_0187413_162_839 225
735 3300046665 Ga0495661_0209570 Ga0495661_0209570_253_930 225
736 3300046665 Ga0495661_0210242 Ga0495661_0210242_181_858 225
737 3300046665 Ga0495661_0279254 Ga0495661_0279254_10_687 225
738 3300046674 Ga0495588_0065526 Ga0495588_0065526_86_763 225
739 3300046674 Ga0495588_0165477 Ga0495588_0165477_434_1111 225
740 3300046674 Ga0495588_0198263 Ga0495588_0198263_66_743 225
741 3300046675 Ga0495657_0221931 Ga0495657_0221931_302_979 225
742 3300046679 Ga0495623_0242471 Ga0495623_0242471_149_826 225
743 3300046680 Ga0495646_0048827 Ga0495646_0048827_1824_2501 225
744 3300046680 Ga0495646_0076035 Ga0495646_0076035_1222_1899 225
745 3300046680 Ga0495646_0302672 Ga0495646_0302672_34_711 225
746 3300046680 Ga0495646_0379219 Ga0495646_0379219_30_707 225
747 3300046684 Ga0495669_0004597 Ga0495669_0004597_2860_3537 225
748 3300046689 Ga0495613_0002298 Ga0495613_0002298_11563_12255 225
749 3300046689 Ga0495613_0155817 Ga0495613_0155817_90_785 225
750 3300046690 Ga0495624_0020980 Ga0495624_0020980_3206_3898 225
751 3300046691 Ga0495670_0007581 Ga0495670_0007581_4170_4850 225
752 3300046691 Ga0495670_0008881 Ga0495670_0008881_47_724 225
753 3300046691 Ga0495670_0044941 Ga0495670_0044941_959_1636 225
754 3300046691 Ga0495670_0089260 Ga0495670_0089260_138_815 225
755 3300046691 Ga0495670_0133414 Ga0495670_0133414_78_770 225
756 3300046691 Ga0495670_0158239 Ga0495670_0158239_194_871 225
757 3300046691 Ga0495670_0205983 Ga0495670_0205983_138_815 225
758 3300046691 Ga0495670_0275571 Ga0495670_0275571_141_818 225
759 3300046691 Ga0495670_0347154 Ga0495670_0347154_78_755 225
760 3300046692 Ga0495671_0002344 Ga0495671_0002344_10579_11259 225
761 3300046692 Ga0495671_0003790 Ga0495671_0003790_207_884 225
762 3300046692 Ga0495671_0010797 Ga0495671_0010797_1280_1963 225
763 3300046692 Ga0495671_0011331 Ga0495671_0011331_102_782 225
764 3300046692 Ga0495671_0018092 Ga0495671_0018092_173_853 225
765 3300046692 Ga0495671_0022388 Ga0495671_0022388_15_695 225
766 3300046692 Ga0495671_0039923 Ga0495671_0039923_1647_2324 225
767 3300046692 Ga0495671_0044591 Ga0495671_0044591_1330_2007 225
768 3300046692 Ga0495671_0060836 Ga0495671_0060836_1012_1698 225
769 3300046692 Ga0495671_0061420 Ga0495671_0061420_1108_1809 225
770 3300046692 Ga0495671_0069695 Ga0495671_0069695_541_1218 225
771 3300046692 Ga0495671_0114605 Ga0495671_0114605_484_1161 225
772 3300046692 Ga0495671_0153297 Ga0495671_0153297_384_1064 225
773 3300046692 Ga0495671_0213265 Ga0495671_0213265_77_754 225
774 3300046692 Ga0495671_0315139 Ga0495671_0315139_10_696 225
775 3300046694 Ga0495649_0001677 Ga0495649_0001677_56_733 225
776 3300046694 Ga0495649_0009271 Ga0495649_0009271_57_737 225
777 3300046694 Ga0495649_0024640 Ga0495649_0024640_182_859 225
778 3300046694 Ga0495649_0028158 Ga0495649_0028158_45_725 225
779 3300046694 Ga0495649_0028539 Ga0495649_0028539_2238_2915 225
780 3300046694 Ga0495649_0056863 Ga0495649_0056863_1023_1700 225
781 3300046694 Ga0495649_0062158 Ga0495649_0062158_1172_1852 225
782 3300046694 Ga0495649_0068056 Ga0495649_0068056_206_883 225
783 3300046694 Ga0495649_0110690 Ga0495649_0110690_140_820 225
784 3300046694 Ga0495649_0136130 Ga0495649_0136130_352_1032 225
785 3300046694 Ga0495649_0152063 Ga0495649_0152063_188_865 225
786 3300046694 Ga0495649_0216047 Ga0495649_0216047_265_954 225
787 3300046794 Ga0495589_0000787 Ga0495589_0000787_64_741 225
788 3300046794 Ga0495589_0007762 Ga0495589_0007762_530_1210 225
789 3300046794 Ga0495589_0009612 Ga0495589_0009612_1907_2584 225
790 3300046794 Ga0495589_0035604 Ga0495589_0035604_1228_1905 225
791 3300046794 Ga0495589_0067862 Ga0495589_0067862_131_814 225
792 3300046794 Ga0495589_0099275 Ga0495589_0099275_571_1248 225
793 3300046794 Ga0495589_0164681 Ga0495589_0164681_237_917 225
794 3300046809 Ga0495600_0009362 Ga0495600_0009362_2262_2939 225
795 3300046809 Ga0495600_0153606 Ga0495600_0153606_601_1293 225
796 3300046809 Ga0495600_0268015 Ga0495600_0268015_146_823 225
797 3300046810 Ga0495660_0010750 Ga0495660_0010750_42_719 225
798 3300046810 Ga0495660_0023828 Ga0495660_0023828_157_834 225
799 3300046810 Ga0495660_0053727 Ga0495660_0053727_1458_2138 225
800 3300046810 Ga0495660_0068231 Ga0495660_0068231_1191_1871 225
801 3300046810 Ga0495660_0068615 Ga0495660_0068615_1167_1844 225
802 3300046810 Ga0495660_0069008 Ga0495660_0069008_164_841 225
803 3300046810 Ga0495660_0069469 Ga0495660_0069469_993_1670 225
804 3300046810 Ga0495660_0074117 Ga0495660_0074117_1104_1784 225
805 3300046810 Ga0495660_0091538 Ga0495660_0091538_48_731 225
806 3300046810 Ga0495660_0107743 Ga0495660_0107743_616_1293 225
807 3300046810 Ga0495660_0113007 Ga0495660_0113007_532_1212 225
808 3300046810 Ga0495660_0122528 Ga0495660_0122528_175_855 225
809 3300046810 Ga0495660_0146185 Ga0495660_0146185_334_1011 225
810 3300047317 Ga0495604_0228203 Ga0495604_0228203_303_995 225
811 3300047317 Ga0495604_0234841 Ga0495604_0234841_399_1076 225
812 3300047319 Ga0495674_0068381 Ga0495674_0068381_189_866 225
813 3300047320 Ga0495672_0020810 Ga0495672_0020810_445_1137 225
814 3300047320 Ga0495672_0031642 Ga0495672_0031642_176_853 225
815 3300047320 Ga0495672_0057280 Ga0495672_0057280_1427_2104 225
816 3300047320 Ga0495672_0058639 Ga0495672_0058639_1531_2208 225
817 3300047320 Ga0495672_0077342 Ga0495672_0077342_58_741 225
818 3300047320 Ga0495672_0083405 Ga0495672_0083405_822_1499 225
819 3300047320 Ga0495672_0105834 Ga0495672_0105834_167_856 225
820 3300047320 Ga0495672_0280501 Ga0495672_0280501_23_700 225
821 3300047321 Ga0495676_0042823 Ga0495676_0042823_2625_3305 225
822 3300047322 Ga0495680_0020349 Ga0495680_0020349_3868_4545 225
823 3300047322 Ga0495680_0193874 Ga0495680_0193874_165_842 225
824 3300047322 Ga0495680_0211920 Ga0495680_0211920_37_714 225
825 3300047322 Ga0495680_0282510 Ga0495680_0282510_282_959 225
826 3300047322 Ga0495680_0403957 Ga0495680_0403957_161_853 225
827 3300047323 Ga0495683_0001412 Ga0495683_0001412_788_1465 225
828 3300047323 Ga0495683_0003997 Ga0495683_0003997_5332_6009 225
829 3300047323 Ga0495683_0048318 Ga0495683_0048318_533_1210 225
830 3300047323 Ga0495683_0091259 Ga0495683_0091259_48_731 225
831 3300047323 Ga0495683_0114543 Ga0495683_0114543_447_1127 225
832 3300047323 Ga0495683_0210352 Ga0495683_0210352_64_741 225
833 3300047443 Ga0495687_008551 Ga0495687_008551_442_1119 225
834 3300047443 Ga0495687_046930 Ga0495687_046930_1009_1686 225
835 3300047443 Ga0495687_125108 Ga0495687_125108_65_742 225
836 3300047444 Ga0495675_0298485 Ga0495675_0298485_119_796 225
837 3300047445 Ga0495677_0020676 Ga0495677_0020676_1275_1952 225
838 3300047446 Ga0495679_005216 Ga0495679_005216_4932_5612 225
839 3300047447 Ga0495685_114732 Ga0495685_114732_36_713 225
840 3300047469 Ga0495673_0000658 Ga0495673_0000658_33131_33808 225
841 3300047469 Ga0495673_0003471 Ga0495673_0003471_9490_10167 225
842 3300047469 Ga0495673_0029459 Ga0495673_0029459_160_837 225
843 3300047469 Ga0495673_0032148 Ga0495673_0032148_132_815 225
844 3300047469 Ga0495673_0035849 Ga0495673_0035849_177_866 225
845 3300047469 Ga0495673_0037690 Ga0495673_0037690_996_1676 225
846 3300047469 Ga0495673_0038264 Ga0495673_0038264_588_1265 225
847 3300047469 Ga0495673_0041672 Ga0495673_0041672_1208_1885 225
848 3300047469 Ga0495673_0063649 Ga0495673_0063649_202_879 225
849 3300047469 Ga0495673_0076684 Ga0495673_0076684_186_863 225
850 3300047469 Ga0495673_0093841 Ga0495673_0093841_365_1042 225
851 3300047469 Ga0495673_0125560 Ga0495673_0125560_181_858 225
852 3300047469 Ga0495673_0137593 Ga0495673_0137593_60_737 225
853 3300047469 Ga0495673_0144265 Ga0495673_0144265_174_851 225
854 3300047469 Ga0495673_0144773 Ga0495673_0144773_94_771 225
855 3300047469 Ga0495673_0178473 Ga0495673_0178473_44_721 225
856 3300047470 Ga0495681_0004848 Ga0495681_0004848_598_1275 225
857 3300047470 Ga0495681_0015297 Ga0495681_0015297_3162_3839 225
858 3300047470 Ga0495681_0032483 Ga0495681_0032483_1126_1809 225
859 3300047470 Ga0495681_0047054 Ga0495681_0047054_185_865 225
860 3300047470 Ga0495681_0050882 Ga0495681_0050882_142_822 225
861 3300047470 Ga0495681_0057421 Ga0495681_0057421_168_845 225
862 3300047470 Ga0495681_0061567 Ga0495681_0061567_173_850 225
863 3300047470 Ga0495681_0075452 Ga0495681_0075452_650_1327 225
864 3300047470 Ga0495681_0111418 Ga0495681_0111418_185_865 225
865 3300047470 Ga0495681_0152527 Ga0495681_0152527_116_793 225
866 3300047471 Ga0495684_0118982 Ga0495684_0118982_347_1024 225
867 3300047471 Ga0495684_0371000 Ga0495684_0371000_136_828 225
868 3300047472 Ga0495686_0017880 Ga0495686_0017880_3835_4515 225
869 3300047472 Ga0495686_0027499 Ga0495686_0027499_157_837 225
870 3300047472 Ga0495686_0128235 Ga0495686_0128235_538_1215 225
871 3300047472 Ga0495686_0164610 Ga0495686_0164610_532_1209 225
872 3300047472 Ga0495686_0175716 Ga0495686_0175716_409_1089 225
873 3300047472 Ga0495686_0176717 Ga0495686_0176717_89_766 225
874 3300047673 Ga0495593_0016946 Ga0495593_0016946_2978_3670 225
875 3300047673 Ga0495593_0033389 Ga0495593_0033389_1015_1692 225
876 3300047673 Ga0495593_0046577 Ga0495593_0046577_822_1499 225
877 3300048088 Ga0495602_0042520 Ga0495602_0042520_580_1272 225
878 3300048091 Ga0495626_0001842 Ga0495626_0001842_123_800 225
879 3300048091 Ga0495626_0008142 Ga0495626_0008142_4752_5429 225
880 3300048091 Ga0495626_0008567 Ga0495626_0008567_183_863 225
881 3300048091 Ga0495626_0009959 Ga0495626_0009959_4357_5034 225
882 3300048091 Ga0495626_0047177 Ga0495626_0047177_115_795 225
883 3300048091 Ga0495626_0081799 Ga0495626_0081799_64_741 225
884 3300048091 Ga0495626_0113299 Ga0495626_0113299_423_1100 225
885 3300048091 Ga0495626_0122618 Ga0495626_0122618_245_922 225
886 3300048091 Ga0495626_0132220 Ga0495626_0132220_17_697 225
887 3300048905 Ga0496102_0200586 Ga0496102_0200586_1018_1695 225
888 3300048906 Ga0496103_0174607 Ga0496103_0174607_541_1218 225
889 3300048914 Ga0496111_0208709 Ga0496111_0208709_562_1239 225
890 3300048915 Ga0496112_0398381 Ga0496112_0398381_25_702 225
891 3300048919 Ga0496116_0000640 Ga0496116_0000640_41086_41781 225
892 3300048919 Ga0496116_0091684 Ga0496116_0091684_621_1301 225
893 3300048919 Ga0496116_0145929 Ga0496116_0145929_184_861 225
894 3300048920 Ga0496117_0001555 Ga0496117_0001555_420_1115 225
895 3300048920 Ga0496117_0003824 Ga0496117_0003824_1191_1886 225
896 3300048920 Ga0496117_0235576 Ga0496117_0235576_146_823 225
897 3300048922 Ga0496119_0264621 Ga0496119_0264621_174_851 225
898 3300048923 Ga0496120_0067885 Ga0496120_0067885_854_1531 225
899 3300048923 Ga0496120_0069420 Ga0496120_0069420_56_748 225
900 3300048924 Ga0496121_0003360 Ga0496121_0003360_3884_4579 225
901 3300048924 Ga0496121_0089893 Ga0496121_0089893_46_723 225
902 3300048924 Ga0496121_0130471 Ga0496121_0130471_1021_1701 225
903 3300048924 Ga0496121_0157193 Ga0496121_0157193_873_1550 225
904 3300048925 Ga0496122_0115944 Ga0496122_0115944_383_1078 225
905 3300048925 Ga0496122_0190155 Ga0496122_0190155_488_1180 225
906 3300048925 Ga0496122_0239746 Ga0496122_0239746_289_966 225
907 3300048926 Ga0496123_0022547 Ga0496123_0022547_4105_4797 225
908 3300048926 Ga0496123_0040682 Ga0496123_0040682_2532_3209 225
909 3300048926 Ga0496123_0062244 Ga0496123_0062244_1694_2371 225
910 3300048926 Ga0496123_0093500 Ga0496123_0093500_167_862 225
911 3300048927 Ga0496124_0005034 Ga0496124_0005034_52_744 225
912 3300048927 Ga0496124_0039561 Ga0496124_0039561_2482_3174 225
913 3300048927 Ga0496124_0077104 Ga0496124_0077104_21_698 225
914 3300048927 Ga0496124_0081808 Ga0496124_0081808_1824_2501 225
915 3300048927 Ga0496124_0227733 Ga0496124_0227733_557_1234 225
916 3300048928 Ga0496125_0004817 Ga0496125_0004817_61_753 225
917 3300048928 Ga0496125_0004927 Ga0496125_0004927_14364_15056 225
918 3300048928 Ga0496125_0191809 Ga0496125_0191809_350_1027 225
919 3300048928 Ga0496125_0370750 Ga0496125_0370750_37_714 225
920 3300048929 Ga0496126_0094445 Ga0496126_0094445_1011_1688 225
921 3300049459 Ga0495678_007396 Ga0495678_007396_4856_5536 225
922 3300049459 Ga0495678_012114 Ga0495678_012114_181_861 225
923 3300049459 Ga0495678_013512 Ga0495678_013512_2962_3651 225
924 3300049459 Ga0495678_039581 Ga0495678_039581_169_846 225
925 3300049459 Ga0495678_045153 Ga0495678_045153_397_1074 225
926 3300049459 Ga0495678_047570 Ga0495678_047570_816_1493 225
927 3300049459 Ga0495678_061389 Ga0495678_061389_540_1217 225
928 3300049459 Ga0495678_076960 Ga0495678_076960_107_784 225
929 3300049459 Ga0495678_081495 Ga0495678_081495_428_1105 225
930 3300049460 Ga0495682_0009354 Ga0495682_0009354_163_852 225
931 3300049460 Ga0495682_0019109 Ga0495682_0019109_1712_2389 225
932 3300049460 Ga0495682_0034489 Ga0495682_0034489_203_880 225
933 3300049460 Ga0495682_0042119 Ga0495682_0042119_41_718 225
934 3300049460 Ga0495682_0114912 Ga0495682_0114912_98_775 225
935 3300049460 Ga0495682_0130311 Ga0495682_0130311_65_742 225
936 3300049460 Ga0495682_0145352 Ga0495682_0145352_27_704 225
937 3300049573 Ga0501037_0140801 Ga0501037_0140801_714_1397 225
938 3300049758 Ga0501241_000699 Ga0501241_000699_984_1664 225
939 3300050489 nmdc:mga03683_234206_c1 nmdc:mga03683_234206_c1_142_819 225
940 3300050491 nmdc:mga00v17_372274_c1 nmdc:mga00v17_372274_c1_157_834 225
941 3300050514 nmdc:mga08x19_184893_c1 nmdc:mga08x19_184893_c1_717_1394 225
942 3300050516 nmdc:mga0sz30_141131_c1 nmdc:mga0sz30_141131_c1_58_735 225
943 3300053111 Ga0500572_043012 Ga0500572_043012_453_1133 225
944 3300053142 Ga0500577_0120528 Ga0500577_0120528_290_979 225
945 iso_pu_bacteria 3007252601 3007253294 225
946 iso_pu_bacteria 3007315729 3007317914 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

32

219

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qjw-assembly2.cif.gz_C crystal structure of a putative hydrolase of the alpha/beta superfamily (xcc1541) from xanthomonas campestris pv. campestris at 1.35 a resolution 0.799 35 223
2qjw-assembly2.cif.gz_D crystal structure of a putative hydrolase of the alpha/beta superfamily (xcc1541) from xanthomonas campestris pv. campestris at 1.35 a resolution 0.79 32 223
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.7808 23 221
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.7763 23 221
2qjw-assembly2.cif.gz_C crystal structure of a putative hydrolase of the alpha/beta superfamily (xcc1541) from xanthomonas campestris pv. campestris at 1.35 a resolution 0.7744 35 223
ID Description Score Start End Superfamily
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.837 18 221 3.40.50.1820
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8259 18 221 3.40.50.1820
af_Q5JUR7_11_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8143 23 212 3.40.50.1820
af_B4FGW5_14_203_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8117 29 202 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8029 23 144 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3M4DHS5-F1-model_v4 Dienelactone hydrolase protein 0.9976 122 223 GO:0016787
AF-A0A656JTH7-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9972 111 223
AF-A0A1Y5FWL5-F1-model_v4 Alpha/beta hydrolase 0.9863 135 222 GO:0016787
AF-A0A6I4Z6M8-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9842 110 223
AF-Q7U689-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9819 117 223

Feature Viewer

pLDDT pTM Quality
91.08 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map