F486417

General Info

Members Datasets Scaffolds Average Seq Length
944 780 344 341

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2690316117|2692319462
Length 363
Sequence GLGVFKLAGLGALELEGKDNMAVLKGALIGCGFFAVNQMHGWRDAEGARIVAICDRDPARLRAVGDEFGITRRYTSAEDLFADGGFDFVDIATTAKSHRPLVEMAARYGIPTICQKPIAPTMEDAKAMAAACAEAGVPLMVHENFRWQSPIRAAKAAIDSGAIGEVFWGRVSFRSAYDVYSGQPYLATGKRFIIEDLGIHALDIARYLFGDATSVTARTRRVNSKIVGEDVATMLLDHHSGITSVVDCSYATRLPVEAFPETLLEVDGSKGTLRLSQGYRLQVHSREGTETKDVAPRLLPWASTPWHNIQESVSLIQQHWVDCLRTGREPDTSGRDNLKTFALVEASYRSAARGKTVPVEEFF

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
11 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
12 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
13 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
14 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
18 2512875024 Mesorhizobium loti R88b Isolate Nodule
19 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
20 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
21 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
22 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
23 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
24 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
25 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
26 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
27 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
28 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
29 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
30 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
31 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
32 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
33 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
34 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
35 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
36 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
37 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
38 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
39 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
40 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
41 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
42 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
43 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
44 2516143018 Ensifer sp. BR816 Isolate Nodule
45 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
46 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
47 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
48 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
49 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
50 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
51 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
52 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
53 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
54 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
55 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
56 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
57 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
58 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
59 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
60 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
61 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
62 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
63 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
64 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
65 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
66 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
67 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
68 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
69 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
70 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
71 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
72 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
73 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
74 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
75 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
76 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
77 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
78 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
79 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
80 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
81 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
82 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
83 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
84 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
85 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
86 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
87 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
88 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
89 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
90 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
91 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
92 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
93 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
94 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
95 2643221599 Rhizobium sp. Root708 Isolate Unclassified
96 2643221607 Rhizobium sp. Root73 Isolate Unclassified
97 2643221626 Ensifer sp. Root31 Isolate Unclassified
98 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
99 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
100 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
101 2643221655 Ensifer sp. Root1252 Isolate Unclassified
102 2643221659 Ensifer sp. Root127 Isolate Unclassified
103 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
104 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
105 2643221698 Ensifer sp. Root142 Isolate Unclassified
106 2643221712 Ensifer sp. Root258 Isolate Unclassified
107 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
108 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
109 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
110 2718217882 Rhizobium sp. N741 Isolate Nodule
111 2718218009 Rhizobium sp. N561 Isolate Nodule
112 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
113 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
114 2718218363 Rhizobium sp. N113 Isolate Nodule
115 2718218365 Rhizobium sp. N731 Isolate Nodule
116 2718218366 Rhizobium sp. N621 Isolate Nodule
117 2721755514 Rhizobium sp. N6212 Isolate Nodule
118 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
119 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
120 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
121 2721755810 Rhizobium sp. N871 Isolate Nodule
122 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
123 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
124 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
125 2728369365 Rhizobium sp. N1341 Isolate Nodule
126 2728369397 Rhizobium sp. N1314 Isolate Nodule
127 2738541293 Rhizobium sp. GV031 Isolate Unclassified
128 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
129 2751185800 Brucella pituitosa AA2 Isolate Unclassified
130 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
131 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
132 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
133 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
134 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
135 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
136 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
137 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
138 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
139 2791355260 Rhizobium sp. L9 Isolate Nodule
140 2791355261 Rhizobium sp. J15 Isolate Nodule
141 2791355263 Rhizobium chutanense C5 Isolate Nodule
142 2791355264 Rhizobium sp. S9 Isolate Nodule
143 2791355266 Rhizobium sp. L43 Isolate Nodule
144 2791355267 Rhizobium sp. L18 Isolate Nodule
145 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
146 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
147 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
148 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
149 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
150 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
151 2802429633 Rhizobium anhuiense J3 Isolate Nodule
152 2802429634 Rhizobium anhuiense S10 Isolate Nodule
153 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
154 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
155 2802429637 Rhizobium anhuiense C15 Isolate Nodule
156 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
157 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
158 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
159 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
160 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
161 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
162 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
163 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
164 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
165 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
166 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
167 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
168 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
169 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
170 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
171 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
172 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
173 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
174 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
175 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
176 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
177 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
178 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
179 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
180 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
181 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
182 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
183 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
184 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
185 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
186 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
187 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
188 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
189 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
190 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
191 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
192 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
193 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
194 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
195 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
196 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
197 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
198 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
199 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
200 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
201 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
202 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
203 2844163670 Ensifer sp. 1H6 Isolate Unclassified
204 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
205 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
206 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
207 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
208 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
209 2854911287 Brucella lupini LUP21 Isolate Unclassified
210 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
211 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
212 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
213 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
214 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
215 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
216 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
217 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
218 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
219 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
220 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
221 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
222 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
223 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
224 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
225 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
226 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
227 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
228 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
229 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
230 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
231 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
232 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
233 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
234 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
235 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
236 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
237 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
238 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
239 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
240 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
241 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
242 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
243 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
244 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
245 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
246 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
247 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
248 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
249 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
250 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
251 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
252 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
253 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
254 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
255 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
256 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
257 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
258 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
259 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
260 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
261 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
262 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
263 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
264 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
265 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
266 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
267 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
268 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
269 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
270 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
271 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
272 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
273 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
274 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
275 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
276 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
277 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
278 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
279 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
280 2909042592 Labrys sp. LIt4 Isolate Nodule
281 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
282 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
283 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
284 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
285 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
286 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
287 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
288 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
289 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
290 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
291 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
292 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
293 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
294 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
295 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
296 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
297 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
298 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
299 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
300 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
301 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
302 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
303 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
304 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
305 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
306 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
307 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
308 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
309 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
310 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
311 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
312 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
313 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
314 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
315 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
316 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
317 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
318 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
319 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
320 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
321 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
322 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
323 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
324 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
325 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
326 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
327 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
328 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
329 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
330 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
331 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
332 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
333 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
334 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
335 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
336 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
337 2933599457 Rhizobium phaseoli M3 Isolate Nodule
338 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
339 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
340 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
341 2936381700 Rhizobium chutanense C16 Isolate Unclassified
342 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
343 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
344 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
345 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
346 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
347 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
348 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
349 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
350 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
351 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
352 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
353 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
354 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
355 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
356 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
357 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
358 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
359 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
360 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
361 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
362 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
363 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
364 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
365 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
366 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
367 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
368 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
369 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
370 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
371 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
372 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
373 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
374 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
375 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
376 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
377 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
378 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
379 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
380 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
381 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
382 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
383 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
384 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
385 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
386 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
387 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
388 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
389 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
390 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
391 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
392 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
393 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
394 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
395 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
396 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
397 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
398 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
399 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
400 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
401 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
402 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
403 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
404 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
405 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
406 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
407 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
408 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
409 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
410 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
411 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
412 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
413 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
414 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
415 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
416 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
417 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
418 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
419 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
420 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
421 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
422 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
423 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
424 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
425 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
426 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
427 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
428 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
429 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
430 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
431 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
432 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
433 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
434 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
435 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
436 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
437 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
438 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
439 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
440 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
441 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
442 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
443 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
444 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
445 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
446 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
447 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
448 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
449 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
450 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
451 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
452 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
453 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
454 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
455 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
456 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
457 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
458 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
459 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
460 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
461 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
462 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
463 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
464 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
465 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
466 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
467 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
468 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
469 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
470 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
471 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
472 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
473 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
474 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
475 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
476 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
477 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
478 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
479 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
480 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
481 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
482 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
483 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
484 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
485 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
486 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
487 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
488 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
489 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
490 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
491 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
492 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
493 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
494 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
495 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
496 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
497 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
498 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
499 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
500 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
501 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
502 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
503 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
504 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
505 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
506 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
507 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
508 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
509 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
510 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
511 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
512 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
513 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
514 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
515 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
516 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
517 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
518 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
519 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
520 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
521 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
522 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
523 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
524 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
525 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
526 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
527 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
528 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
529 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
530 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
531 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
532 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
533 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
534 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
535 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
536 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
537 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
538 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
539 3004167301 Mesorhizobium loti 582 Isolate Unclassified
540 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
541 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
542 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
543 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
544 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
545 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
546 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
547 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
548 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
549 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
550 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
551 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
552 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
553 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
554 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
555 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
556 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
557 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
558 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
559 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
560 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
561 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
562 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
563 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
564 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
565 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
566 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
567 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
568 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
569 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
570 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
571 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
572 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
573 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
574 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
575 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
576 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
577 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
578 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
579 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
580 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
581 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
582 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
583 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
584 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
585 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
586 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
587 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
588 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
589 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
590 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
591 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
592 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
593 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
594 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
595 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
596 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
597 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
598 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
599 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
600 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
601 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
602 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
603 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
604 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
605 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
606 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
607 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
608 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
609 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
610 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
611 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
612 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
613 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
614 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
615 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
616 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
617 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
618 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
619 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
620 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
621 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
622 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
623 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
624 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
625 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
626 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
627 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
628 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
636 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
637 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
638 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
639 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
641 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
642 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
643 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
644 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
645 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
646 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
647 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
648 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
649 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
650 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
651 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
652 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
653 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
654 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
655 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
656 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
657 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
658 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
659 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
660 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
661 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
662 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
663 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
664 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
665 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
666 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
667 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
668 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
669 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
670 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
671 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
672 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
673 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
674 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
675 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
676 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
677 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
678 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
679 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
680 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
681 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
682 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
683 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
684 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
685 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
686 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
687 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
688 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
689 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
690 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
691 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
692 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
693 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
694 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
695 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
696 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
697 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
698 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
699 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
700 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
701 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
702 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
703 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
704 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
705 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
706 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
707 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
708 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
709 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
710 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
711 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
712 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
713 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
714 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
715 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
716 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
717 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
718 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
719 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
720 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
721 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
722 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
723 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
724 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
725 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
726 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
727 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
728 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
729 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
730 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
731 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
732 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
733 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
734 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
735 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
736 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
737 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
738 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
739 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
740 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
741 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
742 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
743 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
744 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
745 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
746 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
747 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
748 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
749 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
750 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
751 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
752 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
753 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
754 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
755 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
756 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
757 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
758 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
759 8005395548 Rhizobium sp. R339 Isolate Nodule
760 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
761 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
762 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
763 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
764 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
765 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
766 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
767 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
768 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
769 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
770 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
771 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
772 8018176218 Rhizobium sp. N122 Isolate Nodule
773 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
774 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
775 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
776 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
777 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
778 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
779 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
780 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.44
Metatranscriptomes 0
Isolates 63.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.36
Nodule 54.13
Rhizoplane 1.27
Rhizosphere 14.51
Stem 0
Stem Tuber 0
Unclassified 14.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000015 3300002704 Bacteria 178839
2 JGI25156J39149_1000007 3300002705 Bacteria 252108
3 JGI25154J39366_1000051 3300002738 Bacteria 123608
4 JGI25157J39369_1000012 3300002741 Bacteria 205167
5 JGI25157J39369_1001565 3300002741 Bacteria 8120
6 JGI25152J39213_1000472 3300002773 Bacteria 23443
7 JGI25152J39213_1002351 3300002773 Bacteria 7261
8 JGI25152J39213_1003011 3300002773 Bacteria 5955
9 JGI25152J39213_1008103 3300002773 Bacteria 2641
10 JGI25150J39212_1000219 3300002774 Bacteria 31283
11 JGI25159J45721_1000036 3300002987 Bacteria 76363
12 JGI25159J45721_1000101 3300002987 Bacteria 41224
13 JGI25159J45721_1000321 3300002987 Bacteria 22253
14 JGI25151J46595_10000007 3300003187 Bacteria 411751
15 JGI25151J46595_10000462 3300003187 Bacteria 39029
16 JGI25151J46595_10008747 3300003187 Bacteria 4840
17 JGI25151J46595_10011789 3300003187 Bacteria 4005
18 JGI25165J46597_1000102 3300003214 Bacteria 155002
19 JGI25165J46597_1000280 3300003214 Bacteria 65126
20 JGI25165J46597_1005128 3300003214 Bacteria 2597
21 JGI25153J46596_10000254 3300003215 Bacteria 43730
22 JGI25153J46596_10002799 3300003215 Bacteria 9916
23 rootH2_10010087 3300003320 Bacteria 5501
24 rootH1_10085854 3300003323 Bacteria 7651
25 JGI25160J50197_1000023 3300003354 Bacteria 200692
26 JGI25160J50197_1000060 3300003354 Bacteria 116870
27 JGI25161J50226_1000012 3300003374 Bacteria 200668
28 JGI25161J50226_1000085 3300003374 Bacteria 76182
29 JGI25161J50226_1000486 3300003374 Bacteria 17962
30 JGI25161J50226_1005087 3300003374 Bacteria 2625
31 Ga0055542_1000516 3300003762 Bacteria 34984
32 Ga0055526_1007793 3300003771 Bacteria 5486
33 Ga0055524_1001911 3300003775 Bacteria 11282
34 Ga0055524_1020816 3300003775 Bacteria 2196
35 Ga0055528_1003888 3300003790 Bacteria 7341
36 Ga0055528_1006142 3300003790 Bacteria 5483
37 Ga0055528_1014676 3300003790 Bacteria 2882
38 Ga0055540_1000331 3300003792 Bacteria 41202
39 Ga0055540_1010207 3300003792 Bacteria 3143
40 Ga0055543_1000009 3300004625 Bacteria 200706
41 Ga0055543_1000036 3300004625 Bacteria 126054
42 Ga0055543_1000478 3300004625 Bacteria 23469
43 Ga0055543_1001244 3300004625 Bacteria 10574
44 Ga0065165_1000064 3300005262 Bacteria 175153
45 Ga0065165_1000160 3300005262 Bacteria 116908
46 Ga0065165_1004819 3300005262 Bacteria 8031
47 Ga0065165_1007340 3300005262 Bacteria 5457
48 Ga0070670_100000091 3300005331 Bacteria 85664
49 Ga0070660_100215186 3300005339 Bacteria 1561
50 Ga0070665_100065456 3300005548 Bacteria 3646
51 Ga0068855_100063530 3300005563 Bacteria 4308
52 Ga0068856_100051751 3300005614 Bacteria 4049
53 Ga0068856_100116212 3300005614 Bacteria 2676
54 Ga0075365_10000172 3300006038 Bacteria 20817
55 Ga0075365_10008935 3300006038 Bacteria 5724
56 Ga0075368_10045934 3300006042 Bacteria 1727
57 Ga0075363_100016354 3300006048 Bacteria 3664
58 Ga0075363_100033823 3300006048 Bacteria 2665
59 Ga0075363_100104410 3300006048 Bacteria 1571
60 Ga0075363_100111319 3300006048 Bacteria 1522
61 Ga0075364_10005092 3300006051 Bacteria 7617
62 Ga0075364_10024357 3300006051 Bacteria 3842
63 Ga0075364_10093043 3300006051 Bacteria 2001
64 Ga0075362_10033458 3300006177 Bacteria 2236
65 Ga0075362_10047012 3300006177 Bacteria 1921
66 Ga0075367_10000610 3300006178 Bacteria 13715
67 Ga0075367_10003061 3300006178 Bacteria 7838
68 Ga0075367_10242379 3300006178 Bacteria 1130
69 Ga0075369_10003613 3300006186 Bacteria 5644
70 Ga0075369_10009935 3300006186 Bacteria 3712
71 Ga0075369_10013715 3300006186 Bacteria 3224
72 Ga0075370_10004228 3300006353 Bacteria 6939
73 Ga0075370_10010727 3300006353 Bacteria 4803
74 Ga0079104_1006901 3300006946 Bacteria 4202
75 Ga0105240_10000557 3300009093 Bacteria 69103
76 Ga0105245_10060891 3300009098 Bacteria 3401
77 Ga0105243_10119152 3300009148 Bacteria 2222
78 Ga0105237_10000934 3300009545 Bacteria 39322
79 Ga0105238_10572566 3300009551 Bacteria 1135
80 Ga0105249_10205822 3300009553 Bacteria 1928
81 Ga0157373_10086578 3300013100 Bacteria 2208
82 Ga0157370_10071003 3300013104 Bacteria 3286
83 Ga0157369_10259280 3300013105 Bacteria 1813
84 Ga0182008_10105241 3300014497 Bacteria 1396
85 Ga0182007_10013587 3300015262 Bacteria 3099
86 Ga0182005_1016224 3300015265 Bacteria 2073
87 Ga0214543_1000025 3300021327 Bacteria 225351
88 Ga0228711_1000005 3300022739 Bacteria 215594
89 Ga0228710_1000018 3300022740 Bacteria 118600
90 Ga0209435_100006 3300025206 Bacteria 542459
91 Ga0209436_100133 3300025208 Bacteria 36901
92 Ga0209436_100661 3300025208 Bacteria 14676
93 Ga0209672_101970 3300025228 Bacteria 5768
94 Ga0209437_100062 3300025233 Bacteria 336900
95 Ga0209437_100281 3300025233 Bacteria 74945
96 Ga0207425_1000018 3300025245 Bacteria 411841
97 Ga0207425_1002535 3300025245 Bacteria 6373
98 Ga0207425_1002605 3300025245 Bacteria 6250
99 Ga0209646_1000015 3300025246 Bacteria 542459
100 Ga0209026_1000046 3300025250 Bacteria 262031
101 Ga0209026_1000327 3300025250 Bacteria 48226
102 Ga0209677_102857 3300025253 Bacteria 6087
103 Ga0209148_1000078 3300025254 Bacteria 296101
104 Ga0209759_1000005 3300025256 Bacteria 542459
105 Ga0209759_1000321 3300025256 Bacteria 63590
106 Ga0209129_1000019 3300025258 Bacteria 460802
107 Ga0209129_1000026 3300025258 Bacteria 411839
108 Ga0209129_1000355 3300025258 Bacteria 38491
109 Ga0209129_1001590 3300025258 Bacteria 12417
110 Ga0209129_1002815 3300025258 Bacteria 8076
111 Ga0209129_1003393 3300025258 Bacteria 6985
112 Ga0209129_1004309 3300025258 Bacteria 5648
113 Ga0209233_1000082 3300025261 Bacteria 336320
114 Ga0209233_1000267 3300025261 Bacteria 74945
115 Ga0209233_1000311 3300025261 Bacteria 55820
116 Ga0209565_1021092 3300025263 Bacteria 1366
117 Ga0209455_1000193 3300025272 Bacteria 90413
118 Ga0209673_1000294 3300025273 Bacteria 93050
119 Ga0209673_1000769 3300025273 Bacteria 43317
120 Ga0209673_1007106 3300025273 Bacteria 5245
121 Ga0209130_1000019 3300025284 Bacteria 381993
122 Ga0209130_1000048 3300025284 Bacteria 233357
123 Ga0209130_1000136 3300025284 Bacteria 116996
124 Ga0209130_1000880 3300025284 Bacteria 24560
125 Ga0209130_1018578 3300025284 Bacteria 1628
126 Ga0209130_1019834 3300025284 Bacteria 1551
127 Ga0209025_1000035 3300025294 Bacteria 411841
128 Ga0209025_1000086 3300025294 Bacteria 262586
129 Ga0209025_1000260 3300025294 Bacteria 124240
130 Ga0209025_1000429 3300025294 Bacteria 83306
131 Ga0209025_1001953 3300025294 Bacteria 23804
132 Ga0209025_1002615 3300025294 Bacteria 18501
133 Ga0209025_1007515 3300025294 Bacteria 8096
134 Ga0209564_1000336 3300025295 Bacteria 90930
135 Ga0209564_1032542 3300025295 Bacteria 1568
136 Ga0209564_1036563 3300025295 Bacteria 1399
137 Ga0209758_1000040 3300025297 Bacteria 411841
138 Ga0209758_1000113 3300025297 Bacteria 202528
139 Ga0209758_1001643 3300025297 Bacteria 25398
140 Ga0209758_1001704 3300025297 Bacteria 24679
141 Ga0209758_1001926 3300025297 Bacteria 22572
142 Ga0209758_1003645 3300025297 Bacteria 13739
143 Ga0209758_1006987 3300025297 Bacteria 7858
144 Ga0209758_1032936 3300025297 Bacteria 2093
145 Ga0209256_1000406 3300025299 Bacteria 68202
146 Ga0209256_1002794 3300025299 Bacteria 13381
147 Ga0209256_1005862 3300025299 Bacteria 6811
148 Ga0209256_1019330 3300025299 Bacteria 2173
149 Ga0207426_1000005 3300025302 Bacteria 1037188
150 Ga0207426_1000085 3300025302 Bacteria 293171
151 Ga0207426_1000136 3300025302 Bacteria 201401
152 Ga0207426_1000253 3300025302 Bacteria 116996
153 Ga0207426_1000282 3300025302 Bacteria 104108
154 Ga0207426_1001460 3300025302 Bacteria 19554
155 Ga0209051_1000027 3300025303 Bacteria 412172
156 Ga0209051_1000683 3300025303 Bacteria 37689
157 Ga0209257_1002682 3300025304 Bacteria 17053
158 Ga0207647_10081494 3300025904 Bacteria 1939
159 Ga0207695_10000646 3300025913 Bacteria 69276
160 Ga0207695_10111566 3300025913 Bacteria 2714
161 Ga0207671_10001180 3300025914 Bacteria 31086
162 Ga0207671_10077312 3300025914 Bacteria 2491
163 Ga0207650_10000723 3300025925 Bacteria 25614
164 Ga0207667_10237381 3300025949 Bacteria 1866
165 Ga0207678_10032285 3300026067 Bacteria 4563
166 Ga0207702_10116665 3300026078 Bacteria 2383
167 Ga0207698_10236287 3300026142 Bacteria 1662
168 Ga0209281_1000111 3300027111 Bacteria 215615
169 Ga0209281_1000324 3300027111 Bacteria 84060
170 Ga0209371_1001530 3300027312 Bacteria 15320
171 Ga0209282_1000012 3300027666 Bacteria 215614
172 Ga0268266_10243983 3300028379 Bacteria 1659
173 Ga0307515_10000600 3300028794 Bacteria 83981
174 Ga0307515_10098233 3300028794 Bacteria 3568
175 Ga0268256_1002200 3300030500 Bacteria 10284
176 Ga0307513_10008298 3300031456 Bacteria 13309
177 Ga0307408_100044896 3300031548 Bacteria 3153
178 Ga0307406_10017175 3300031901 Bacteria 4213
179 Ga0307412_10006770 3300031911 Bacteria 6497
180 Ga0307412_10171158 3300031911 Bacteria 1624
181 Ga0315914_1000007 3300031967 Bacteria 215597
182 Ga0307409_100223123 3300031995 Bacteria 1703
183 Ga0315913_1000003 3300033430 Bacteria 215608
184 Ga0315915_1000011 3300033464 Bacteria 215597
185 Ga0395905_0069051 3300037471 Bacteria 3310
186 Ga0436364_0405304 3300037853 Bacteria 5384
187 Ga0400483_095688 3300039062 Bacteria 22591
188 Ga0400483_248197 3300039062 Bacteria 15606
189 Ga0439436_0011422 3300041404 Bacteria 2698
190 Ga0439439_0042574 3300041406 Bacteria 1180
191 Ga0439465_0002248 3300041413 Bacteria 6343
192 Ga0439465_0019866 3300041413 Bacteria 2101
193 Ga0451833_0330568 3300041491 Bacteria 1756
194 Ga0451847_0188200 3300041503 Bacteria 2015
195 Ga0451847_0563186 3300041503 Bacteria 1235
196 Ga0451855_1584958 3300041511 Bacteria 2438
197 Ga0451853_0763300 3300041512 Bacteria 1905
198 Ga0439449_0003926 3300042007 Bacteria 5765
199 Ga0439449_0046059 3300042007 Bacteria 1616
200 Ga0466972_0035844 3300044658 Bacteria 2429
201 Ga0466967_0180330 3300045976 Bacteria 1992
202 Ga0495638_0008711 3300046460 Bacteria 7172
203 Ga0495638_0029523 3300046460 Bacteria 3536
204 Ga0495662_0023488 3300046476 Bacteria 2977
205 Ga0495584_0114818 3300046491 Bacteria 1363
206 Ga0495585_0101835 3300046492 Bacteria 1535
207 Ga0495583_0013226 3300046506 Bacteria 4617
208 Ga0495606_0046809 3300046507 Bacteria 2856
209 Ga0495610_0051699 3300046512 Bacteria 1998
210 Ga0495618_0133592 3300046514 Bacteria 1588
211 Ga0495632_0000580 3300046519 Bacteria 33943
212 Ga0495632_0040914 3300046519 Bacteria 2331
213 Ga0495643_0098412 3300046522 Bacteria 1502
214 Ga0495633_0014136 3300046558 Bacteria 4184
215 Ga0495633_0035834 3300046558 Bacteria 2381
216 Ga0495656_0004137 3300046615 Bacteria 4943
217 Ga0495668_0102863 3300046616 Bacteria 1563
218 Ga0495625_0013906 3300046660 Bacteria 6444
219 Ga0495625_0082457 3300046660 Bacteria 2236
220 Ga0495670_0031367 3300046691 Bacteria 2641
221 Ga0495600_0131722 3300046809 Bacteria 1625
222 Ga0495604_0007238 3300047317 Bacteria 8786
223 Ga0495672_0064923 3300047320 Bacteria 2088
224 Ga0495686_0056294 3300047472 Bacteria 2457
225 Ga0495686_0093012 3300047472 Bacteria 1829
226 Ga0495686_0100469 3300047472 Bacteria 1745
227 Ga0496100_0008412 3300048903 Bacteria 5755
228 Ga0496100_0119975 3300048903 Bacteria 1838
229 Ga0496102_0006548 3300048905 Bacteria 9945
230 Ga0496102_0191500 3300048905 Bacteria 1927
231 Ga0496103_0057093 3300048906 Bacteria 2423
232 Ga0496104_0016044 3300048907 Bacteria 6800
233 Ga0496105_0069045 3300048908 Bacteria 2920
234 Ga0496106_0099788 3300048909 Bacteria 2251
235 Ga0496106_0110129 3300048909 Bacteria 2143
236 Ga0496112_0064536 3300048915 Bacteria 3613
237 Ga0496114_0198002 3300048917 Bacteria 1759
238 Ga0496116_0012255 3300048919 Bacteria 7012
239 Ga0496116_0018046 3300048919 Bacteria 5452
240 Ga0496116_0047373 3300048919 Bacteria 2893
241 Ga0496117_0001218 3300048920 Bacteria 38567
242 Ga0496117_0003731 3300048920 Bacteria 17468
243 Ga0496117_0025343 3300048920 Bacteria 4665
244 Ga0496117_0098423 3300048920 Bacteria 1859
245 Ga0496118_0006410 3300048921 Bacteria 12947
246 Ga0496118_0068768 3300048921 Bacteria 2569
247 Ga0496118_0100820 3300048921 Bacteria 1951
248 Ga0496118_0137342 3300048921 Bacteria 1557
249 Ga0496119_0001100 3300048922 Bacteria 34059
250 Ga0496119_0005459 3300048922 Bacteria 12172
251 Ga0496119_0018343 3300048922 Bacteria 5216
252 Ga0496119_0020337 3300048922 Bacteria 4847
253 Ga0496119_0025324 3300048922 Bacteria 4148
254 Ga0496119_0081918 3300048922 Bacteria 1856
255 Ga0496120_0025688 3300048923 Bacteria 3651
256 Ga0496120_0095425 3300048923 Bacteria 1581
257 Ga0496121_0011972 3300048924 Bacteria 9539
258 Ga0496121_0012200 3300048924 Bacteria 9417
259 Ga0496121_0043326 3300048924 Bacteria 3899
260 Ga0496121_0072800 3300048924 Bacteria 2757
261 Ga0496121_0133149 3300048924 Bacteria 1856
262 Ga0496122_0001245 3300048925 Bacteria 42799
263 Ga0496122_0008016 3300048925 Bacteria 11538
264 Ga0496122_0022991 3300048925 Bacteria 5517
265 Ga0496122_0027716 3300048925 Bacteria 4833
266 Ga0496122_0031948 3300048925 Bacteria 4364
267 Ga0496122_0042346 3300048925 Bacteria 3584
268 Ga0496122_0056904 3300048925 Bacteria 2910
269 Ga0496122_0092387 3300048925 Bacteria 2057
270 Ga0496122_0155227 3300048925 Bacteria 1405
271 Ga0496123_0000093 3300048926 Bacteria 179205
272 Ga0496123_0000524 3300048926 Bacteria 66159
273 Ga0496123_0009972 3300048926 Bacteria 8466
274 Ga0496123_0018686 3300048926 Bacteria 5496
275 Ga0496123_0024375 3300048926 Bacteria 4600
276 Ga0496123_0027913 3300048926 Bacteria 4190
277 Ga0496123_0046700 3300048926 Bacteria 2934
278 Ga0496124_0000462 3300048927 Bacteria 70383
279 Ga0496124_0002329 3300048927 Bacteria 25080
280 Ga0496124_0028604 3300048927 Bacteria 4984
281 Ga0496124_0030891 3300048927 Bacteria 4746
282 Ga0496124_0051807 3300048927 Bacteria 3490
283 Ga0496124_0209588 3300048927 Bacteria 1475
284 Ga0496125_0000041 3300048928 Bacteria 310158
285 Ga0496125_0021534 3300048928 Bacteria 6010
286 Ga0496125_0023932 3300048928 Bacteria 5627
287 Ga0496125_0040266 3300048928 Bacteria 4011
288 Ga0496125_0073020 3300048928 Bacteria 2670
289 Ga0496125_0129435 3300048928 Bacteria 1780
290 Ga0496126_0000299 3300048929 Bacteria 105208
291 Ga0496126_0026786 3300048929 Bacteria 5520
292 Ga0496126_0351028 3300048929 Bacteria 1206
293 Ga0501031_0005491 3300049568 Bacteria 8250
294 Ga0501031_0126291 3300049568 Bacteria 1671
295 Ga0501031_0151007 3300049568 Bacteria 1518
296 Ga0501032_0002804 3300049569 Bacteria 13554
297 Ga0501033_0003721 3300049570 Bacteria 12406
298 Ga0501033_0201347 3300049570 Bacteria 1422
299 Ga0501034_0006050 3300049571 Bacteria 13067
300 Ga0501034_0088107 3300049571 Bacteria 3103
301 Ga0501036_0003490 3300049572 Bacteria 12566
302 Ga0501037_0257951 3300049573 Bacteria 1218
303 Ga0501038_0006495 3300049574 Bacteria 10822
304 Ga0501039_0002578 3300049575 Bacteria 13540
305 Ga0501043_0003499 3300049579 Bacteria 12912
306 Ga0501046_0001795 3300049580 Bacteria 20473
307 Ga0501046_0053250 3300049580 Bacteria 3188
308 Ga0501047_0003954 3300049581 Bacteria 13934
309 Ga0501047_0293962 3300049581 Bacteria 1468
310 Ga0501048_0006983 3300049582 Bacteria 8581
311 Ga0501070_0008205 3300049586 Bacteria 8834
312 Ga0501073_0035352 3300049589 Bacteria 3553
313 Ga0501076_0201875 3300049592 Bacteria 1624
314 Ga0501080_0039014 3300049742 Bacteria 4432
315 Ga0501083_0207338 3300049744 Bacteria 1278
316 Ga0501035_0003248 3300049822 Bacteria 15578
317 Ga0501035_0237649 3300049822 Bacteria 1551
318 Ga0501044_0044192 3300049823 Bacteria 4625
319 Ga0501044_0262470 3300049823 Bacteria 1665
320 Ga0501045_0065593 3300049824 Bacteria 2665
321 nmdc:mga03683_72726_c1 3300050489 Bacteria 1473
322 nmdc:mga03n38_6879_c1 3300050490 Bacteria 3988
323 nmdc:mga03n38_78827_c1 3300050490 Bacteria 1543
324 nmdc:mga0yw44_147255_c1 3300050492 Bacteria 1534
325 nmdc:mga0yw44_30056_c1 3300050492 Bacteria 3144
326 nmdc:mga0yw44_32556_c1 3300050492 Bacteria 3039
327 nmdc:mga06z11_43028_c1 3300050494 Bacteria 2269
328 nmdc:mga06z11_78061_c1 3300050494 Bacteria 1769
329 nmdc:mga07m45_180184_c1 3300050496 Bacteria 1229
330 nmdc:mga0sz30_19730_c1 3300050516 Bacteria 2712
331 Ga0500610_0004653 3300053079 Bacteria 5490
332 Ga0500569_001519 3300053109 Bacteria 4397
333 Ga0500618_005944 3300053125 Bacteria 3641
334 Ga0500658_0005175 3300053134 Bacteria 4855
335 Ga0500559_0005903 3300053136 Bacteria 5576
336 Ga0500568_0000070 3300053139 Bacteria 99663
337 Ga0500568_0004843 3300053139 Bacteria 7109
338 Ga0500568_0027517 3300053139 Bacteria 2377
339 Ga0500590_001707 3300053148 Bacteria 9202
340 Ga0500616_0007322 3300053153 Bacteria 7035
341 Ga0500620_013555 3300053155 Bacteria 2251
342 Ga0500622_0000207 3300053156 Bacteria 62384
343 Ga0500622_0003264 3300053156 Bacteria 11005
344 Ga0501082_0176052 3300060353 Bacteria 1860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026142 Ga0207698_10236287 Ga0207698_102362872 276
2 iso_pu_bacteria 3004232784 3004238480 282
3 iso_pu_bacteria 2906427513 2906434762 284
4 iso_pu_bacteria 2751185821 2753460433 297
5 iso_pu_bacteria 2937980651 2937988360 299
6 iso_pu_bacteria 2836160341 2836166795 301
7 iso_pu_bacteria 2856356410 2856357690 306
8 iso_pu_bacteria 2515154107 2515609822 311
9 iso_pu_bacteria 2936996657 2936996712 311
10 3300053139 Ga0500568_0000070 Ga0500568_0000070_66330_67343 312
11 iso_pu_bacteria 2821443989 2821449676 312
12 iso_pu_bacteria 2894817345 2894820751 312
13 iso_pu_bacteria 2582581283 2585167130 313
14 iso_pu_bacteria 2909042592 2909045433 313
15 3300048922 Ga0496119_0001100 Ga0496119_0001100_28324_29343 314
16 iso_pu_bacteria 2582581307 2585272612 314
17 iso_pu_bacteria 2585427531 2585562280 314
18 iso_pu_bacteria 2615840698 2616551944 314
19 iso_pu_bacteria 2847417321 2847422037 314
20 iso_pu_bacteria 2855872281 2855875008 314
21 iso_pu_bacteria 2856364286 2856371487 314
22 iso_pu_bacteria 2869285874 2869289592 314
23 iso_pu_bacteria 2871429161 2871431658 314
24 iso_pu_bacteria 2874146452 2874154800 314
25 iso_pu_bacteria 2874155637 2874162181 314
26 iso_pu_bacteria 2876413966 2876420366 314
27 iso_pu_bacteria 2878745973 2878748264 314
28 iso_pu_bacteria 2903492973 2903505836 314
29 iso_pu_bacteria 2906308376 2906311881 314
30 iso_pu_bacteria 2906321335 2906323618 314
31 iso_pu_bacteria 2924754689 2924758457 314
32 iso_pu_bacteria 2937813078 2937818300 314
33 iso_pu_bacteria 2958130278 2958133965 314
34 iso_pu_bacteria 2958179912 2958183611 314
35 iso_pu_bacteria 2961077736 2961081577 314
36 iso_pu_bacteria 2977843712 2977850948 314
37 iso_pu_bacteria 2977864932 2977868515 314
38 iso_pu_bacteria 8004387939 8004391470 314
39 iso_pu_bacteria 8004395343 8004403047 314
40 iso_pu_bacteria 8004714634 8004716839 314
41 3300009098 Ga0105245_10060891 Ga0105245_100608912 315
42 iso_pu_bacteria 2503198000 2503203832 315
43 iso_pu_bacteria 2508501122 2509110448 315
44 iso_pu_bacteria 2508501123 2509117361 315
45 iso_pu_bacteria 2508501127 2509141376 315
46 iso_pu_bacteria 2509276018 2509369188 315
47 iso_pu_bacteria 2509276019 2509379473 315
48 iso_pu_bacteria 2509276021 2509391092 315
49 iso_pu_bacteria 2509276022 2509398193 315
50 iso_pu_bacteria 2510065019 2510135974 315
51 iso_pu_bacteria 2510065057 2510303024 315
52 iso_pu_bacteria 2510065059 2510316920 315
53 iso_pu_bacteria 2510461076 2510892516 315
54 iso_pu_bacteria 2510917028 2511181536 315
55 iso_pu_bacteria 2510917030 2511197372 315
56 iso_pu_bacteria 2511231052 2511497023 315
57 iso_pu_bacteria 2512875016 2512929119 315
58 iso_pu_bacteria 2512875024 2512963923 315
59 iso_pu_bacteria 2512875026 2512968964 315
60 iso_pu_bacteria 2513237084 2513568277 315
61 iso_pu_bacteria 2513237085 2513578182 315
62 iso_pu_bacteria 2513237086 2513582805 315
63 iso_pu_bacteria 2513237089 2513605984 315
64 iso_pu_bacteria 2513237090 2513611308 315
65 iso_pu_bacteria 2513237091 2513614862 315
66 iso_pu_bacteria 2513237093 2513634819 315
67 iso_pu_bacteria 2513237103 2513713819 315
68 iso_pu_bacteria 2513237138 2513866143 315
69 iso_pu_bacteria 2513237140 2513882371 315
70 iso_pu_bacteria 2513237143 2513901687 315
71 iso_pu_bacteria 2513237144 2513911979 315
72 iso_pu_bacteria 2513237156 2513985128 315
73 iso_pu_bacteria 2513237159 2514000813 315
74 iso_pu_bacteria 2513237160 2514005983 315
75 iso_pu_bacteria 2513237162 2514021913 315
76 iso_pu_bacteria 2513237164 2514035799 315
77 iso_pu_bacteria 2513237305 2514421664 315
78 iso_pu_bacteria 2515075009 2515109084 315
79 iso_pu_bacteria 2515154107 2515611599 315
80 iso_pu_bacteria 2515154113 2515632411 315
81 iso_pu_bacteria 2515154114 2515640702 315
82 iso_pu_bacteria 2515154116 2515661630 315
83 iso_pu_bacteria 2515154134 2515737900 315
84 iso_pu_bacteria 2516143018 2516207905 315
85 iso_pu_bacteria 2516653046 2516895747 315
86 iso_pu_bacteria 2516653077 2517041402 315
87 iso_pu_bacteria 2516653085 2517079963 315
88 iso_pu_bacteria 2517093000 2517097984 315
89 iso_pu_bacteria 2517287029 2517410230 315
90 iso_pu_bacteria 2517487022 2517566283 315
91 iso_pu_bacteria 2524023207 2524449249 315
92 iso_pu_bacteria 2524023209 2524459261 315
93 iso_pu_bacteria 2529292951 2530648499 315
94 iso_pu_bacteria 2534681796 2535520241 315
95 iso_pu_bacteria 2551306084 2551678786 315
96 iso_pu_bacteria 2551306084 2551682024 315
97 iso_pu_bacteria 2551306085 2551683336 315
98 iso_pu_bacteria 2551306086 2551696787 315
99 iso_pu_bacteria 2551306087 2551700841 315
100 iso_pu_bacteria 2551306089 2551714352 315
101 iso_pu_bacteria 2551306090 2551716676 315
102 iso_pu_bacteria 2551306091 2551727739 315
103 iso_pu_bacteria 2551306092 2551735831 315
104 iso_pu_bacteria 2551306093 2551744325 315
105 iso_pu_bacteria 2558860100 2558861398 315
106 iso_pu_bacteria 2582581294 2585200679 315
107 iso_pu_bacteria 2582581298 2585226817 315
108 iso_pu_bacteria 2582581299 2585230299 315
109 iso_pu_bacteria 2582581304 2585255263 315
110 iso_pu_bacteria 2582581306 2585270266 315
111 iso_pu_bacteria 2582581308 2585281176 315
112 iso_pu_bacteria 2582581315 2585327262 315
113 iso_pu_bacteria 2582581316 2585335257 315
114 iso_pu_bacteria 2582581865 2585390488 315
115 iso_pu_bacteria 2582581866 2585397995 315
116 iso_pu_bacteria 2582581867 2585404746 315
117 iso_pu_bacteria 2585427526 2585525797 315
118 iso_pu_bacteria 2585427527 2585536741 315
119 iso_pu_bacteria 2585427528 2585541647 315
120 iso_pu_bacteria 2585427529 2585550232 315
121 iso_pu_bacteria 2585427530 2585557305 315
122 iso_pu_bacteria 2585427590 2585823395 315
123 iso_pu_bacteria 2585427593 2585840134 315
124 iso_pu_bacteria 2585427594 2585842659 315
125 iso_pu_bacteria 2585427608 2585896716 315
126 iso_pu_bacteria 2615840624 2616294803 315
127 iso_pu_bacteria 2615840626 2616312246 315
128 iso_pu_bacteria 2617270742 2617385581 315
129 iso_pu_bacteria 2643221595 2643986390 315
130 iso_pu_bacteria 2643221599 2644003983 315
131 iso_pu_bacteria 2643221607 2644048144 315
132 iso_pu_bacteria 2643221626 2644147080 315
133 iso_pu_bacteria 2643221627 2644152622 315
134 iso_pu_bacteria 2643221634 2644195474 315
135 iso_pu_bacteria 2643221636 2644203366 315
136 iso_pu_bacteria 2643221655 2644310567 315
137 iso_pu_bacteria 2643221659 2644334648 315
138 iso_pu_bacteria 2643221686 2644480937 315
139 iso_pu_bacteria 2643221689 2644497606 315
140 iso_pu_bacteria 2643221698 2644545157 315
141 iso_pu_bacteria 2643221712 2644612669 315
142 iso_pu_bacteria 2667528174 2671114449 315
143 iso_pu_bacteria 2687453392 2688600714 315
144 iso_pu_bacteria 2718217882 2719184430 315
145 iso_pu_bacteria 2718218009 2719728450 315
146 iso_pu_bacteria 2718218232 2720610605 315
147 iso_pu_bacteria 2718218233 2720618175 315
148 iso_pu_bacteria 2718218363 2721144138 315
149 iso_pu_bacteria 2718218365 2721156235 315
150 iso_pu_bacteria 2718218366 2721161513 315
151 iso_pu_bacteria 2721755514 2722842658 315
152 iso_pu_bacteria 2721755556 2723030676 315
153 iso_pu_bacteria 2721755684 2723565093 315
154 iso_pu_bacteria 2721755686 2723578174 315
155 iso_pu_bacteria 2721755810 2724041475 315
156 iso_pu_bacteria 2721755823 2724113612 315
157 iso_pu_bacteria 2724679232 2725947063 315
158 iso_pu_bacteria 2728369352 2730111209 315
159 iso_pu_bacteria 2728369365 2730160546 315
160 iso_pu_bacteria 2728369397 2730295768 315
161 iso_pu_bacteria 2738541293 2738799833 315
162 iso_pu_bacteria 2738541333 2739036261 315
163 iso_pu_bacteria 2751185800 2753357096 315
164 iso_pu_bacteria 2756170246 2756672687 315
165 iso_pu_bacteria 2758568016 2758639382 315
166 iso_pu_bacteria 2765235942 2766069248 315
167 iso_pu_bacteria 2775507266 2778176581 315
168 iso_pu_bacteria 2791355091 2792624111 315
169 iso_pu_bacteria 2791355092 2792629487 315
170 iso_pu_bacteria 2791355094 2792640746 315
171 iso_pu_bacteria 2791355123 2792745570 315
172 iso_pu_bacteria 2791355260 2793323159 315
173 iso_pu_bacteria 2791355261 2793330499 315
174 iso_pu_bacteria 2791355263 2793342784 315
175 iso_pu_bacteria 2791355264 2793345315 315
176 iso_pu_bacteria 2791355266 2793363351 315
177 iso_pu_bacteria 2791355267 2793365053 315
178 iso_pu_bacteria 2802428858 2802719813 315
179 iso_pu_bacteria 2802428859 2802727816 315
180 iso_pu_bacteria 2802428860 2802733316 315
181 iso_pu_bacteria 2802428861 2802738872 315
182 iso_pu_bacteria 2802428862 2802745529 315
183 iso_pu_bacteria 2802428863 2802751294 315
184 iso_pu_bacteria 2802429633 2806046364 315
185 iso_pu_bacteria 2802429634 2806053100 315
186 iso_pu_bacteria 2802429635 2806059692 315
187 iso_pu_bacteria 2802429636 2806068570 315
188 iso_pu_bacteria 2802429637 2806074992 315
189 iso_pu_bacteria 2818991448 2819607574 315
190 iso_pu_bacteria 2818991453 2819641713 315
191 iso_pu_bacteria 2838016132 2838016551 315
192 iso_pu_bacteria 2838029111 2838032074 315
193 iso_pu_bacteria 2838068647 2838069085 315
194 iso_pu_bacteria 2838686498 2838687682 315
195 iso_pu_bacteria 2838729681 2838735569 315
196 iso_pu_bacteria 2838742623 2838748471 315
197 iso_pu_bacteria 2841734538 2841735261 315
198 iso_pu_bacteria 2841851746 2841854229 315
199 iso_pu_bacteria 2841864319 2841865571 315
200 iso_pu_bacteria 2842110456 2842111365 315
201 iso_pu_bacteria 2842156927 2842159403 315
202 iso_pu_bacteria 2842163707 2842163842 315
203 iso_pu_bacteria 2842180545 2842183028 315
204 iso_pu_bacteria 2842217011 2842223834 315
205 iso_pu_bacteria 2842229732 2842232739 315
206 iso_pu_bacteria 2842243621 2842247018 315
207 iso_pu_bacteria 2842257432 2842259296 315
208 iso_pu_bacteria 2842264693 2842265425 315
209 iso_pu_bacteria 2842271015 2842272286 315
210 iso_pu_bacteria 2842285085 2842287865 315
211 iso_pu_bacteria 2842298080 2842301049 315
212 iso_pu_bacteria 2842304105 2842309262 315
213 iso_pu_bacteria 2842341865 2842345501 315
214 iso_pu_bacteria 2842357229 2842359936 315
215 iso_pu_bacteria 2842363717 2842363797 315
216 iso_pu_bacteria 2842395702 2842397268 315
217 iso_pu_bacteria 2842402390 2842405131 315
218 iso_pu_bacteria 2842409023 2842412112 315
219 iso_pu_bacteria 2842415677 2842418361 315
220 iso_pu_bacteria 2842422224 2842422275 315
221 iso_pu_bacteria 2842428310 2842428524 315
222 iso_pu_bacteria 2842434925 2842435138 315
223 iso_pu_bacteria 2842441272 2842441999 315
224 iso_pu_bacteria 2842462802 2842462950 315
225 iso_pu_bacteria 2842469257 2842469470 315
226 iso_pu_bacteria 2842475841 2842478806 315
227 iso_pu_bacteria 2842482326 2842486518 315
228 iso_pu_bacteria 2842502639 2842505875 315
229 iso_pu_bacteria 2842509118 2842513770 315
230 iso_pu_bacteria 2842521101 2842525440 315
231 iso_pu_bacteria 2842922631 2842922982 315
232 iso_pu_bacteria 2844002411 2844005143 315
233 iso_pu_bacteria 2844009547 2844016064 315
234 iso_pu_bacteria 2844163670 2844165655 315
235 iso_pu_bacteria 2844454524 2844460677 315
236 iso_pu_bacteria 2848992105 2848997014 315
237 iso_pu_bacteria 2850079185 2850084636 315
238 iso_pu_bacteria 2852387548 2852395041 315
239 iso_pu_bacteria 2854911287 2854915002 315
240 iso_pu_bacteria 2855825444 2855829436 315
241 iso_pu_bacteria 2855839649 2855844535 315
242 iso_pu_bacteria 2856320880 2856326466 315
243 iso_pu_bacteria 2856328259 2856330154 315
244 iso_pu_bacteria 2856334872 2856336856 315
245 iso_pu_bacteria 2857349434 2857349547 315
246 iso_pu_bacteria 2857367948 2857369069 315
247 iso_pu_bacteria 2857516855 2857518237 315
248 iso_pu_bacteria 2858800743 2858806004 315
249 iso_pu_bacteria 2869234852 2869238163 315
250 iso_pu_bacteria 2869242130 2869244254 315
251 iso_pu_bacteria 2869249662 2869253222 315
252 iso_pu_bacteria 2869256925 2869259162 315
253 iso_pu_bacteria 2869264136 2869265062 315
254 iso_pu_bacteria 2869271264 2869274899 315
255 iso_pu_bacteria 2869278585 2869283911 315
256 iso_pu_bacteria 2871435913 2871437322 315
257 iso_pu_bacteria 2871451962 2871455766 315
258 iso_pu_bacteria 2871459585 2871460311 315
259 iso_pu_bacteria 2871466892 2871469177 315
260 iso_pu_bacteria 2871474448 2871479223 315
261 iso_pu_bacteria 2871481445 2871485084 315
262 iso_pu_bacteria 2874109183 2874110428 315
263 iso_pu_bacteria 2874116593 2874117269 315
264 iso_pu_bacteria 2874123672 2874131378 315
265 iso_pu_bacteria 2874131515 2874135560 315
266 iso_pu_bacteria 2874139085 2874144530 315
267 iso_pu_bacteria 2874162495 2874164137 315
268 iso_pu_bacteria 2874168670 2874171141 315
269 iso_pu_bacteria 2876363079 2876367323 315
270 iso_pu_bacteria 2876386047 2876387623 315
271 iso_pu_bacteria 2876399893 2876401795 315
272 iso_pu_bacteria 2876406927 2876410491 315
273 iso_pu_bacteria 2876420981 2876425578 315
274 iso_pu_bacteria 2878730984 2878737813 315
275 iso_pu_bacteria 2878738818 2878744094 315
276 iso_pu_bacteria 2878774303 2878774939 315
277 iso_pu_bacteria 2878781027 2878784259 315
278 iso_pu_bacteria 2881861095 2881863065 315
279 iso_pu_bacteria 2882632389 2882637542 315
280 iso_pu_bacteria 2885312484 2885315665 315
281 iso_pu_bacteria 2885318864 2885323293 315
282 iso_pu_bacteria 2888337043 2888341626 315
283 iso_pu_bacteria 2889790730 2889794637 315
284 iso_pu_bacteria 2891373044 2891375914 315
285 iso_pu_bacteria 2903448605 2903453207 315
286 iso_pu_bacteria 2903513507 2903518341 315
287 iso_pu_bacteria 2903521522 2903526814 315
288 iso_pu_bacteria 2903528002 2903530567 315
289 iso_pu_bacteria 2906363423 2906368586 315
290 iso_pu_bacteria 2906370794 2906373162 315
291 iso_pu_bacteria 2906378014 2906382292 315
292 iso_pu_bacteria 2906393657 2906400123 315
293 iso_pu_bacteria 2906401398 2906404857 315
294 iso_pu_bacteria 2906408224 2906409824 315
295 iso_pu_bacteria 2915650412 2915654477 315
296 iso_pu_bacteria 2915980308 2915984084 315
297 iso_pu_bacteria 2915986958 2915989913 315
298 iso_pu_bacteria 2915993759 2915993911 315
299 iso_pu_bacteria 2916000859 2916003326 315
300 iso_pu_bacteria 2916007675 2916007846 315
301 iso_pu_bacteria 2916014648 2916015729 315
302 iso_pu_bacteria 2916021584 2916021744 315
303 iso_pu_bacteria 2916028427 2916028446 315
304 iso_pu_bacteria 2916035215 2916037448 315
305 iso_pu_bacteria 2916041962 2916042095 315
306 iso_pu_bacteria 2916048683 2916048868 315
307 iso_pu_bacteria 2916055098 2916059783 315
308 iso_pu_bacteria 2916061851 2916063393 315
309 iso_pu_bacteria 2916068649 2916074347 315
310 iso_pu_bacteria 2916076590 2916081258 315
311 iso_pu_bacteria 2919100787 2919102177 315
312 iso_pu_bacteria 2919408235 2919413172 315
313 iso_pu_bacteria 2921201388 2921202205 315
314 iso_pu_bacteria 2921208531 2921212688 315
315 iso_pu_bacteria 2921237296 2921237416 315
316 iso_pu_bacteria 2921244191 2921250054 315
317 iso_pu_bacteria 2921250672 2921256619 315
318 iso_pu_bacteria 2921257292 2921259377 315
319 iso_pu_bacteria 2921263974 2921268174 315
320 iso_pu_bacteria 2921282425 2921282956 315
321 iso_pu_bacteria 2921289301 2921294666 315
322 iso_pu_bacteria 2922151315 2922154713 315
323 iso_pu_bacteria 2922172374 2922176271 315
324 iso_pu_bacteria 2922178524 2922179642 315
325 iso_pu_bacteria 2923556063 2923562416 315
326 iso_pu_bacteria 2924144063 2924148065 315
327 iso_pu_bacteria 2924150972 2924157104 315
328 iso_pu_bacteria 2924158325 2924161785 315
329 iso_pu_bacteria 2924165586 2924165621 315
330 iso_pu_bacteria 2924172951 2924174959 315
331 iso_pu_bacteria 2924179722 2924180646 315
332 iso_pu_bacteria 2924186466 2924188204 315
333 iso_pu_bacteria 2924193448 2924196897 315
334 iso_pu_bacteria 2924200457 2924200614 315
335 iso_pu_bacteria 2924207177 2924207237 315
336 iso_pu_bacteria 2924214083 2924217299 315
337 iso_pu_bacteria 2924221636 2924224162 315
338 iso_pu_bacteria 2924228884 2924228954 315
339 iso_pu_bacteria 2924710171 2924717606 315
340 iso_pu_bacteria 2924718760 2924719276 315
341 iso_pu_bacteria 2924733363 2924737542 315
342 iso_pu_bacteria 2924741084 2924741472 315
343 iso_pu_bacteria 2924748358 2924752485 315
344 iso_pu_bacteria 2924776078 2924782011 315
345 iso_pu_bacteria 2924784321 2924786110 315
346 iso_pu_bacteria 2928521798 2928526062 315
347 iso_pu_bacteria 2933016740 2933017716 315
348 iso_pu_bacteria 2933570622 2933575637 315
349 iso_pu_bacteria 2933586486 2933587919 315
350 iso_pu_bacteria 2933599457 2933599752 315
351 iso_pu_bacteria 2935901341 2935902942 315
352 iso_pu_bacteria 2936367885 2936374162 315
353 iso_pu_bacteria 2936375103 2936375319 315
354 iso_pu_bacteria 2936381700 2936387051 315
355 iso_pu_bacteria 2936996657 2936999048 315
356 iso_pu_bacteria 2937002841 2937003077 315
357 iso_pu_bacteria 2937009748 2937009926 315
358 iso_pu_bacteria 2937016420 2937020363 315
359 iso_pu_bacteria 2937023124 2937025245 315
360 iso_pu_bacteria 2937029754 2937033206 315
361 iso_pu_bacteria 2937036028 2937037665 315
362 iso_pu_bacteria 2937042894 2937047252 315
363 iso_pu_bacteria 2937049772 2937050672 315
364 iso_pu_bacteria 2937056579 2937058463 315
365 iso_pu_bacteria 2937063883 2937064004 315
366 iso_pu_bacteria 2937071275 2937072333 315
367 iso_pu_bacteria 2937078374 2937084495 315
368 iso_pu_bacteria 2937084907 2937087084 315
369 iso_pu_bacteria 2937091812 2937094338 315
370 iso_pu_bacteria 2937098957 2937101522 315
371 iso_pu_bacteria 2937106411 2937110132 315
372 iso_pu_bacteria 2937113482 2937115507 315
373 iso_pu_bacteria 2937119839 2937120012 315
374 iso_pu_bacteria 2937126314 2937128130 315
375 iso_pu_bacteria 2937836603 2937839549 315
376 iso_pu_bacteria 2937848649 2937850902 315
377 iso_pu_bacteria 2937861824 2937866991 315
378 iso_pu_bacteria 2937868953 2937875308 315
379 iso_pu_bacteria 2937877337 2937884662 315
380 iso_pu_bacteria 2937972304 2937977933 315
381 iso_pu_bacteria 2941499720 2941505456 315
382 iso_pu_bacteria 2957375807 2957381257 315
383 iso_pu_bacteria 2957382221 2957382353 315
384 iso_pu_bacteria 2957388812 2957395438 315
385 iso_pu_bacteria 2957395598 2957400806 315
386 iso_pu_bacteria 2957402308 2957404201 315
387 iso_pu_bacteria 2957408893 2957414866 315
388 iso_pu_bacteria 2957415311 2957421193 315
389 iso_pu_bacteria 2957422303 2957429748 315
390 iso_pu_bacteria 2957430029 2957432114 315
391 iso_pu_bacteria 2957437181 2957437745 315
392 iso_pu_bacteria 2957443900 2957445926 315
393 iso_pu_bacteria 2957450854 2957451030 315
394 iso_pu_bacteria 2957457609 2957461670 315
395 iso_pu_bacteria 2957464669 2957467984 315
396 iso_pu_bacteria 2957471148 2957474598 315
397 iso_pu_bacteria 2957478035 2957483376 315
398 iso_pu_bacteria 2957484790 2957487247 315
399 iso_pu_bacteria 2957491536 2957496493 315
400 iso_pu_bacteria 2957498199 2957504819 315
401 iso_pu_bacteria 2957505466 2957505620 315
402 iso_pu_bacteria 2958034702 2958040301 315
403 iso_pu_bacteria 2958041894 2958055149 315
404 iso_pu_bacteria 2958071322 2958075742 315
405 iso_pu_bacteria 2958084443 2958091970 315
406 iso_pu_bacteria 2958092219 2958099059 315
407 iso_pu_bacteria 2958108152 2958111763 315
408 iso_pu_bacteria 2958122699 2958128403 315
409 iso_pu_bacteria 2958137437 2958141857 315
410 iso_pu_bacteria 2958144490 2958151466 315
411 iso_pu_bacteria 2958158011 2958159167 315
412 iso_pu_bacteria 2960584000 2960584203 315
413 iso_pu_bacteria 2960591022 2960596905 315
414 iso_pu_bacteria 2960597568 2960603014 315
415 iso_pu_bacteria 2960603979 2960604081 315
416 iso_pu_bacteria 2960610863 2960611026 315
417 iso_pu_bacteria 2960617483 2960622391 315
418 iso_pu_bacteria 2960624210 2960625252 315
419 iso_pu_bacteria 2960631154 2960631593 315
420 iso_pu_bacteria 2960637947 2960639805 315
421 iso_pu_bacteria 2960645483 2960649147 315
422 iso_pu_bacteria 2960652885 2960659677 315
423 iso_pu_bacteria 2960660292 2960663774 315
424 iso_pu_bacteria 2960667422 2960667585 315
425 iso_pu_bacteria 2960674078 2960676504 315
426 iso_pu_bacteria 2960680706 2960684744 315
427 iso_pu_bacteria 2960693952 2960699903 315
428 iso_pu_bacteria 2961136820 2961141409 315
429 iso_pu_bacteria 2961183825 2961186186 315
430 iso_pu_bacteria 2963644680 2963650116 315
431 iso_pu_bacteria 2964607997 2964610098 315
432 iso_pu_bacteria 2964615318 2964615548 315
433 iso_pu_bacteria 2964621998 2964626094 315
434 iso_pu_bacteria 2964628898 2964629041 315
435 iso_pu_bacteria 2964636051 2964636148 315
436 iso_pu_bacteria 2964643177 2964643350 315
437 iso_pu_bacteria 2964649959 2964653889 315
438 iso_pu_bacteria 2964656573 2964656750 315
439 iso_pu_bacteria 2964663802 2964663976 315
440 iso_pu_bacteria 2964670856 2964676614 315
441 iso_pu_bacteria 2964678106 2964678117 315
442 iso_pu_bacteria 2964685014 2964688995 315
443 iso_pu_bacteria 2964691889 2964694096 315
444 iso_pu_bacteria 2964698721 2964698937 315
445 iso_pu_bacteria 2964705432 2964711164 315
446 iso_pu_bacteria 2964712639 2964717852 315
447 iso_pu_bacteria 2964719344 2964723370 315
448 iso_pu_bacteria 2965025482 2965027394 315
449 iso_pu_bacteria 2965032056 2965039704 315
450 iso_pu_bacteria 2965040258 2965044047 315
451 iso_pu_bacteria 2965047637 2965051782 315
452 iso_pu_bacteria 2965062239 2965065454 315
453 iso_pu_bacteria 2965089291 2965093199 315
454 iso_pu_bacteria 2965102966 2965106683 315
455 iso_pu_bacteria 2965110997 2965117121 315
456 iso_pu_bacteria 2967664464 2967664590 315
457 iso_pu_bacteria 2967671571 2967671745 315
458 iso_pu_bacteria 2967678726 2967681336 315
459 iso_pu_bacteria 2967686174 2967689417 315
460 iso_pu_bacteria 2967693043 2967698489 315
461 iso_pu_bacteria 2967699805 2967699830 315
462 iso_pu_bacteria 2967706974 2967714077 315
463 iso_pu_bacteria 2967714385 2967718561 315
464 iso_pu_bacteria 2967721400 2967721435 315
465 iso_pu_bacteria 2967728569 2967730770 315
466 iso_pu_bacteria 2967735183 2967737381 315
467 iso_pu_bacteria 2967742019 2967744406 315
468 iso_pu_bacteria 2967748971 2967749146 315
469 iso_pu_bacteria 2967755722 2967755897 315
470 iso_pu_bacteria 2967762386 2967762454 315
471 iso_pu_bacteria 2967769361 2967769478 315
472 iso_pu_bacteria 2967775926 2967775991 315
473 iso_pu_bacteria 2968016561 2968022072 315
474 iso_pu_bacteria 2968083720 2968086573 315
475 iso_pu_bacteria 2968091066 2968094574 315
476 iso_pu_bacteria 2968138860 2968145176 315
477 iso_pu_bacteria 2970019648 2970019773 315
478 iso_pu_bacteria 2970026789 2970028555 315
479 iso_pu_bacteria 2970033650 2970033825 315
480 iso_pu_bacteria 2970040964 2970044006 315
481 iso_pu_bacteria 2970047711 2970053141 315
482 iso_pu_bacteria 2970054988 2970055640 315
483 iso_pu_bacteria 2970061556 2970063826 315
484 iso_pu_bacteria 2970068827 2970069001 315
485 iso_pu_bacteria 2970076120 2970078041 315
486 iso_pu_bacteria 2970082768 2970084433 315
487 iso_pu_bacteria 2970088815 2970091931 315
488 iso_pu_bacteria 2970095765 2970095940 315
489 iso_pu_bacteria 2970102677 2970102852 315
490 iso_pu_bacteria 2970109326 2970111313 315
491 iso_pu_bacteria 2970116247 2970119086 315
492 iso_pu_bacteria 2970122695 2970125581 315
493 iso_pu_bacteria 2970129317 2970135300 315
494 iso_pu_bacteria 2970136068 2970136087 315
495 iso_pu_bacteria 2970143518 2970146095 315
496 iso_pu_bacteria 2970149975 2970152097 315
497 iso_pu_bacteria 2970156795 2970159945 315
498 iso_pu_bacteria 2970164137 2970165511 315
499 iso_pu_bacteria 2970170962 2970171156 315
500 iso_pu_bacteria 2970177841 2970180049 315
501 iso_pu_bacteria 2970184632 2970188181 315
502 iso_pu_bacteria 2970191845 2970191885 315
503 iso_pu_bacteria 2970469710 2970474662 315
504 iso_pu_bacteria 2970489779 2970491792 315
505 iso_pu_bacteria 2970510686 2970511002 315
506 iso_pu_bacteria 2970532167 2970535295 315
507 iso_pu_bacteria 2970547951 2970549649 315
508 iso_pu_bacteria 2970593180 2970598524 315
509 iso_pu_bacteria 2970619444 2970620770 315
510 iso_pu_bacteria 2970627176 2970629061 315
511 iso_pu_bacteria 2977516862 2977519509 315
512 iso_pu_bacteria 2977523885 2977525901 315
513 iso_pu_bacteria 2977530762 2977534824 315
514 iso_pu_bacteria 2977537788 2977539805 315
515 iso_pu_bacteria 2977544691 2977545330 315
516 iso_pu_bacteria 2977551784 2977556125 315
517 iso_pu_bacteria 2977558990 2977559039 315
518 iso_pu_bacteria 2977565890 2977566110 315
519 iso_pu_bacteria 2977572785 2977573577 315
520 iso_pu_bacteria 2977579622 2977585059 315
521 iso_pu_bacteria 2977851361 2977855743 315
522 iso_pu_bacteria 2977858184 2977862551 315
523 iso_pu_bacteria 2977872689 2977877316 315
524 iso_pu_bacteria 2977898635 2977904449 315
525 iso_pu_bacteria 2977907340 2977909279 315
526 iso_pu_bacteria 2977915119 2977922091 315
527 iso_pu_bacteria 2977922695 2977923878 315
528 iso_pu_bacteria 2977935797 2977937362 315
529 iso_pu_bacteria 2977942078 2977944279 315
530 iso_pu_bacteria 2977950692 2977951197 315
531 iso_pu_bacteria 2977957713 2977960029 315
532 iso_pu_bacteria 2979764755 2979766936 315
533 iso_pu_bacteria 2979772303 2979774173 315
534 iso_pu_bacteria 2979793036 2979796810 315
535 iso_pu_bacteria 2987636660 2987645454 315
536 iso_pu_bacteria 2987645492 2987647702 315
537 iso_pu_bacteria 2987673487 2987676297 315
538 iso_pu_bacteria 2989349275 2989354430 315
539 iso_pu_bacteria 2989771324 2989772896 315
540 iso_pu_bacteria 2996348954 2996354071 315
541 iso_pu_bacteria 2996386984 2996391172 315
542 iso_pu_bacteria 3000135777 3000141146 315
543 iso_pu_bacteria 3004167301 3004171601 315
544 iso_pu_bacteria 3004195979 3004201982 315
545 iso_pu_bacteria 3004203850 3004206361 315
546 iso_pu_bacteria 3004211236 3004213316 315
547 iso_pu_bacteria 3004218560 3004221388 315
548 iso_pu_bacteria 3004239961 3004244124 315
549 iso_pu_bacteria 3004248173 3004255600 315
550 iso_pu_bacteria 3004268573 3004270188 315
551 iso_pu_bacteria 3004275668 3004280739 315
552 iso_pu_bacteria 3004289098 3004290908 315
553 iso_pu_bacteria 3004334049 3004338883 315
554 iso_pu_bacteria 3005409236 3005414673 315
555 iso_pu_bacteria 3005416602 3005421984 315
556 iso_pu_bacteria 3005445848 3005452034 315
557 iso_pu_bacteria 3005452660 3005458518 315
558 iso_pu_bacteria 637000159 637078879 315
559 iso_pu_bacteria 639633055 639645150 315
560 iso_pu_bacteria 643692032 643824053 315
561 iso_pu_bacteria 648276728 648735547 315
562 iso_pu_bacteria 649633066 649875167 315
563 iso_pu_bacteria 8003992118 8003997059 315
564 iso_pu_bacteria 8003999396 8004004753 315
565 iso_pu_bacteria 8004300914 8004303262 315
566 iso_pu_bacteria 8004361976 8004369214 315
567 iso_pu_bacteria 8004633249 8004638654 315
568 iso_pu_bacteria 8004640170 8004643753 315
569 iso_pu_bacteria 8004695233 8004703720 315
570 iso_pu_bacteria 8004727605 8004733617 315
571 iso_pu_bacteria 8005282627 8005284996 315
572 iso_pu_bacteria 8005301065 8005306374 315
573 iso_pu_bacteria 8005307578 8005307714 315
574 iso_pu_bacteria 8005314921 8005321265 315
575 iso_pu_bacteria 8005376324 8005380024 315
576 iso_pu_bacteria 8005395548 8005399089 315
577 iso_pu_bacteria 8005460587 8005467427 315
578 iso_pu_bacteria 8005542996 8005547979 315
579 iso_pu_bacteria 8005556819 8005563554 315
580 iso_pu_bacteria 8005563573 8005565330 315
581 iso_pu_bacteria 8005570704 8005572369 315
582 iso_pu_bacteria 8005626139 8005626207 315
583 iso_pu_bacteria 8005645114 8005650858 315
584 iso_pu_bacteria 8005682033 8005687832 315
585 iso_pu_bacteria 8005688590 8005693930 315
586 iso_pu_bacteria 8005695170 8005701300 315
587 iso_pu_bacteria 8018127388 8018131841 315
588 iso_pu_bacteria 8018163183 8018165712 315
589 iso_pu_bacteria 8018176218 8018179152 315
590 iso_pu_bacteria 8023680758 8023687901 315
591 iso_pu_bacteria 8024479707 8024484840 315
592 iso_pu_bacteria 8024486573 8024493130 315
593 iso_pu_bacteria 8054558443 8054560425 315
594 iso_pu_bacteria 8056375014 8056377787 315
595 iso_pu_bacteria 8057575449 8057576307 315
596 iso_pu_bacteria 8057874678 8057877814 315
597 3300025284 Ga0209130_1000880 Ga0209130_100088016 316
598 3300025294 Ga0209025_1000429 Ga0209025_100042934 316
599 3300025297 Ga0209758_1001704 Ga0209758_10017043 316
600 3300025302 Ga0207426_1000085 Ga0207426_1000085143 316
601 3300026067 Ga0207678_10032285 Ga0207678_100322853 316
602 3300037853 Ga0436364_0405304 Ga0436364_0405304_737_1780 316
603 3300048925 Ga0496122_0001245 Ga0496122_0001245_22893_23918 316
604 3300048926 Ga0496123_0000524 Ga0496123_0000524_4717_5742 316
605 iso_pu_bacteria 2597489875 2597815627 316
606 iso_pu_bacteria 2856342000 2856346080 316
607 iso_pu_bacteria 2970524798 2970531130 316
608 iso_pu_bacteria 2970540015 2970540798 316
609 iso_pu_bacteria 8055617313 8055623706 316
610 3300006051 Ga0075364_10005092 Ga0075364_100050922 317
611 3300039062 Ga0400483_095688 Ga0400483_095688_200_1252 317
612 3300039062 Ga0400483_248197 Ga0400483_248197_9150_10202 317
613 iso_pu_bacteria 2588253730 2588514357 317
614 3300006353 Ga0075370_10004228 Ga0075370_100042285 318
615 3300031901 Ga0307406_10017175 Ga0307406_100171754 318
616 3300048919 Ga0496116_0018046 Ga0496116_0018046_913_1947 318
617 3300048920 Ga0496117_0001218 Ga0496117_0001218_36517_37551 318
618 3300048921 Ga0496118_0006410 Ga0496118_0006410_11792_12826 318
619 3300048925 Ga0496122_0022991 Ga0496122_0022991_4275_5309 318
620 3300048926 Ga0496123_0018686 Ga0496123_0018686_4049_5083 318
621 3300048927 Ga0496124_0002329 Ga0496124_0002329_19516_20550 318
622 iso_pu_bacteria 2690316117 2692319462 318
623 3300002704 JGI25155J39150_1000015 JGI25155J39150_100001576 319
624 3300002705 JGI25156J39149_1000007 JGI25156J39149_100000776 319
625 3300002738 JGI25154J39366_1000051 JGI25154J39366_100005196 319
626 3300002741 JGI25157J39369_1000012 JGI25157J39369_1000012124 319
627 3300002741 JGI25157J39369_1001565 JGI25157J39369_10015653 319
628 3300002773 JGI25152J39213_1000472 JGI25152J39213_100047214 319
629 3300002773 JGI25152J39213_1002351 JGI25152J39213_10023515 319
630 3300002773 JGI25152J39213_1003011 JGI25152J39213_10030114 319
631 3300002773 JGI25152J39213_1008103 JGI25152J39213_10081032 319
632 3300002774 JGI25150J39212_1000219 JGI25150J39212_100021928 319
633 3300002987 JGI25159J45721_1000036 JGI25159J45721_100003635 319
634 3300002987 JGI25159J45721_1000101 JGI25159J45721_10001019 319
635 3300002987 JGI25159J45721_1000321 JGI25159J45721_10003212 319
636 3300003187 JGI25151J46595_10000007 JGI25151J46595_10000007152 319
637 3300003187 JGI25151J46595_10000462 JGI25151J46595_100004625 319
638 3300003187 JGI25151J46595_10008747 JGI25151J46595_100087473 319
639 3300003187 JGI25151J46595_10011789 JGI25151J46595_100117893 319
640 3300003214 JGI25165J46597_1000102 JGI25165J46597_1000102122 319
641 3300003214 JGI25165J46597_1000280 JGI25165J46597_100028031 319
642 3300003214 JGI25165J46597_1005128 JGI25165J46597_10051281 319
643 3300003215 JGI25153J46596_10000254 JGI25153J46596_1000025436 319
644 3300003215 JGI25153J46596_10002799 JGI25153J46596_100027998 319
645 3300003320 rootH2_10010087 rootH2_100100875 319
646 3300003323 rootH1_10085854 rootH1_100858542 319
647 3300003354 JGI25160J50197_1000023 JGI25160J50197_1000023113 319
648 3300003354 JGI25160J50197_1000060 JGI25160J50197_100006044 319
649 3300003374 JGI25161J50226_1000012 JGI25161J50226_1000012113 319
650 3300003374 JGI25161J50226_1000085 JGI25161J50226_100008520 319
651 3300003374 JGI25161J50226_1000486 JGI25161J50226_100048613 319
652 3300003374 JGI25161J50226_1005087 JGI25161J50226_10050873 319
653 3300003762 Ga0055542_1000516 Ga0055542_10005168 319
654 3300003771 Ga0055526_1007793 Ga0055526_10077935 319
655 3300003775 Ga0055524_1001911 Ga0055524_10019113 319
656 3300003775 Ga0055524_1020816 Ga0055524_10208162 319
657 3300003790 Ga0055528_1003888 Ga0055528_10038888 319
658 3300003790 Ga0055528_1006142 Ga0055528_10061422 319
659 3300003790 Ga0055528_1014676 Ga0055528_10146762 319
660 3300003792 Ga0055540_1000331 Ga0055540_100033116 319
661 3300003792 Ga0055540_1010207 Ga0055540_10102072 319
662 3300004625 Ga0055543_1000009 Ga0055543_1000009113 319
663 3300004625 Ga0055543_1000036 Ga0055543_1000036106 319
664 3300004625 Ga0055543_1000478 Ga0055543_10004783 319
665 3300004625 Ga0055543_1001244 Ga0055543_100124410 319
666 3300005262 Ga0065165_1000064 Ga0065165_100006485 319
667 3300005262 Ga0065165_1000160 Ga0065165_100016088 319
668 3300005262 Ga0065165_1004819 Ga0065165_10048192 319
669 3300005262 Ga0065165_1007340 Ga0065165_10073402 319
670 3300005331 Ga0070670_100000091 Ga0070670_10000009124 319
671 3300005339 Ga0070660_100215186 Ga0070660_1002151862 319
672 3300005548 Ga0070665_100065456 Ga0070665_1000654562 319
673 3300005563 Ga0068855_100063530 Ga0068855_1000635303 319
674 3300005614 Ga0068856_100051751 Ga0068856_1000517512 319
675 3300005614 Ga0068856_100116212 Ga0068856_1001162122 319
676 3300006038 Ga0075365_10000172 Ga0075365_100001729 319
677 3300006038 Ga0075365_10008935 Ga0075365_100089355 319
678 3300006042 Ga0075368_10045934 Ga0075368_100459342 319
679 3300006048 Ga0075363_100016354 Ga0075363_1000163543 319
680 3300006048 Ga0075363_100033823 Ga0075363_1000338233 319
681 3300006048 Ga0075363_100104410 Ga0075363_1001044102 319
682 3300006048 Ga0075363_100111319 Ga0075363_1001113192 319
683 3300006051 Ga0075364_10024357 Ga0075364_100243573 319
684 3300006051 Ga0075364_10093043 Ga0075364_100930432 319
685 3300006177 Ga0075362_10033458 Ga0075362_100334582 319
686 3300006177 Ga0075362_10047012 Ga0075362_100470122 319
687 3300006178 Ga0075367_10000610 Ga0075367_1000061010 319
688 3300006178 Ga0075367_10003061 Ga0075367_100030613 319
689 3300006178 Ga0075367_10242379 Ga0075367_102423791 319
690 3300006186 Ga0075369_10003613 Ga0075369_100036135 319
691 3300006186 Ga0075369_10009935 Ga0075369_100099353 319
692 3300006186 Ga0075369_10013715 Ga0075369_100137152 319
693 3300006353 Ga0075370_10010727 Ga0075370_100107274 319
694 3300006946 Ga0079104_1006901 Ga0079104_10069011 319
695 3300009093 Ga0105240_10000557 Ga0105240_1000055757 319
696 3300009148 Ga0105243_10119152 Ga0105243_101191522 319
697 3300009545 Ga0105237_10000934 Ga0105237_100009342 319
698 3300009551 Ga0105238_10572566 Ga0105238_105725661 319
699 3300009553 Ga0105249_10205822 Ga0105249_102058222 319
700 3300013100 Ga0157373_10086578 Ga0157373_100865782 319
701 3300013104 Ga0157370_10071003 Ga0157370_100710032 319
702 3300013105 Ga0157369_10259280 Ga0157369_102592802 319
703 3300014497 Ga0182008_10105241 Ga0182008_101052412 319
704 3300015262 Ga0182007_10013587 Ga0182007_100135872 319
705 3300015265 Ga0182005_1016224 Ga0182005_10162242 319
706 3300021327 Ga0214543_1000025 Ga0214543_1000025206 319
707 3300022739 Ga0228711_1000005 Ga0228711_100000548 319
708 3300022740 Ga0228710_1000018 Ga0228710_100001848 319
709 3300025206 Ga0209435_100006 Ga0209435_100006450 319
710 3300025208 Ga0209436_100133 Ga0209436_10013317 319
711 3300025208 Ga0209436_100661 Ga0209436_1006613 319
712 3300025228 Ga0209672_101970 Ga0209672_1019705 319
713 3300025233 Ga0209437_100062 Ga0209437_100062228 319
714 3300025233 Ga0209437_100281 Ga0209437_10028131 319
715 3300025245 Ga0207425_1000018 Ga0207425_1000018179 319
716 3300025245 Ga0207425_1002535 Ga0207425_10025356 319
717 3300025245 Ga0207425_1002605 Ga0207425_10026053 319
718 3300025246 Ga0209646_1000015 Ga0209646_100001584 319
719 3300025250 Ga0209026_1000046 Ga0209026_100004684 319
720 3300025250 Ga0209026_1000327 Ga0209026_10003277 319
721 3300025253 Ga0209677_102857 Ga0209677_1028572 319
722 3300025254 Ga0209148_1000078 Ga0209148_1000078166 319
723 3300025256 Ga0209759_1000005 Ga0209759_1000005450 319
724 3300025256 Ga0209759_1000321 Ga0209759_100032166 319
725 3300025258 Ga0209129_1000019 Ga0209129_100001987 319
726 3300025258 Ga0209129_1000026 Ga0209129_1000026150 319
727 3300025258 Ga0209129_1000355 Ga0209129_100035520 319
728 3300025258 Ga0209129_1001590 Ga0209129_10015904 319
729 3300025258 Ga0209129_1002815 Ga0209129_10028153 319
730 3300025258 Ga0209129_1003393 Ga0209129_10033933 319
731 3300025258 Ga0209129_1004309 Ga0209129_10043093 319
732 3300025261 Ga0209233_1000082 Ga0209233_1000082228 319
733 3300025261 Ga0209233_1000267 Ga0209233_100026731 319
734 3300025261 Ga0209233_1000311 Ga0209233_100031145 319
735 3300025263 Ga0209565_1021092 Ga0209565_10210922 319
736 3300025272 Ga0209455_1000193 Ga0209455_100019317 319
737 3300025273 Ga0209673_1000294 Ga0209673_100029486 319
738 3300025273 Ga0209673_1000769 Ga0209673_100076928 319
739 3300025273 Ga0209673_1007106 Ga0209673_10071062 319
740 3300025284 Ga0209130_1000019 Ga0209130_1000019287 319
741 3300025284 Ga0209130_1000048 Ga0209130_100004885 319
742 3300025284 Ga0209130_1000136 Ga0209130_100013677 319
743 3300025284 Ga0209130_1018578 Ga0209130_10185782 319
744 3300025284 Ga0209130_1019834 Ga0209130_10198341 319
745 3300025294 Ga0209025_1000035 Ga0209025_1000035150 319
746 3300025294 Ga0209025_1000086 Ga0209025_100008616 319
747 3300025294 Ga0209025_1000260 Ga0209025_100026037 319
748 3300025294 Ga0209025_1001953 Ga0209025_10019538 319
749 3300025294 Ga0209025_1002615 Ga0209025_10026159 319
750 3300025294 Ga0209025_1007515 Ga0209025_10075155 319
751 3300025295 Ga0209564_1000336 Ga0209564_100033654 319
752 3300025295 Ga0209564_1032542 Ga0209564_10325422 319
753 3300025295 Ga0209564_1036563 Ga0209564_10365632 319
754 3300025297 Ga0209758_1000040 Ga0209758_1000040150 319
755 3300025297 Ga0209758_1000113 Ga0209758_100011365 319
756 3300025297 Ga0209758_1001643 Ga0209758_100164311 319
757 3300025297 Ga0209758_1001926 Ga0209758_100192610 319
758 3300025297 Ga0209758_1003645 Ga0209758_10036458 319
759 3300025297 Ga0209758_1006987 Ga0209758_10069876 319
760 3300025297 Ga0209758_1032936 Ga0209758_10329362 319
761 3300025299 Ga0209256_1000406 Ga0209256_100040618 319
762 3300025299 Ga0209256_1002794 Ga0209256_10027942 319
763 3300025299 Ga0209256_1005862 Ga0209256_10058622 319
764 3300025299 Ga0209256_1019330 Ga0209256_10193302 319
765 3300025302 Ga0207426_1000005 Ga0207426_1000005321 319
766 3300025302 Ga0207426_1000136 Ga0207426_100013685 319
767 3300025302 Ga0207426_1000253 Ga0207426_100025377 319
768 3300025302 Ga0207426_1000282 Ga0207426_100028260 319
769 3300025302 Ga0207426_1001460 Ga0207426_100146016 319
770 3300025303 Ga0209051_1000027 Ga0209051_1000027173 319
771 3300025303 Ga0209051_1000683 Ga0209051_100068321 319
772 3300025304 Ga0209257_1002682 Ga0209257_100268210 319
773 3300025904 Ga0207647_10081494 Ga0207647_100814942 319
774 3300025913 Ga0207695_10000646 Ga0207695_1000064658 319
775 3300025913 Ga0207695_10111566 Ga0207695_101115662 319
776 3300025914 Ga0207671_10001180 Ga0207671_100011805 319
777 3300025914 Ga0207671_10077312 Ga0207671_100773122 319
778 3300025925 Ga0207650_10000723 Ga0207650_1000072325 319
779 3300025949 Ga0207667_10237381 Ga0207667_102373812 319
780 3300026078 Ga0207702_10116665 Ga0207702_101166653 319
781 3300027111 Ga0209281_1000111 Ga0209281_100011148 319
782 3300027111 Ga0209281_1000324 Ga0209281_100032452 319
783 3300027312 Ga0209371_1001530 Ga0209371_10015308 319
784 3300027666 Ga0209282_1000012 Ga0209282_100001248 319
785 3300028379 Ga0268266_10243983 Ga0268266_102439831 319
786 3300028794 Ga0307515_10000600 Ga0307515_1000060054 319
787 3300028794 Ga0307515_10098233 Ga0307515_100982331 319
788 3300030500 Ga0268256_1002200 Ga0268256_10022005 319
789 3300031456 Ga0307513_10008298 Ga0307513_100082981 319
790 3300031548 Ga0307408_100044896 Ga0307408_1000448962 319
791 3300031911 Ga0307412_10006770 Ga0307412_100067702 319
792 3300031911 Ga0307412_10171158 Ga0307412_101711582 319
793 3300031967 Ga0315914_1000007 Ga0315914_1000007166 319
794 3300031995 Ga0307409_100223123 Ga0307409_1002231232 319
795 3300033430 Ga0315913_1000003 Ga0315913_100000348 319
796 3300033464 Ga0315915_1000011 Ga0315915_1000011166 319
797 3300037471 Ga0395905_0069051 Ga0395905_0069051_1000_2034 319
798 3300041404 Ga0439436_0011422 Ga0439436_0011422_1091_2125 319
799 3300041406 Ga0439439_0042574 Ga0439439_0042574_77_1111 319
800 3300041413 Ga0439465_0002248 Ga0439465_0002248_876_1910 319
801 3300041413 Ga0439465_0019866 Ga0439465_0019866_438_1472 319
802 3300041491 Ga0451833_0330568 Ga0451833_0330568_631_1665 319
803 3300041503 Ga0451847_0188200 Ga0451847_0188200_425_1459 319
804 3300041503 Ga0451847_0563186 Ga0451847_0563186_53_1087 319
805 3300041511 Ga0451855_1584958 Ga0451855_1584958_200_1234 319
806 3300041512 Ga0451853_0763300 Ga0451853_0763300_96_1130 319
807 3300042007 Ga0439449_0003926 Ga0439449_0003926_3793_4827 319
808 3300042007 Ga0439449_0046059 Ga0439449_0046059_348_1382 319
809 3300044658 Ga0466972_0035844 Ga0466972_0035844_445_1479 319
810 3300045976 Ga0466967_0180330 Ga0466967_0180330_208_1242 319
811 3300046460 Ga0495638_0008711 Ga0495638_0008711_5117_6151 319
812 3300046460 Ga0495638_0029523 Ga0495638_0029523_660_1694 319
813 3300046476 Ga0495662_0023488 Ga0495662_0023488_1569_2603 319
814 3300046491 Ga0495584_0114818 Ga0495584_0114818_14_1048 319
815 3300046492 Ga0495585_0101835 Ga0495585_0101835_212_1246 319
816 3300046506 Ga0495583_0013226 Ga0495583_0013226_105_1139 319
817 3300046507 Ga0495606_0046809 Ga0495606_0046809_135_1169 319
818 3300046512 Ga0495610_0051699 Ga0495610_0051699_398_1432 319
819 3300046514 Ga0495618_0133592 Ga0495618_0133592_539_1573 319
820 3300046519 Ga0495632_0000580 Ga0495632_0000580_8423_9457 319
821 3300046519 Ga0495632_0040914 Ga0495632_0040914_602_1636 319
822 3300046522 Ga0495643_0098412 Ga0495643_0098412_299_1333 319
823 3300046558 Ga0495633_0014136 Ga0495633_0014136_625_1659 319
824 3300046558 Ga0495633_0035834 Ga0495633_0035834_493_1527 319
825 3300046615 Ga0495656_0004137 Ga0495656_0004137_2785_3819 319
826 3300046616 Ga0495668_0102863 Ga0495668_0102863_485_1519 319
827 3300046660 Ga0495625_0013906 Ga0495625_0013906_191_1225 319
828 3300046660 Ga0495625_0082457 Ga0495625_0082457_760_1794 319
829 3300046691 Ga0495670_0031367 Ga0495670_0031367_1063_2097 319
830 3300046809 Ga0495600_0131722 Ga0495600_0131722_293_1327 319
831 3300047317 Ga0495604_0007238 Ga0495604_0007238_4373_5407 319
832 3300047320 Ga0495672_0064923 Ga0495672_0064923_50_1084 319
833 3300047472 Ga0495686_0056294 Ga0495686_0056294_750_1784 319
834 3300047472 Ga0495686_0093012 Ga0495686_0093012_733_1767 319
835 3300047472 Ga0495686_0100469 Ga0495686_0100469_347_1381 319
836 3300048903 Ga0496100_0008412 Ga0496100_0008412_63_1097 319
837 3300048903 Ga0496100_0119975 Ga0496100_0119975_204_1238 319
838 3300048905 Ga0496102_0006548 Ga0496102_0006548_1205_2239 319
839 3300048905 Ga0496102_0191500 Ga0496102_0191500_785_1819 319
840 3300048906 Ga0496103_0057093 Ga0496103_0057093_554_1588 319
841 3300048907 Ga0496104_0016044 Ga0496104_0016044_1136_2170 319
842 3300048908 Ga0496105_0069045 Ga0496105_0069045_785_1819 319
843 3300048909 Ga0496106_0099788 Ga0496106_0099788_1047_2081 319
844 3300048909 Ga0496106_0110129 Ga0496106_0110129_208_1242 319
845 3300048915 Ga0496112_0064536 Ga0496112_0064536_264_1298 319
846 3300048917 Ga0496114_0198002 Ga0496114_0198002_449_1483 319
847 3300048919 Ga0496116_0012255 Ga0496116_0012255_5739_6773 319
848 3300048919 Ga0496116_0047373 Ga0496116_0047373_149_1183 319
849 3300048920 Ga0496117_0003731 Ga0496117_0003731_11846_12880 319
850 3300048920 Ga0496117_0025343 Ga0496117_0025343_729_1763 319
851 3300048920 Ga0496117_0098423 Ga0496117_0098423_261_1295 319
852 3300048921 Ga0496118_0068768 Ga0496118_0068768_284_1318 319
853 3300048921 Ga0496118_0100820 Ga0496118_0100820_657_1691 319
854 3300048921 Ga0496118_0137342 Ga0496118_0137342_78_1112 319
855 3300048922 Ga0496119_0005459 Ga0496119_0005459_8568_9602 319
856 3300048922 Ga0496119_0018343 Ga0496119_0018343_2651_3685 319
857 3300048922 Ga0496119_0020337 Ga0496119_0020337_105_1139 319
858 3300048922 Ga0496119_0025324 Ga0496119_0025324_3028_4062 319
859 3300048922 Ga0496119_0081918 Ga0496119_0081918_258_1292 319
860 3300048923 Ga0496120_0025688 Ga0496120_0025688_1990_3024 319
861 3300048923 Ga0496120_0095425 Ga0496120_0095425_302_1336 319
862 3300048924 Ga0496121_0011972 Ga0496121_0011972_4632_5666 319
863 3300048924 Ga0496121_0012200 Ga0496121_0012200_4620_5654 319
864 3300048924 Ga0496121_0043326 Ga0496121_0043326_1705_2739 319
865 3300048924 Ga0496121_0072800 Ga0496121_0072800_1059_2093 319
866 3300048924 Ga0496121_0133149 Ga0496121_0133149_258_1292 319
867 3300048925 Ga0496122_0008016 Ga0496122_0008016_3059_4093 319
868 3300048925 Ga0496122_0027716 Ga0496122_0027716_2731_3765 319
869 3300048925 Ga0496122_0031948 Ga0496122_0031948_2973_4007 319
870 3300048925 Ga0496122_0042346 Ga0496122_0042346_2173_3207 319
871 3300048925 Ga0496122_0056904 Ga0496122_0056904_1759_2793 319
872 3300048925 Ga0496122_0092387 Ga0496122_0092387_982_2016 319
873 3300048925 Ga0496122_0155227 Ga0496122_0155227_265_1299 319
874 3300048926 Ga0496123_0000093 Ga0496123_0000093_47239_48273 319
875 3300048926 Ga0496123_0009972 Ga0496123_0009972_232_1266 319
876 3300048926 Ga0496123_0024375 Ga0496123_0024375_2444_3478 319
877 3300048926 Ga0496123_0027913 Ga0496123_0027913_2980_4014 319
878 3300048926 Ga0496123_0046700 Ga0496123_0046700_48_1082 319
879 3300048927 Ga0496124_0000462 Ga0496124_0000462_20159_21193 319
880 3300048927 Ga0496124_0028604 Ga0496124_0028604_207_1241 319
881 3300048927 Ga0496124_0030891 Ga0496124_0030891_2970_4004 319
882 3300048927 Ga0496124_0051807 Ga0496124_0051807_1473_2507 319
883 3300048927 Ga0496124_0209588 Ga0496124_0209588_328_1362 319
884 3300048928 Ga0496125_0000041 Ga0496125_0000041_244668_245702 319
885 3300048928 Ga0496125_0021534 Ga0496125_0021534_4827_5861 319
886 3300048928 Ga0496125_0023932 Ga0496125_0023932_2060_3094 319
887 3300048928 Ga0496125_0040266 Ga0496125_0040266_2727_3761 319
888 3300048928 Ga0496125_0073020 Ga0496125_0073020_955_1989 319
889 3300048928 Ga0496125_0129435 Ga0496125_0129435_128_1162 319
890 3300048929 Ga0496126_0000299 Ga0496126_0000299_65559_66593 319
891 3300048929 Ga0496126_0026786 Ga0496126_0026786_4302_5336 319
892 3300048929 Ga0496126_0351028 Ga0496126_0351028_98_1132 319
893 3300049568 Ga0501031_0005491 Ga0501031_0005491_2660_3694 319
894 3300049568 Ga0501031_0126291 Ga0501031_0126291_494_1528 319
895 3300049568 Ga0501031_0151007 Ga0501031_0151007_440_1474 319
896 3300049569 Ga0501032_0002804 Ga0501032_0002804_5197_6231 319
897 3300049570 Ga0501033_0003721 Ga0501033_0003721_4585_5619 319
898 3300049570 Ga0501033_0201347 Ga0501033_0201347_267_1301 319
899 3300049571 Ga0501034_0006050 Ga0501034_0006050_4710_5744 319
900 3300049571 Ga0501034_0088107 Ga0501034_0088107_976_2010 319
901 3300049572 Ga0501036_0003490 Ga0501036_0003490_7321_8355 319
902 3300049573 Ga0501037_0257951 Ga0501037_0257951_55_1089 319
903 3300049574 Ga0501038_0006495 Ga0501038_0006495_4634_5668 319
904 3300049575 Ga0501039_0002578 Ga0501039_0002578_7324_8358 319
905 3300049579 Ga0501043_0003499 Ga0501043_0003499_5202_6236 319
906 3300049580 Ga0501046_0001795 Ga0501046_0001795_6754_7788 319
907 3300049580 Ga0501046_0053250 Ga0501046_0053250_1987_3021 319
908 3300049581 Ga0501047_0003954 Ga0501047_0003954_5577_6611 319
909 3300049581 Ga0501047_0293962 Ga0501047_0293962_79_1113 319
910 3300049582 Ga0501048_0006983 Ga0501048_0006983_3948_4982 319
911 3300049586 Ga0501070_0008205 Ga0501070_0008205_4073_5107 319
912 3300049589 Ga0501073_0035352 Ga0501073_0035352_1964_2998 319
913 3300049592 Ga0501076_0201875 Ga0501076_0201875_205_1239 319
914 3300049742 Ga0501080_0039014 Ga0501080_0039014_50_1084 319
915 3300049744 Ga0501083_0207338 Ga0501083_0207338_233_1267 319
916 3300049822 Ga0501035_0003248 Ga0501035_0003248_7221_8255 319
917 3300049822 Ga0501035_0237649 Ga0501035_0237649_188_1222 319
918 3300049823 Ga0501044_0044192 Ga0501044_0044192_2211_3245 319
919 3300049823 Ga0501044_0262470 Ga0501044_0262470_359_1393 319
920 3300049824 Ga0501045_0065593 Ga0501045_0065593_1102_2136 319
921 3300050489 nmdc:mga03683_72726_c1 nmdc:mga03683_72726_c1_22_1056 319
922 3300050490 nmdc:mga03n38_6879_c1 nmdc:mga03n38_6879_c1_2604_3638 319
923 3300050490 nmdc:mga03n38_78827_c1 nmdc:mga03n38_78827_c1_320_1354 319
924 3300050492 nmdc:mga0yw44_147255_c1 nmdc:mga0yw44_147255_c1_291_1325 319
925 3300050492 nmdc:mga0yw44_30056_c1 nmdc:mga0yw44_30056_c1_104_1138 319
926 3300050492 nmdc:mga0yw44_32556_c1 nmdc:mga0yw44_32556_c1_98_1132 319
927 3300050494 nmdc:mga06z11_43028_c1 nmdc:mga06z11_43028_c1_179_1213 319
928 3300050494 nmdc:mga06z11_78061_c1 nmdc:mga06z11_78061_c1_573_1607 319
929 3300050496 nmdc:mga07m45_180184_c1 nmdc:mga07m45_180184_c1_150_1184 319
930 3300050516 nmdc:mga0sz30_19730_c1 nmdc:mga0sz30_19730_c1_1530_2564 319
931 3300053079 Ga0500610_0004653 Ga0500610_0004653_1115_2149 319
932 3300053109 Ga0500569_001519 Ga0500569_001519_187_1221 319
933 3300053125 Ga0500618_005944 Ga0500618_005944_2352_3386 319
934 3300053134 Ga0500658_0005175 Ga0500658_0005175_2953_3987 319
935 3300053136 Ga0500559_0005903 Ga0500559_0005903_4355_5389 319
936 3300053139 Ga0500568_0004843 Ga0500568_0004843_5054_6088 319
937 3300053139 Ga0500568_0027517 Ga0500568_0027517_1011_2045 319
938 3300053148 Ga0500590_001707 Ga0500590_001707_5734_6768 319
939 3300053153 Ga0500616_0007322 Ga0500616_0007322_849_1883 319
940 3300053155 Ga0500620_013555 Ga0500620_013555_1065_2099 319
941 3300053156 Ga0500622_0000207 Ga0500622_0000207_54280_55314 319
942 3300053156 Ga0500622_0003264 Ga0500622_0003264_5114_6148 319
943 3300060353 Ga0501082_0176052 Ga0501082_0176052_752_1786 319
944 iso_pu_bacteria 2512047086 2512529477 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

24

143

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

151

274

0.95

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

155

359

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uia-assembly1.cif.gz_B crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with nad+, r-2,3-dihydroxyisovalerate and magnesium 0.9908 3 317
5uia-assembly1.cif.gz_B crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with nad+, r-2,3-dihydroxyisovalerate and magnesium 0.9754 3 317
6a3j-assembly1.cif.gz_D levoglucosan dehydrogenase, complex with nadh and l-sorbose 0.8389 1 314
2o48-assembly1.cif.gz_X crystal structure of mammalian dimeric dihydrodiol dehydrogenase 0.8385 4 304
3ezy-assembly1.cif.gz_B crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.8351 4 317
ID Description Score Start End Superfamily
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9346 4 97 3.40.50.720
3euwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9247 4 97 3.40.50.720
1zh8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9162 3 97 3.40.50.720
af_A0A1D8PPX6_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9161 1 97 3.40.50.720
3e18B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9074 3 97 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A529SZK7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9908 116 319
AF-A0A528AYS3-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9894 48 319 GO:0000166
GO:0016491
AF-A0A7K0P4M3-F1-model_v4 GFO/IDH/MocA-like oxidoreductase domain-containing protein 0.982 97 315
AF-A0A529SZK7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9813 116 319
AF-A0A1G6D900-F1-model_v4 Predicted dehydrogenase 0.9808 3 313 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.1 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map