F486319

General Info

Members Datasets Scaffolds Average Seq Length
940 755 363 398

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0110695|Ga0496114_0110695_940_2151
Length 390
Sequence MNCFTARRTALALFFASALTGVAAAQDATSPQAPCGGDLNEFLAGVKAEAIAAGASAEAADKVLAGAQIDPKVLSRDRAQGVFKQTFLEFSQRTVSQARLDIGRQKMKQYADAFARAEQDYGVPQGVITADFNTRNALVTLSHDCRRPELFRPQLIALIKMDEHGDVDPSVTTGAWAGEIGQTQMLPKDIIAYGVDGDGDGHVRLKESAPDVILTTANFIKHLGFERGQPWIQEVTLPENLPYEKSGIGGAMTAGDWFALGVKPRDENTSFGSLKADLILPQGRMGPAFLTYPNFGIYLEWNKSFIYTTSAAYFATRLSGAPTYLKGQPEQGLNDAEMKVLQTKLQAHGYDVGKVDGILGSGTRVAIQKEQQRLGLPADGWATPSLLSQL

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2519899620 Rhizobium sp. Pop5 Isolate Nodule
47 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
48 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
49 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
50 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
51 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
52 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
53 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
54 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
55 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
56 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
57 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
58 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
59 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
60 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
61 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
62 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
63 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
64 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
65 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
66 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
67 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
68 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
69 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
70 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
71 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
72 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
73 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
74 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
75 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
76 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
77 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
78 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
79 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
80 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
81 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
82 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
83 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
84 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
85 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
86 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
87 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
88 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
89 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
90 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
91 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
92 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
93 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
94 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
95 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
96 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
97 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
98 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
99 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
100 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
101 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
102 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
103 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
104 2643221557 Ensifer sp. Root558 Isolate Unclassified
105 2643221558 Rhizobium sp. Root149 Isolate Unclassified
106 2643221568 Rhizobium sp. Root564 Isolate Unclassified
107 2643221582 Rhizobium sp. Root651 Isolate Unclassified
108 2643221599 Rhizobium sp. Root708 Isolate Unclassified
109 2643221607 Rhizobium sp. Root73 Isolate Unclassified
110 2643221610 Ensifer sp. Root74 Isolate Unclassified
111 2643221618 Ensifer sp. Root231 Isolate Unclassified
112 2643221626 Ensifer sp. Root31 Isolate Unclassified
113 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
114 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
115 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
116 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
117 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
118 2643221655 Ensifer sp. Root1252 Isolate Unclassified
119 2643221659 Ensifer sp. Root127 Isolate Unclassified
120 2643221668 Ensifer sp. Root423 Isolate Unclassified
121 2643221675 Ensifer sp. Root1298 Isolate Unclassified
122 2643221680 Ensifer sp. Root1312 Isolate Unclassified
123 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
124 2643221688 Rhizobium sp. Root482 Isolate Unclassified
125 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
126 2643221693 Rhizobium sp. Root491 Isolate Unclassified
127 2643221698 Ensifer sp. Root142 Isolate Unclassified
128 2643221712 Ensifer sp. Root258 Isolate Unclassified
129 2643221718 Rhizobium sp. Root268 Isolate Unclassified
130 2643221719 Rhizobium sp. Root274 Isolate Unclassified
131 2643221723 Ensifer sp. Root278 Isolate Unclassified
132 2643221726 Ensifer sp. Root954 Isolate Unclassified
133 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
134 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
135 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
136 2718217882 Rhizobium sp. N741 Isolate Nodule
137 2718217927 Rhizobium sp. N324 Isolate Nodule
138 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
139 2718218009 Rhizobium sp. N561 Isolate Nodule
140 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
141 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
142 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
143 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
144 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
145 2718218363 Rhizobium sp. N113 Isolate Nodule
146 2718218365 Rhizobium sp. N731 Isolate Nodule
147 2718218366 Rhizobium sp. N621 Isolate Nodule
148 2718218423 Rhizobium sp. N941 Isolate Nodule
149 2721755514 Rhizobium sp. N6212 Isolate Nodule
150 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
151 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
152 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
153 2721755809 Rhizobium sp. N541 Isolate Nodule
154 2721755810 Rhizobium sp. N871 Isolate Nodule
155 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
156 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
157 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
158 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
159 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
160 2728369365 Rhizobium sp. N1341 Isolate Nodule
161 2728369397 Rhizobium sp. N1314 Isolate Nodule
162 2738541293 Rhizobium sp. GV031 Isolate Unclassified
163 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
164 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
165 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
166 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
167 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
168 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
169 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
170 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
171 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
172 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
173 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
174 2791355256 Rhizobium sp. M10 Isolate Nodule
175 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
176 2791355260 Rhizobium sp. L9 Isolate Nodule
177 2791355261 Rhizobium sp. J15 Isolate Nodule
178 2791355262 Rhizobium sp. M1 Isolate Nodule
179 2791355263 Rhizobium chutanense C5 Isolate Nodule
180 2791355264 Rhizobium sp. S9 Isolate Nodule
181 2791355265 Rhizobium sp. H4 Isolate Nodule
182 2791355266 Rhizobium sp. L43 Isolate Nodule
183 2791355267 Rhizobium sp. L18 Isolate Nodule
184 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
185 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
186 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
187 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
188 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
189 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
190 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
191 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
192 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
193 2802429633 Rhizobium anhuiense J3 Isolate Nodule
194 2802429634 Rhizobium anhuiense S10 Isolate Nodule
195 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
196 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
197 2802429637 Rhizobium anhuiense C15 Isolate Nodule
198 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
199 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
200 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
201 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
202 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
203 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
204 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
205 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
206 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
207 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
208 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
209 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
210 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
211 2838048938 Rhizobium pisi 27/80 Isolate Nodule
212 2838061910 Rhizobium phaseoli L15 Isolate Nodule
213 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
214 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
215 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
216 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
217 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
218 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
219 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
220 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
221 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
222 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
223 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
224 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
225 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
226 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
227 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
228 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
229 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
230 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
231 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
232 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
233 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
234 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
235 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
236 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
237 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
238 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
239 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
240 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
241 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
242 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
243 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
244 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
245 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
246 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
247 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
248 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
249 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
250 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
251 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
252 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
253 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
254 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
255 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
256 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
257 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
258 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
259 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
260 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
261 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
262 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
263 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
264 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
265 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
266 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
267 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
268 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
269 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
270 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
271 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
272 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
273 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
274 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
275 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
276 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
277 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
278 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
279 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
280 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
281 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
282 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
283 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
284 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
285 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
286 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
287 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
288 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
289 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
290 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
291 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
292 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
293 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
294 2844163670 Ensifer sp. 1H6 Isolate Unclassified
295 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
296 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
297 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
298 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
299 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
300 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
301 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
302 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
303 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
304 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
305 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
306 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
307 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
308 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
309 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
310 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
311 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
312 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
313 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
314 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
315 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
316 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
317 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
318 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
319 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
320 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
321 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
322 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
323 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
324 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
325 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
326 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
327 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
328 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
329 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
330 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
331 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
332 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
333 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
334 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
335 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
336 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
337 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
338 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
339 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
340 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
341 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
342 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
343 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
344 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
345 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
346 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
347 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
348 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
349 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
350 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
351 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
352 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
353 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
354 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
355 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
356 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
357 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
358 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
359 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
360 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
361 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
362 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
363 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
364 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
365 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
366 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
367 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
368 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
369 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
370 2933599457 Rhizobium phaseoli M3 Isolate Nodule
371 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
372 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
373 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
374 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
375 2936381700 Rhizobium chutanense C16 Isolate Unclassified
376 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
377 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
378 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
379 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
380 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
381 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
382 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
383 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
384 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
385 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
386 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
387 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
388 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
389 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
390 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
391 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
392 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
393 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
394 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
395 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
396 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
397 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
398 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
399 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
400 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
401 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
402 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
403 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
404 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
405 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
406 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
407 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
408 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
409 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
410 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
411 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
412 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
413 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
414 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
415 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
416 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
417 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
418 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
419 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
420 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
421 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
422 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
423 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
424 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
425 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
426 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
427 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
428 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
429 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
430 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
431 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
432 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
433 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
434 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
435 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
436 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
437 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
438 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
439 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
440 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
441 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
442 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
443 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
444 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
445 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
446 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
447 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
448 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
449 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
450 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
451 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
452 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
453 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
454 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
455 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
456 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
457 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
458 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
459 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
460 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
461 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
462 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
463 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
464 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
465 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
466 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
467 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
468 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
469 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
470 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
471 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
472 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
473 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
474 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
475 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
476 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
477 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
478 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
479 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
480 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
481 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
482 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
483 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
484 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
485 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
486 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
487 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
488 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
489 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
490 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
491 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
492 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
493 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
494 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
495 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
496 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
497 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
498 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
499 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
500 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
501 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
502 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
503 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
504 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
505 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
506 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
507 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
508 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
509 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
510 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
511 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
512 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
513 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
514 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
515 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
516 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
517 2996887358 Rhizobium sp. R711 Isolate Nodule
518 2996893221 Rhizobium sp. R635 Isolate Nodule
519 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
520 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
521 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
522 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
523 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
524 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
525 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
526 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
527 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
528 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
529 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
530 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
531 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
532 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
533 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
534 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
535 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
536 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
537 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
538 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
539 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
540 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
541 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
542 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
543 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
544 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
545 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
546 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
547 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
548 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
549 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
550 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
551 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
552 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
553 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
554 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
555 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
556 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
557 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
558 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
559 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
560 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
561 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
562 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
563 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
564 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
565 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
566 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
567 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
568 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
569 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
570 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
571 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
572 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
573 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
574 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
575 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
576 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
577 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
578 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
579 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
580 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
581 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
582 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
583 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
584 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
585 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
586 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
587 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
588 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
589 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
590 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
591 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
592 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
593 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
594 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
595 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
596 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
597 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
598 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
599 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
600 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
601 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
602 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
603 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
610 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
611 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
612 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
613 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
615 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
616 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
617 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
618 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
619 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
620 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
621 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
622 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
623 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
624 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
625 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
626 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
627 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
628 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
629 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
630 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
631 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
632 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
633 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
634 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
635 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
636 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
637 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
638 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
639 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
640 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
641 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
642 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
643 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
644 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
645 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
646 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
647 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
648 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
649 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
650 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
651 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
652 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
653 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
654 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
655 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
656 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
657 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
658 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
659 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
660 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
661 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
662 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
663 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
664 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
665 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
666 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
667 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
668 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
669 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
670 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
671 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
672 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
673 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
674 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
675 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
676 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
677 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
678 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
679 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
680 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
681 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
682 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
683 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
684 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
685 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
686 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
687 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
688 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
689 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
690 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
691 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
692 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
693 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
694 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
695 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
696 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
697 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
698 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
699 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
700 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
701 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
702 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
703 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
704 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
705 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
706 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
707 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
708 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
709 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
710 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
711 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
712 8005258706 Rhizobium sp. R693 Isolate Nodule
713 8005275841 Rhizobium sp. N4311 Isolate Nodule
714 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
715 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
716 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
717 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
718 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
719 8005321885 Rhizobium sp. R72 Isolate Nodule
720 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
721 8005382845 Rhizobium sp. R634 Isolate Nodule
722 8005395548 Rhizobium sp. R339 Isolate Nodule
723 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
724 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
725 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
726 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
727 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
728 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
729 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
730 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
731 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
732 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
733 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
734 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
735 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
736 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
737 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
738 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
739 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
740 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
741 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
742 8018176218 Rhizobium sp. N122 Isolate Nodule
743 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
744 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
745 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
746 8024501048 Rhizobium sp. H4 Isolate Nodule
747 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
748 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
749 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
750 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
751 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
752 8056382006 Rhizobium croatiense 13T Isolate Nodule
753 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
754 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
755 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.51
Metatranscriptomes 0.11
Isolates 61.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 16.7
Nodule 46.7
Rhizoplane 1.6
Rhizosphere 16.17
Stem 0
Stem Tuber 0
Unclassified 18.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000001 3300002704 Bacteria 354543
2 JGI25156J39149_1000001 3300002705 Bacteria 354557
3 JGI25162J39368_1000366 3300002737 Bacteria 38535
4 JGI25162J39368_1000368 3300002737 Bacteria 38495
5 JGI25154J39366_1000122 3300002738 Bacteria 61892
6 JGI25158J39367_1000325 3300002739 Bacteria 10567
7 JGI25157J39369_1000044 3300002741 Bacteria 122466
8 JGI25152J39213_1004106 3300002773 Bacteria 4708
9 JGI25150J39212_1000074 3300002774 Bacteria 60735
10 JGI25150J39212_1006967 3300002774 Bacteria 2299
11 JGI25159J45721_1000014 3300002987 Bacteria 147809
12 JGI25159J45721_1000424 3300002987 Bacteria 19457
13 JGI25159J45721_1003265 3300002987 Bacteria 5811
14 JGI25151J46595_10000486 3300003187 Bacteria 37582
15 JGI25151J46595_10001329 3300003187 Bacteria 17282
16 JGI25151J46595_10003192 3300003187 Bacteria 9187
17 JGI25165J46597_1000516 3300003214 Bacteria 36635
18 JGI25165J46597_1001244 3300003214 Bacteria 15085
19 JGI25153J46596_10000267 3300003215 Bacteria 41505
20 JGI25153J46596_10008873 3300003215 Bacteria 4748
21 JGI25153J46596_10019777 3300003215 Bacteria 2567
22 rootH1_10146533 3300003316 Bacteria 2313
23 rootH2_10058184 3300003320 Bacteria 2033
24 rootL2_10010590 3300003322 Bacteria 17548
25 JGI25160J50197_1000001 3300003354 Bacteria 782301
26 JGI25160J50197_1000020 3300003354 Bacteria 232739
27 JGI25160J50197_1001033 3300003354 Bacteria 14383
28 JGI25160J50197_1002835 3300003354 Bacteria 7937
29 JGI25161J50226_1000001 3300003374 Bacteria 655036
30 JGI25161J50226_1000301 3300003374 Bacteria 27747
31 JGI25161J50226_1001190 3300003374 Bacteria 8540
32 Ga0055526_1001900 3300003771 Bacteria 14483
33 Ga0055526_1002418 3300003771 Bacteria 12652
34 Ga0055526_1004707 3300003771 Bacteria 8100
35 Ga0055526_1005167 3300003771 Bacteria 7592
36 Ga0055526_1007119 3300003771 Bacteria 5900
37 Ga0055524_1002147 3300003775 Bacteria 10378
38 Ga0055524_1008133 3300003775 Bacteria 4383
39 Ga0055524_1008904 3300003775 Bacteria 4131
40 Ga0055536_1005920 3300003781 Bacteria 5850
41 Ga0055528_1000234 3300003790 Bacteria 46499
42 Ga0055528_1000512 3300003790 Bacteria 30456
43 Ga0055528_1002231 3300003790 Bacteria 10561
44 Ga0055528_1015849 3300003790 Bacteria 2697
45 Ga0055540_1000350 3300003792 Bacteria 39199
46 Ga0055540_1006937 3300003792 Bacteria 4381
47 Ga0055540_1010620 3300003792 Bacteria 3047
48 Ga0055540_1010736 3300003792 Bacteria 3023
49 Ga0055531_10015821 3300003794 Bacteria 3296
50 Ga0058692_1003579 3300003856 Bacteria 4774
51 Ga0058692_1006401 3300003856 Bacteria 3242
52 Ga0058692_1015739 3300003856 Bacteria 1696
53 Ga0055543_1000003 3300004625 Bacteria 358656
54 Ga0055543_1000047 3300004625 Bacteria 111073
55 Ga0055543_1000355 3300004625 Bacteria 31085
56 Ga0055543_1000776 3300004625 Bacteria 15875
57 Ga0065165_1000013 3300005262 Bacteria 301887
58 Ga0065165_1000068 3300005262 Bacteria 170609
59 Ga0065165_1002171 3300005262 Bacteria 17718
60 Ga0065165_1014683 3300005262 Bacteria 3029
61 Ga0065165_1018639 3300005262 Bacteria 2505
62 Ga0070670_100036105 3300005331 Bacteria 4254
63 Ga0070668_100076750 3300005347 Bacteria 2610
64 Ga0070663_100090599 3300005455 Bacteria 2265
65 Ga0070665_100006642 3300005548 Bacteria 11760
66 Ga0070665_100056582 3300005548 Bacteria 3932
67 Ga0068852_100069250 3300005616 Bacteria 3092
68 Ga0068851_10015204 3300005834 Bacteria 3664
69 Ga0075365_10000068 3300006038 Bacteria 31130
70 Ga0075365_10001261 3300006038 Bacteria 11230
71 Ga0075368_10000960 3300006042 Bacteria 8974
72 Ga0075362_10009317 3300006177 Bacteria 3793
73 Ga0075367_10027609 3300006178 Bacteria 3231
74 Ga0075369_10013710 3300006186 Bacteria 3224
75 Ga0075366_10003507 3300006195 Bacteria 8286
76 Ga0075370_10020671 3300006353 Bacteria 3601
77 Ga0079104_1000045 3300006946 Bacteria 183705
78 Ga0079104_1004188 3300006946 Bacteria 6279
79 Ga0079104_1008418 3300006946 Bacteria 3612
80 Ga0099826_10006287 3300006948 Bacteria 8642
81 Ga0099826_10081907 3300006948 Bacteria 2007
82 Ga0105240_10000076 3300009093 Bacteria 198848
83 Ga0105248_10059648 3300009177 Bacteria 4286
84 Ga0105237_10000226 3300009545 Bacteria 79798
85 Ga0123341_1000007 3300009765 Bacteria 147072
86 Ga0123342_1008862 3300009766 Bacteria 12394
87 Ga0123342_1010306 3300009766 Bacteria 10777
88 Ga0105239_10010871 3300010375 Bacteria 10170
89 Ga0105239_10050961 3300010375 Bacteria 4539
90 Ga0157373_10048957 3300013100 Bacteria 3013
91 Ga0157371_10000017 3300013102 Bacteria 320830
92 Ga0157370_10000461 3300013104 Bacteria 50850
93 Ga0171463_1003 3300013249 Bacteria 695693
94 Ga0163163_10314648 3300014325 Bacteria 1619
95 Ga0182008_10007170 3300014497 Bacteria 6171
96 Ga0182007_10001912 3300015262 Bacteria 10815
97 Ga0183363_1158 3300015690 Bacteria 16472
98 Ga0214542_1000012 3300021321 Bacteria 235800
99 Ga0214542_1018489 3300021321 Bacteria 5871
100 Ga0214543_1000024 3300021327 Bacteria 235745
101 Ga0214543_1000038 3300021327 Bacteria 182106
102 Ga0228711_1000008 3300022739 Bacteria 169893
103 Ga0228710_1000009 3300022740 Bacteria 169770
104 Ga0209435_100012 3300025206 Bacteria 401621
105 Ga0209436_100150 3300025208 Bacteria 33510
106 Ga0209436_103391 3300025208 Bacteria 4260
107 Ga0209437_100051 3300025233 Bacteria 392523
108 Ga0209437_100098 3300025233 Bacteria 229766
109 Ga0207425_1000075 3300025245 Bacteria 107452
110 Ga0207425_1002917 3300025245 Bacteria 5727
111 Ga0207425_1004688 3300025245 Bacteria 4040
112 Ga0209646_1000026 3300025246 Bacteria 401621
113 Ga0209026_1000014 3300025250 Bacteria 401621
114 Ga0209677_101110 3300025253 Bacteria 12626
115 Ga0209759_1000012 3300025256 Bacteria 401621
116 Ga0209129_1000156 3300025258 Bacteria 107484
117 Ga0209129_1000218 3300025258 Bacteria 66076
118 Ga0209129_1001121 3300025258 Bacteria 15560
119 Ga0209129_1001564 3300025258 Bacteria 12565
120 Ga0209129_1008363 3300025258 Bacteria 2892
121 Ga0209233_1000095 3300025261 Bacteria 303783
122 Ga0209233_1000113 3300025261 Bacteria 253455
123 Ga0209233_1000148 3300025261 Bacteria 185135
124 Ga0209673_1000010 3300025273 Bacteria 596656
125 Ga0209673_1000117 3300025273 Bacteria 172081
126 Ga0209673_1000151 3300025273 Bacteria 148103
127 Ga0209673_1004063 3300025273 Bacteria 8083
128 Ga0209673_1005985 3300025273 Bacteria 5984
129 Ga0209130_1000003 3300025284 Bacteria 677988
130 Ga0209130_1000020 3300025284 Bacteria 379297
131 Ga0209130_1000034 3300025284 Bacteria 302439
132 Ga0209025_1000070 3300025294 Bacteria 287776
133 Ga0209025_1000140 3300025294 Bacteria 184765
134 Ga0209025_1000213 3300025294 Bacteria 139002
135 Ga0209025_1000314 3300025294 Bacteria 107720
136 Ga0209025_1000571 3300025294 Bacteria 66955
137 Ga0209025_1006435 3300025294 Bacteria 9113
138 Ga0209025_1019203 3300025294 Bacteria 3815
139 Ga0209025_1042981 3300025294 Bacteria 1912
140 Ga0209025_1044245 3300025294 Bacteria 1864
141 Ga0209564_1000013 3300025295 Bacteria 775755
142 Ga0209564_1000386 3300025295 Bacteria 79939
143 Ga0209564_1000424 3300025295 Bacteria 74299
144 Ga0209564_1002355 3300025295 Bacteria 15231
145 Ga0209564_1015750 3300025295 Bacteria 3056
146 Ga0209564_1023864 3300025295 Bacteria 2108
147 Ga0209758_1000094 3300025297 Bacteria 241068
148 Ga0209758_1000405 3300025297 Bacteria 73971
149 Ga0209758_1000413 3300025297 Bacteria 72744
150 Ga0209758_1001750 3300025297 Bacteria 24144
151 Ga0209758_1001956 3300025297 Bacteria 22266
152 Ga0209758_1001965 3300025297 Bacteria 22211
153 Ga0209758_1002998 3300025297 Bacteria 16172
154 Ga0209758_1012550 3300025297 Bacteria 4727
155 Ga0209050_1000646 3300025298 Bacteria 54050
156 Ga0209256_1000396 3300025299 Bacteria 69216
157 Ga0209256_1000610 3300025299 Bacteria 49586
158 Ga0209256_1001575 3300025299 Bacteria 22398
159 Ga0209256_1001585 3300025299 Bacteria 22292
160 Ga0209256_1003401 3300025299 Bacteria 11218
161 Ga0209256_1004556 3300025299 Bacteria 8602
162 Ga0209256_1011618 3300025299 Bacteria 3495
163 Ga0207426_1000006 3300025302 Bacteria 1025969
164 Ga0207426_1000008 3300025302 Bacteria 848730
165 Ga0207426_1000011 3300025302 Bacteria 791203
166 Ga0207426_1000449 3300025302 Bacteria 65802
167 Ga0207426_1000869 3300025302 Bacteria 31530
168 Ga0209051_1000097 3300025303 Bacteria 167378
169 Ga0209051_1000314 3300025303 Bacteria 74316
170 Ga0209051_1001837 3300025303 Bacteria 16782
171 Ga0209051_1017349 3300025303 Bacteria 3219
172 Ga0209051_1022199 3300025303 Bacteria 2677
173 Ga0209051_1029781 3300025303 Bacteria 2130
174 Ga0209257_1005915 3300025304 Bacteria 8236
175 Ga0207695_10000011 3300025913 Bacteria 910221
176 Ga0207671_10000093 3300025914 Bacteria 138939
177 Ga0207681_10213427 3300025923 Bacteria 1489
178 Ga0207650_10024844 3300025925 Bacteria 4265
179 Ga0207668_10119362 3300025972 Bacteria 1994
180 Ga0207678_10036250 3300026067 Bacteria 4293
181 Ga0209281_1000034 3300027111 Bacteria 382562
182 Ga0209281_1000106 3300027111 Bacteria 219666
183 Ga0209281_1000318 3300027111 Bacteria 85039
184 Ga0209371_1000022 3300027312 Bacteria 536342
185 Ga0209371_1000173 3300027312 Bacteria 96201
186 Ga0209371_1007319 3300027312 Bacteria 3869
187 Ga0209371_1008531 3300027312 Bacteria 3390
188 Ga0209282_1000024 3300027666 Bacteria 170348
189 Ga0209282_1000628 3300027666 Bacteria 17386
190 Ga0209813_10020367 3300027866 Bacteria 1855
191 Ga0268266_10013232 3300028379 Bacteria 7113
192 Ga0268266_10066012 3300028379 Bacteria 3129
193 Ga0307515_10003171 3300028794 Bacteria 34790
194 Ga0307515_10087514 3300028794 Bacteria 3952
195 Ga0268256_1000019 3300030500 Bacteria 587949
196 Ga0268256_1008535 3300030500 Bacteria 3497
197 Ga0268256_1011027 3300030500 Bacteria 2894
198 Ga0307513_10012757 3300031456 Bacteria 10350
199 Ga0307405_10003099 3300031731 Bacteria 7547
200 Ga0307410_10013918 3300031852 Bacteria 4713
201 Ga0307406_10120322 3300031901 Bacteria 1824
202 Ga0307412_10000493 3300031911 Bacteria 23544
203 Ga0315914_1000012 3300031967 Bacteria 169896
204 Ga0307409_100204536 3300031995 Bacteria 1769
205 Ga0315913_1000006 3300033430 Bacteria 169893
206 Ga0315915_1000010 3300033464 Bacteria 240214
207 Ga0373925_0002266 3300037068 Bacteria 15579
208 Ga0395905_0010069 3300037471 Bacteria 9215
209 Ga0395905_0027015 3300037471 Bacteria 5412
210 Ga0439436_0009533 3300041404 Bacteria 2977
211 Ga0439465_0000968 3300041413 Bacteria 9139
212 Ga0439462_0002977 3300042015 Bacteria 4018
213 Ga0439462_0021545 3300042015 Bacteria 1684
214 Ga0495638_0001181 3300046460 Bacteria 25058
215 Ga0495585_0002937 3300046492 Bacteria 11794
216 Ga0495585_0005327 3300046492 Bacteria 8123
217 Ga0495585_0015923 3300046492 Bacteria 4362
218 Ga0495596_0044584 3300046500 Bacteria 1745
219 Ga0495583_0014957 3300046506 Bacteria 4247
220 Ga0495606_0002324 3300046507 Bacteria 22407
221 Ga0495616_0020484 3300046513 Bacteria 3596
222 Ga0495616_0036958 3300046513 Bacteria 2516
223 Ga0495631_0000327 3300046518 Bacteria 32708
224 Ga0495631_0020323 3300046518 Bacteria 3103
225 Ga0495632_0002058 3300046519 Bacteria 15803
226 Ga0495643_0005737 3300046522 Bacteria 8307
227 Ga0495654_0000110 3300046530 Bacteria 93042
228 Ga0495609_0068292 3300046538 Bacteria 1564
229 Ga0495609_0073448 3300046538 Bacteria 1501
230 Ga0495597_0015155 3300046542 Bacteria 3653
231 Ga0495633_0011405 3300046558 Bacteria 4793
232 Ga0495633_0052841 3300046558 Bacteria 1913
233 Ga0495633_0069375 3300046558 Bacteria 1646
234 Ga0495668_0001961 3300046616 Bacteria 18215
235 Ga0495625_0001387 3300046660 Bacteria 29722
236 Ga0495625_0155673 3300046660 Bacteria 1533
237 Ga0495635_0105198 3300046663 Bacteria 1928
238 Ga0495588_0000645 3300046674 Bacteria 16208
239 Ga0495657_0074542 3300046675 Bacteria 2208
240 Ga0495649_0001505 3300046694 Bacteria 17487
241 Ga0495600_0018256 3300046809 Bacteria 4466
242 Ga0495604_0010846 3300047317 Bacteria 7237
243 Ga0495672_0009547 3300047320 Bacteria 7016
244 Ga0495687_043767 3300047443 Bacteria 1949
245 Ga0495687_070919 3300047443 Bacteria 1397
246 Ga0495681_0002148 3300047470 Bacteria 14294
247 Ga0495686_0002638 3300047472 Bacteria 16585
248 Ga0495686_0005077 3300047472 Bacteria 10541
249 Ga0495686_0018999 3300047472 Bacteria 4598
250 Ga0495686_0034160 3300047472 Bacteria 3277
251 Ga0495615_0001484 3300048090 Bacteria 3513
252 Ga0495626_0049814 3300048091 Bacteria 1938
253 Ga0496103_0002316 3300048906 Bacteria 12042
254 Ga0496104_0094068 3300048907 Bacteria 2867
255 Ga0496106_0001376 3300048909 Bacteria 18218
256 Ga0496110_0054085 3300048913 Bacteria 3531
257 Ga0496111_0000410 3300048914 Bacteria 21502
258 Ga0496114_0110695 3300048917 Bacteria 2353
259 Ga0496116_0000142 3300048919 Bacteria 150342
260 Ga0496116_0003173 3300048919 Bacteria 16471
261 Ga0496116_0004575 3300048919 Bacteria 13122
262 Ga0496116_0048481 3300048919 Bacteria 2850
263 Ga0496116_0120115 3300048919 Bacteria 1523
264 Ga0496116_0128827 3300048919 Bacteria 1447
265 Ga0496117_0000002 3300048920 Bacteria 2483758
266 Ga0496117_0008182 3300048920 Bacteria 9980
267 Ga0496117_0016063 3300048920 Bacteria 6339
268 Ga0496117_0063551 3300048920 Bacteria 2522
269 Ga0496118_0000087 3300048921 Bacteria 176693
270 Ga0496118_0006719 3300048921 Bacteria 12534
271 Ga0496118_0018301 3300048921 Bacteria 6325
272 Ga0496119_0024029 3300048922 Bacteria 4301
273 Ga0496119_0095567 3300048922 Bacteria 1678
274 Ga0496119_0097263 3300048922 Bacteria 1659
275 Ga0496120_0000413 3300048923 Bacteria 68125
276 Ga0496120_0013309 3300048923 Bacteria 5545
277 Ga0496121_0000003 3300048924 Bacteria 1191431
278 Ga0496121_0001116 3300048924 Bacteria 47237
279 Ga0496121_0002536 3300048924 Bacteria 27686
280 Ga0496121_0010348 3300048924 Bacteria 10539
281 Ga0496121_0017405 3300048924 Bacteria 7345
282 Ga0496121_0020138 3300048924 Bacteria 6622
283 Ga0496121_0048879 3300048924 Bacteria 3593
284 Ga0496121_0264704 3300048924 Bacteria 1185
285 Ga0496122_0000004 3300048925 Bacteria 645283
286 Ga0496122_0000215 3300048925 Bacteria 128810
287 Ga0496122_0000840 3300048925 Bacteria 58107
288 Ga0496122_0014566 3300048925 Bacteria 7591
289 Ga0496122_0015873 3300048925 Bacteria 7171
290 Ga0496122_0023427 3300048925 Bacteria 5443
291 Ga0496122_0031991 3300048925 Bacteria 4360
292 Ga0496122_0046471 3300048925 Bacteria 3361
293 Ga0496122_0088259 3300048925 Bacteria 2126
294 Ga0496122_0146740 3300048925 Bacteria 1464
295 Ga0496123_0000007 3300048926 Bacteria 645283
296 Ga0496123_0000306 3300048926 Bacteria 95266
297 Ga0496123_0000336 3300048926 Bacteria 89161
298 Ga0496123_0010719 3300048926 Bacteria 8054
299 Ga0496123_0012395 3300048926 Bacteria 7274
300 Ga0496123_0025971 3300048926 Bacteria 4401
301 Ga0496123_0037124 3300048926 Bacteria 3445
302 Ga0496123_0050627 3300048926 Bacteria 2773
303 Ga0496124_0001040 3300048927 Bacteria 43813
304 Ga0496124_0002399 3300048927 Bacteria 24609
305 Ga0496124_0003209 3300048927 Bacteria 20191
306 Ga0496124_0014012 3300048927 Bacteria 7778
307 Ga0496124_0017758 3300048927 Bacteria 6690
308 Ga0496124_0049121 3300048927 Bacteria 3600
309 Ga0496124_0067028 3300048927 Bacteria 2987
310 Ga0496124_0067968 3300048927 Bacteria 2963
311 Ga0496124_0209186 3300048927 Bacteria 1477
312 Ga0496125_0000039 3300048928 Bacteria 318665
313 Ga0496125_0000248 3300048928 Bacteria 110840
314 Ga0496125_0005944 3300048928 Bacteria 13366
315 Ga0496125_0178251 3300048928 Bacteria 1419
316 Ga0496126_0000866 3300048929 Bacteria 53241
317 Ga0496126_0001294 3300048929 Bacteria 39967
318 Ga0496126_0012603 3300048929 Bacteria 8654
319 Ga0496126_0030111 3300048929 Bacteria 5148
320 Ga0496126_0050121 3300048929 Bacteria 3806
321 Ga0496126_0091165 3300048929 Bacteria 2680
322 Ga0495678_002707 3300049459 Bacteria 11690
323 Ga0501032_0110851 3300049569 Bacteria 1816
324 Ga0501037_0048836 3300049573 Bacteria 3099
325 Ga0501037_0050282 3300049573 Bacteria 3051
326 Ga0501038_0040998 3300049574 Bacteria 4040
327 Ga0501038_0195661 3300049574 Bacteria 1625
328 Ga0501043_0075689 3300049579 Bacteria 2644
329 Ga0501046_0091893 3300049580 Bacteria 2334
330 Ga0501280_001357 3300049776 Bacteria 4639
331 Ga0501035_0090511 3300049822 Bacteria 2693
332 Ga0501044_0216663 3300049823 Bacteria 1866
333 nmdc:mga03683_535_c1 3300050489 Bacteria 10863
334 nmdc:mga00v17_128704_c1 3300050491 Bacteria 1617
335 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
336 nmdc:mga00v17_145662_c1 3300050491 Bacteria 1520
337 nmdc:mga0yw44_175_c1 3300050492 Bacteria 22466
338 nmdc:mga0yw44_6023_c1 3300050492 Bacteria 5809
339 nmdc:mga0k408_35280_c1 3300050493 Bacteria 2868
340 nmdc:mga06z11_25678_c1 3300050494 Bacteria 2795
341 nmdc:mga0sz30_867_c1 3300050516 Bacteria 10907
342 Ga0500610_0002875 3300053079 Bacteria 6473
343 Ga0500644_0018182 3300053088 Bacteria 2054
344 Ga0500557_002273 3300053105 Bacteria 3473
345 Ga0500618_000314 3300053125 Bacteria 35813
346 Ga0500618_000328 3300053125 Bacteria 34407
347 Ga0500618_013335 3300053125 Bacteria 2126
348 Ga0500658_0000465 3300053134 Bacteria 17285
349 Ga0500658_0033020 3300053134 Bacteria 2033
350 Ga0500559_0009323 3300053136 Bacteria 4253
351 Ga0500568_0000441 3300053139 Bacteria 31147
352 Ga0500568_0002224 3300053139 Bacteria 11649
353 Ga0500573_0047674 3300053140 Bacteria 2467
354 Ga0500590_000286 3300053148 Bacteria 16015
355 Ga0500616_0000277 3300053153 Bacteria 76399
356 Ga0500616_0001018 3300053153 Bacteria 29841
357 Ga0500616_0077548 3300053153 Bacteria 1677
358 Ga0500622_0000458 3300053156 Bacteria 38693
359 Ga0500622_0000627 3300053156 Bacteria 31781
360 Ga0500624_001340 3300053157 Bacteria 4175
361 Ga0500634_0013179 3300053161 Bacteria 4329
362 Ga0500636_0075100 3300053177 Bacteria 1955
363 Ga0587072_007761 3300059643 Bacteria 1681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2916007675 2916009820 344
2 3300048924 Ga0496121_0264704 Ga0496121_0264704_33_1175 356
3 3300048925 Ga0496122_0015873 Ga0496122_0015873_4817_5959 356
4 3300048927 Ga0496124_0001040 Ga0496124_0001040_32176_33402 361
5 3300048928 Ga0496125_0178251 Ga0496125_0178251_261_1346 361
6 3300021321 Ga0214542_1000012 Ga0214542_100001273 362
7 3300021327 Ga0214543_1000024 Ga0214543_100002474 362
8 3300013100 Ga0157373_10048957 Ga0157373_100489573 363
9 3300021321 Ga0214542_1018489 Ga0214542_10184892 364
10 3300021327 Ga0214543_1000038 Ga0214543_100003850 364
11 3300047443 Ga0495687_070919 Ga0495687_070919_20_1228 367
12 3300048919 Ga0496116_0128827 Ga0496116_0128827_15_1193 367
13 3300003794 Ga0055531_10015821 Ga0055531_100158213 368
14 3300048919 Ga0496116_0048481 Ga0496116_0048481_15_1190 368
15 3300048927 Ga0496124_0049121 Ga0496124_0049121_2411_3586 368
16 3300003792 Ga0055540_1000350 Ga0055540_100035028 370
17 3300003856 Ga0058692_1003579 Ga0058692_10035794 370
18 3300025273 Ga0209673_1004063 Ga0209673_10040635 370
19 3300025294 Ga0209025_1000213 Ga0209025_100021315 370
20 3300025303 Ga0209051_1000097 Ga0209051_100009777 370
21 3300027312 Ga0209371_1000022 Ga0209371_1000022100 370
22 3300027312 Ga0209371_1000173 Ga0209371_10001738 370
23 3300030500 Ga0268256_1000019 Ga0268256_1000019420 370
24 3300047472 Ga0495686_0018999 Ga0495686_0018999_1648_2892 370
25 3300003316 rootH1_10146533 rootH1_101465332 371
26 3300003781 Ga0055536_1005920 Ga0055536_10059201 371
27 3300025294 Ga0209025_1042981 Ga0209025_10429811 371
28 3300048920 Ga0496117_0063551 Ga0496117_0063551_351_1577 371
29 3300048924 Ga0496121_0000003 Ga0496121_0000003_406811_408037 371
30 3300048925 Ga0496122_0146740 Ga0496122_0146740_171_1397 371
31 3300048928 Ga0496125_0000039 Ga0496125_0000039_185448_186674 371
32 3300050491 nmdc:mga00v17_128704_c1 nmdc:mga00v17_128704_c1_242_1468 371
33 3300048921 Ga0496118_0006719 Ga0496118_0006719_4616_5911 372
34 3300002987 JGI25159J45721_1000014 JGI25159J45721_100001473 373
35 3300003354 JGI25160J50197_1000020 JGI25160J50197_100002073 373
36 3300004625 Ga0055543_1000047 Ga0055543_100004724 373
37 3300005262 Ga0065165_1000013 Ga0065165_1000013146 373
38 3300025208 Ga0209436_103391 Ga0209436_1033914 373
39 3300025284 Ga0209130_1000034 Ga0209130_1000034142 373
40 3300025294 Ga0209025_1000314 Ga0209025_10003144 373
41 3300025298 Ga0209050_1000646 Ga0209050_100064648 373
42 3300025302 Ga0207426_1000006 Ga0207426_1000006515 373
43 3300025303 Ga0209051_1029781 Ga0209051_10297812 373
44 3300047472 Ga0495686_0005077 Ga0495686_0005077_2920_4170 373
45 3300025294 Ga0209025_1019203 Ga0209025_10192032 374
46 iso_pu_bacteria 2924214083 2924216800 374
47 3300031901 Ga0307406_10120322 Ga0307406_101203221 375
48 3300037068 Ga0373925_0002266 Ga0373925_0002266_5111_6307 375
49 3300053088 Ga0500644_0018182 Ga0500644_0018182_345_1541 376
50 3300053156 Ga0500622_0000627 Ga0500622_0000627_26675_27871 376
51 iso_pu_bacteria 8005668836 8005672328 376
52 3300002987 JGI25159J45721_1003265 JGI25159J45721_10032654 377
53 3300003320 rootH2_10058184 rootH2_100581841 377
54 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001639 377
55 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001116 377
56 3300003771 Ga0055526_1005167 Ga0055526_10051672 377
57 3300003790 Ga0055528_1000512 Ga0055528_10005123 377
58 3300004625 Ga0055543_1000003 Ga0055543_1000003132 377
59 3300005262 Ga0065165_1000068 Ga0065165_100006837 377
60 3300025284 Ga0209130_1000003 Ga0209130_1000003138 377
61 3300025302 Ga0207426_1000011 Ga0207426_1000011640 377
62 3300048927 Ga0496124_0003209 Ga0496124_0003209_4740_5936 377
63 3300053125 Ga0500618_000328 Ga0500618_000328_12584_13828 378
64 3300003187 JGI25151J46595_10003192 JGI25151J46595_100031924 379
65 3300025294 Ga0209025_1000140 Ga0209025_100014053 379
66 3300048927 Ga0496124_0014012 Ga0496124_0014012_2912_4138 379
67 3300048929 Ga0496126_0091165 Ga0496126_0091165_166_1392 379
68 3300041404 Ga0439436_0009533 Ga0439436_0009533_666_1874 380
69 3300042015 Ga0439462_0002977 Ga0439462_0002977_2452_3660 380
70 3300048920 Ga0496117_0008182 Ga0496117_0008182_8693_9925 380
71 3300048925 Ga0496122_0000840 Ga0496122_0000840_46825_48057 380
72 3300048926 Ga0496123_0000336 Ga0496123_0000336_34296_35528 380
73 3300048927 Ga0496124_0067968 Ga0496124_0067968_1341_2555 380
74 3300048928 Ga0496125_0000248 Ga0496125_0000248_75157_76389 380
75 3300048929 Ga0496126_0001294 Ga0496126_0001294_32688_33914 380
76 3300053153 Ga0500616_0000277 Ga0500616_0000277_6860_8062 380
77 3300046513 Ga0495616_0036958 Ga0495616_0036958_1294_2490 381
78 3300046558 Ga0495633_0069375 Ga0495633_0069375_321_1529 381
79 3300048925 Ga0496122_0000215 Ga0496122_0000215_66008_67210 381
80 3300048926 Ga0496123_0000306 Ga0496123_0000306_61601_62803 381
81 3300003775 Ga0055524_1002147 Ga0055524_100214710 382
82 3300013249 Ga0171463_1003 Ga0171463_1003148 382
83 3300015690 Ga0183363_1158 Ga0183363_115813 382
84 3300025294 Ga0209025_1044245 Ga0209025_10442452 382
85 3300025299 Ga0209256_1000396 Ga0209256_100039620 382
86 3300048919 Ga0496116_0000142 Ga0496116_0000142_76807_78033 382
87 3300048927 Ga0496124_0209186 Ga0496124_0209186_24_1250 382
88 3300003771 Ga0055526_1001900 Ga0055526_100190013 383
89 3300006946 Ga0079104_1000045 Ga0079104_10000455 383
90 3300006948 Ga0099826_10006287 Ga0099826_100062874 383
91 3300025295 Ga0209564_1000013 Ga0209564_1000013142 383
92 3300025299 Ga0209256_1001575 Ga0209256_100157517 383
93 3300027111 Ga0209281_1000034 Ga0209281_100003481 383
94 3300027666 Ga0209282_1000628 Ga0209282_100062813 383
95 3300028794 Ga0307515_10003171 Ga0307515_100031716 383
96 3300031456 Ga0307513_10012757 Ga0307513_100127573 383
97 3300041413 Ga0439465_0000968 Ga0439465_0000968_6799_8052 383
98 3300046674 Ga0495588_0000645 Ga0495588_0000645_14256_15482 383
99 3300047470 Ga0495681_0002148 Ga0495681_0002148_12781_14007 383
100 3300048907 Ga0496104_0094068 Ga0496104_0094068_1618_2844 383
101 3300048922 Ga0496119_0095567 Ga0496119_0095567_415_1641 383
102 3300048925 Ga0496122_0088259 Ga0496122_0088259_457_1683 383
103 3300037471 Ga0395905_0027015 Ga0395905_0027015_3088_4245 384
104 3300048929 Ga0496126_0012603 Ga0496126_0012603_2330_3526 384
105 3300002739 JGI25158J39367_1000325 JGI25158J39367_10003255 385
106 3300002774 JGI25150J39212_1006967 JGI25150J39212_10069671 385
107 3300002987 JGI25159J45721_1000424 JGI25159J45721_10004243 385
108 3300003354 JGI25160J50197_1002835 JGI25160J50197_10028352 385
109 3300003374 JGI25161J50226_1000301 JGI25161J50226_100030114 385
110 3300003771 Ga0055526_1004707 Ga0055526_10047075 385
111 3300003775 Ga0055524_1008904 Ga0055524_10089041 385
112 3300003790 Ga0055528_1002231 Ga0055528_10022315 385
113 3300003792 Ga0055540_1010736 Ga0055540_10107361 385
114 3300003856 Ga0058692_1006401 Ga0058692_10064013 385
115 3300004625 Ga0055543_1000355 Ga0055543_100035517 385
116 3300005262 Ga0065165_1018639 Ga0065165_10186392 385
117 3300025208 Ga0209436_100150 Ga0209436_1001505 385
118 3300025258 Ga0209129_1001121 Ga0209129_10011214 385
119 3300025273 Ga0209673_1000117 Ga0209673_100011765 385
120 3300025273 Ga0209673_1005985 Ga0209673_10059853 385
121 3300025284 Ga0209130_1000020 Ga0209130_1000020238 385
122 3300025295 Ga0209564_1000386 Ga0209564_100038665 385
123 3300025295 Ga0209564_1002355 Ga0209564_10023554 385
124 3300025297 Ga0209758_1001956 Ga0209758_100195613 385
125 3300025297 Ga0209758_1002998 Ga0209758_10029984 385
126 3300025299 Ga0209256_1001585 Ga0209256_100158513 385
127 3300025299 Ga0209256_1004556 Ga0209256_10045565 385
128 3300025302 Ga0207426_1000008 Ga0207426_1000008306 385
129 3300025303 Ga0209051_1001837 Ga0209051_10018371 385
130 3300027312 Ga0209371_1007319 Ga0209371_10073192 385
131 3300030500 Ga0268256_1008535 Ga0268256_10085351 385
132 3300050491 nmdc:mga00v17_145662_c1 nmdc:mga00v17_145662_c1_91_1317 385
133 3300059643 Ga0587072_007761 Ga0587072_007761_50_1276 385
134 3300005331 Ga0070670_100036105 Ga0070670_1000361053 386
135 3300005548 Ga0070665_100006642 Ga0070665_1000066422 386
136 3300006042 Ga0075368_10000960 Ga0075368_100009606 386
137 3300006948 Ga0099826_10081907 Ga0099826_100819072 386
138 3300009765 Ga0123341_1000007 Ga0123341_100000769 386
139 3300009766 Ga0123342_1008862 Ga0123342_100886211 386
140 3300009766 Ga0123342_1010306 Ga0123342_10103067 386
141 3300013102 Ga0157371_10000017 Ga0157371_1000001775 386
142 3300013104 Ga0157370_10000461 Ga0157370_100004615 386
143 3300025245 Ga0207425_1002917 Ga0207425_10029174 386
144 3300025245 Ga0207425_1004688 Ga0207425_10046884 386
145 3300025297 Ga0209758_1001965 Ga0209758_100196513 386
146 3300025925 Ga0207650_10024844 Ga0207650_100248442 386
147 3300027866 Ga0209813_10020367 Ga0209813_100203672 386
148 3300028379 Ga0268266_10013232 Ga0268266_100132322 386
149 3300031911 Ga0307412_10000493 Ga0307412_1000049321 386
150 3300048920 Ga0496117_0000002 Ga0496117_0000002_451925_453151 386
151 3300048921 Ga0496118_0000087 Ga0496118_0000087_63484_64710 386
152 3300048922 Ga0496119_0024029 Ga0496119_0024029_854_2080 386
153 3300048923 Ga0496120_0000413 Ga0496120_0000413_32810_34036 386
154 3300048925 Ga0496122_0000004 Ga0496122_0000004_136707_137933 386
155 3300048926 Ga0496123_0000007 Ga0496123_0000007_136707_137933 386
156 3300048927 Ga0496124_0002399 Ga0496124_0002399_12953_14203 386
157 3300048927 Ga0496124_0017758 Ga0496124_0017758_3957_5183 386
158 3300050491 nmdc:mga00v17_12_c1 nmdc:mga00v17_12_c1_2210_3436 386
159 3300050516 nmdc:mga0sz30_867_c1 nmdc:mga0sz30_867_c1_4235_5461 386
160 3300053157 Ga0500624_001340 Ga0500624_001340_2467_3693 386
161 3300031731 Ga0307405_10003099 Ga0307405_100030995 387
162 3300048919 Ga0496116_0120115 Ga0496116_0120115_22_1281 387
163 3300049569 Ga0501032_0110851 Ga0501032_0110851_541_1755 387
164 3300049573 Ga0501037_0050282 Ga0501037_0050282_369_1583 387
165 3300049574 Ga0501038_0195661 Ga0501038_0195661_340_1554 387
166 3300006946 Ga0079104_1008418 Ga0079104_10084182 388
167 3300022739 Ga0228711_1000008 Ga0228711_100000811 388
168 3300022740 Ga0228710_1000009 Ga0228710_100000910 388
169 3300027111 Ga0209281_1000106 Ga0209281_1000106221 388
170 3300027666 Ga0209282_1000024 Ga0209282_1000024152 388
171 3300031967 Ga0315914_1000012 Ga0315914_100001211 388
172 3300033430 Ga0315913_1000006 Ga0315913_100000611 388
173 3300033464 Ga0315915_1000010 Ga0315915_1000010254 388
174 3300002773 JGI25152J39213_1004106 JGI25152J39213_10041064 389
175 3300003790 Ga0055528_1000234 Ga0055528_100023434 389
176 3300006038 Ga0075365_10000068 Ga0075365_1000006811 389
177 3300025258 Ga0209129_1000218 Ga0209129_100021820 389
178 3300025273 Ga0209673_1000010 Ga0209673_1000010228 389
179 3300025294 Ga0209025_1006435 Ga0209025_10064354 389
180 3300025295 Ga0209564_1015750 Ga0209564_10157502 389
181 3300025299 Ga0209256_1000610 Ga0209256_100061039 389
182 3300046492 Ga0495585_0005327 Ga0495585_0005327_6061_7305 389
183 3300046558 Ga0495633_0052841 Ga0495633_0052841_299_1543 389
184 3300048917 Ga0496114_0110695 Ga0496114_0110695_940_2151 389
185 3300048924 Ga0496121_0020138 Ga0496121_0020138_178_1422 389
186 3300048926 Ga0496123_0037124 Ga0496123_0037124_1508_2752 389
187 3300002774 JGI25150J39212_1000074 JGI25150J39212_100007442 390
188 3300003187 JGI25151J46595_10001329 JGI25151J46595_100013294 390
189 3300003215 JGI25153J46596_10000267 JGI25153J46596_1000026713 390
190 3300025245 Ga0207425_1000075 Ga0207425_100007543 390
191 3300025258 Ga0209129_1000156 Ga0209129_100015655 390
192 3300025294 Ga0209025_1000070 Ga0209025_1000070222 390
193 3300025297 Ga0209758_1000094 Ga0209758_100009413 390
194 3300046460 Ga0495638_0001181 Ga0495638_0001181_1153_2403 390
195 3300046492 Ga0495585_0002937 Ga0495585_0002937_4013_5263 390
196 3300046506 Ga0495583_0014957 Ga0495583_0014957_1079_2329 390
197 3300046518 Ga0495631_0000327 Ga0495631_0000327_18013_19263 390
198 3300046538 Ga0495609_0068292 Ga0495609_0068292_226_1476 390
199 3300046616 Ga0495668_0001961 Ga0495668_0001961_3742_4992 390
200 3300046660 Ga0495625_0001387 Ga0495625_0001387_3773_5023 390
201 3300047320 Ga0495672_0009547 Ga0495672_0009547_3959_5209 390
202 3300048919 Ga0496116_0003173 Ga0496116_0003173_12844_14103 390
203 3300048919 Ga0496116_0004575 Ga0496116_0004575_9498_10757 390
204 3300048924 Ga0496121_0048879 Ga0496121_0048879_1405_2664 390
205 3300048925 Ga0496122_0031991 Ga0496122_0031991_3012_4271 390
206 3300048926 Ga0496123_0050627 Ga0496123_0050627_110_1369 390
207 3300048927 Ga0496124_0067028 Ga0496124_0067028_1471_2730 390
208 3300048928 Ga0496125_0005944 Ga0496125_0005944_8934_10193 390
209 3300048929 Ga0496126_0030111 Ga0496126_0030111_1243_2502 390
210 3300049459 Ga0495678_002707 Ga0495678_002707_9153_10403 390
211 3300053079 Ga0500610_0002875 Ga0500610_0002875_3765_5015 390
212 3300053105 Ga0500557_002273 Ga0500557_002273_1877_3127 390
213 3300053139 Ga0500568_0000441 Ga0500568_0000441_13911_15161 390
214 3300053153 Ga0500616_0001018 Ga0500616_0001018_5972_7222 390
215 iso_pu_bacteria 2510461069 2510841918 390
216 iso_pu_bacteria 2643221653 2644298686 390
217 iso_pu_bacteria 2643221719 2644656915 390
218 iso_pu_bacteria 2775507049 2776913940 390
219 iso_pu_bacteria 2818991272 2819241387 390
220 iso_pu_bacteria 2989776772 2989779221 390
221 iso_pu_bacteria 8005246636 8005248782 390
222 iso_pu_bacteria 8056875544 8056877283 390
223 3300005548 Ga0070665_100056582 Ga0070665_1000565822 391
224 3300005616 Ga0068852_100069250 Ga0068852_1000692502 391
225 3300005834 Ga0068851_10015204 Ga0068851_100152044 391
226 3300009093 Ga0105240_10000076 Ga0105240_10000076177 391
227 3300009545 Ga0105237_10000226 Ga0105237_1000022617 391
228 3300010375 Ga0105239_10010871 Ga0105239_100108718 391
229 3300014497 Ga0182008_10007170 Ga0182008_100071702 391
230 3300015262 Ga0182007_10001912 Ga0182007_100019123 391
231 3300025253 Ga0209677_101110 Ga0209677_1011105 391
232 3300025261 Ga0209233_1000148 Ga0209233_1000148180 391
233 3300025913 Ga0207695_10000011 Ga0207695_1000001124 391
234 3300025914 Ga0207671_10000093 Ga0207671_10000093109 391
235 3300028379 Ga0268266_10066012 Ga0268266_100660121 391
236 3300046507 Ga0495606_0002324 Ga0495606_0002324_20218_21462 391
237 3300048906 Ga0496103_0002316 Ga0496103_0002316_6821_8065 391
238 3300048920 Ga0496117_0016063 Ga0496117_0016063_931_2175 391
239 3300048921 Ga0496118_0018301 Ga0496118_0018301_931_2175 391
240 3300048922 Ga0496119_0097263 Ga0496119_0097263_186_1430 391
241 3300048923 Ga0496120_0013309 Ga0496120_0013309_4072_5316 391
242 3300048924 Ga0496121_0002536 Ga0496121_0002536_4081_5325 391
243 3300048924 Ga0496121_0017405 Ga0496121_0017405_667_1911 391
244 3300048925 Ga0496122_0014566 Ga0496122_0014566_3977_5221 391
245 3300048926 Ga0496123_0010719 Ga0496123_0010719_6625_7869 391
246 3300048929 Ga0496126_0050121 Ga0496126_0050121_230_1474 391
247 iso_pu_bacteria 2643221618 2644107262 391
248 iso_pu_bacteria 2643221626 2644150828 391
249 iso_pu_bacteria 2643221655 2644308657 391
250 iso_pu_bacteria 2643221659 2644335475 391
251 iso_pu_bacteria 2643221698 2644539880 391
252 iso_pu_bacteria 2643221712 2644614598 391
253 iso_pu_bacteria 2657244999 2657681576 391
254 iso_pu_bacteria 2791355082 2792585113 391
255 iso_pu_bacteria 2802429268 2804752767 391
256 iso_pu_bacteria 2837651117 2837654508 391
257 iso_pu_bacteria 2844163670 2844164591 391
258 iso_pu_bacteria 2941499720 2941502120 391
259 3300003792 Ga0055540_1010620 Ga0055540_10106203 392
260 3300006178 Ga0075367_10027609 Ga0075367_100276091 392
261 3300031852 Ga0307410_10013918 Ga0307410_100139184 392
262 3300053177 Ga0500636_0075100 Ga0500636_0075100_50_1240 392
263 iso_pu_bacteria 2738541317 2738947319 392
264 iso_pu_bacteria 2891048133 2891050844 392
265 iso_pu_bacteria 2899803654 2899807252 392
266 iso_pu_bacteria 2913308742 2913312583 392
267 iso_pu_bacteria 2995392953 2995393021 392
268 iso_pu_bacteria 8005658619 8005659015 392
269 iso_pu_bacteria 8054558443 8054558630 392
270 iso_pu_bacteria 8055431914 8055432745 392
271 3300002737 JGI25162J39368_1000366 JGI25162J39368_10003666 393
272 3300003214 JGI25165J46597_1001244 JGI25165J46597_100124410 393
273 3300025233 Ga0209437_100051 Ga0209437_100051311 393
274 3300025261 Ga0209233_1000113 Ga0209233_100011332 393
275 iso_pu_bacteria 2643221637 2644209013 393
276 iso_pu_bacteria 2643221688 2644492045 393
277 iso_pu_bacteria 2643221718 2644652543 393
278 iso_pu_bacteria 2891373044 2891373364 393
279 iso_pu_bacteria 3003930520 3003934083 393
280 iso_pu_bacteria 8018150411 8018153243 393
281 3300047472 Ga0495686_0002638 Ga0495686_0002638_12051_13295 394
282 iso_pu_bacteria 2913295892 2913299297 394
283 iso_pu_bacteria 2989349275 2989349688 394
284 iso_pu_bacteria 2989771324 2989774303 394
285 3300003187 JGI25151J46595_10000486 JGI25151J46595_1000048616 395
286 3300003215 JGI25153J46596_10008873 JGI25153J46596_100088732 395
287 3300003771 Ga0055526_1002418 Ga0055526_10024184 395
288 3300025258 Ga0209129_1001564 Ga0209129_10015646 395
289 3300025294 Ga0209025_1000571 Ga0209025_100057114 395
290 3300025295 Ga0209564_1000424 Ga0209564_100042456 395
291 3300025297 Ga0209758_1000405 Ga0209758_100040521 395
292 3300042015 Ga0439462_0021545 Ga0439462_0021545_381_1577 395
293 iso_pu_bacteria 2558860983 2561468355 395
294 3300006946 Ga0079104_1004188 Ga0079104_10041883 396
295 3300027111 Ga0209281_1000318 Ga0209281_10003189 396
296 3300053140 Ga0500573_0047674 Ga0500573_0047674_974_2236 396
297 iso_pu_bacteria 2510917026 2511170053 396
298 iso_pu_bacteria 2513237159 2514001488 396
299 iso_pu_bacteria 2582581283 2585166365 396
300 iso_pu_bacteria 2582581306 2585267407 396
301 iso_pu_bacteria 2582581865 2585386475 396
302 iso_pu_bacteria 2582581866 2585393271 396
303 iso_pu_bacteria 2585427633 2585996217 396
304 iso_pu_bacteria 2585427634 2586000827 396
305 iso_pu_bacteria 2643221558 2643811518 396
306 iso_pu_bacteria 2643221607 2644050502 396
307 iso_pu_bacteria 2643221636 2644205730 396
308 iso_pu_bacteria 2643221686 2644483420 396
309 iso_pu_bacteria 2842521101 2842521829 396
310 iso_pu_bacteria 2854896431 2854899603 396
311 iso_pu_bacteria 2854916844 2854918428 396
312 iso_pu_bacteria 2919171160 2919174696 396
313 3300046492 Ga0495585_0015923 Ga0495585_0015923_1456_2742 397
314 3300046519 Ga0495632_0002058 Ga0495632_0002058_14431_15672 397
315 3300046558 Ga0495633_0011405 Ga0495633_0011405_149_1435 397
316 3300048929 Ga0496126_0000866 Ga0496126_0000866_34277_35473 397
317 3300049573 Ga0501037_0048836 Ga0501037_0048836_1579_2775 397
318 3300049574 Ga0501038_0040998 Ga0501038_0040998_2110_3306 397
319 3300049822 Ga0501035_0090511 Ga0501035_0090511_740_1936 397
320 3300049823 Ga0501044_0216663 Ga0501044_0216663_378_1574 397
321 iso_pu_bacteria 2721755684 2723561108 397
322 iso_pu_bacteria 2721755823 2724110828 397
323 iso_pu_bacteria 2818991461 2819684928 397
324 iso_pu_bacteria 2920760137 2920761505 397
325 iso_pu_bacteria 8005430974 8005435168 397
326 3300010375 Ga0105239_10050961 Ga0105239_100509613 398
327 3300037471 Ga0395905_0010069 Ga0395905_0010069_928_2127 398
328 3300049776 Ga0501280_001357 Ga0501280_001357_2304_3509 398
329 3300053136 Ga0500559_0009323 Ga0500559_0009323_1061_2260 398
330 3300053161 Ga0500634_0013179 Ga0500634_0013179_1362_2558 398
331 iso_pu_bacteria 2599185236 2599721898 398
332 iso_pu_bacteria 2690316117 2692315525 398
333 iso_pu_bacteria 2718217997 2719666173 398
334 iso_pu_bacteria 2718218199 2720492593 398
335 iso_pu_bacteria 2718218232 2720614027 398
336 iso_pu_bacteria 2791355091 2792620755 398
337 iso_pu_bacteria 2791355092 2792626114 398
338 iso_pu_bacteria 2821123053 2821127477 398
339 iso_pu_bacteria 2838048938 2838054371 398
340 iso_pu_bacteria 2838061910 2838068000 398
341 iso_pu_bacteria 2838736955 2838738001 398
342 iso_pu_bacteria 2841840854 2841841630 398
343 iso_pu_bacteria 2842140634 2842141408 398
344 iso_pu_bacteria 2842311132 2842314897 398
345 iso_pu_bacteria 2842447887 2842454066 398
346 iso_pu_bacteria 2857531043 2857536510 398
347 iso_pu_bacteria 2896384573 2896389011 398
348 iso_pu_bacteria 2508501122 2509108380 399
349 iso_pu_bacteria 2509276019 2509376487 399
350 iso_pu_bacteria 2509276021 2509392040 399
351 iso_pu_bacteria 2509276033 2509445632 399
352 iso_pu_bacteria 2509276033 2509447067 399
353 iso_pu_bacteria 2510065019 2510133969 399
354 iso_pu_bacteria 2510065057 2510306470 399
355 iso_pu_bacteria 2510461076 2510895388 399
356 iso_pu_bacteria 2511231052 2511502260 399
357 iso_pu_bacteria 2512047086 2512533633 399
358 iso_pu_bacteria 2512875026 2512970668 399
359 iso_pu_bacteria 2513237084 2513567958 399
360 iso_pu_bacteria 2513237085 2513576957 399
361 iso_pu_bacteria 2513237086 2513584368 399
362 iso_pu_bacteria 2513237089 2513604288 399
363 iso_pu_bacteria 2513237091 2513618820 399
364 iso_pu_bacteria 2513237103 2513708033 399
365 iso_pu_bacteria 2513237140 2513884389 399
366 iso_pu_bacteria 2513237143 2513905025 399
367 iso_pu_bacteria 2513237156 2513988374 399
368 iso_pu_bacteria 2513237160 2514006363 399
369 iso_pu_bacteria 2513237162 2514019992 399
370 iso_pu_bacteria 2515075009 2515113018 399
371 iso_pu_bacteria 2515154107 2515609036 399
372 iso_pu_bacteria 2515154113 2515638529 399
373 iso_pu_bacteria 2515154114 2515640978 399
374 iso_pu_bacteria 2515154116 2515655340 399
375 iso_pu_bacteria 2515154134 2515739497 399
376 iso_pu_bacteria 2516143018 2516204161 399
377 iso_pu_bacteria 2516653046 2516893639 399
378 iso_pu_bacteria 2516653077 2517036720 399
379 iso_pu_bacteria 2516653085 2517077078 399
380 iso_pu_bacteria 2517093000 2517095846 399
381 iso_pu_bacteria 2517287029 2517407418 399
382 iso_pu_bacteria 2517487022 2517570361 399
383 iso_pu_bacteria 2524023207 2524448540 399
384 iso_pu_bacteria 2529292951 2530645939 399
385 iso_pu_bacteria 2551306084 2551674527 399
386 iso_pu_bacteria 2551306084 2551677908 399
387 iso_pu_bacteria 2551306085 2551687721 399
388 iso_pu_bacteria 2551306086 2551691408 399
389 iso_pu_bacteria 2551306087 2551698040 399
390 iso_pu_bacteria 2551306089 2551715595 399
391 iso_pu_bacteria 2551306090 2551715862 399
392 iso_pu_bacteria 2551306091 2551726527 399
393 iso_pu_bacteria 2551306092 2551739255 399
394 iso_pu_bacteria 2551306093 2551744448 399
395 iso_pu_bacteria 2558860100 2558864445 399
396 iso_pu_bacteria 2585427526 2585527458 399
397 iso_pu_bacteria 2585427528 2585538199 399
398 iso_pu_bacteria 2585427593 2585836148 399
399 iso_pu_bacteria 2599185352 2600194409 399
400 iso_pu_bacteria 2643221689 2644499632 399
401 iso_pu_bacteria 2643221723 2644676063 399
402 iso_pu_bacteria 2718217882 2719181821 399
403 iso_pu_bacteria 2718218009 2719732485 399
404 iso_pu_bacteria 2718218233 2720620832 399
405 iso_pu_bacteria 2718218235 2720632157 399
406 iso_pu_bacteria 2718218269 2720775885 399
407 iso_pu_bacteria 2718218363 2721147912 399
408 iso_pu_bacteria 2718218365 2721159363 399
409 iso_pu_bacteria 2718218366 2721164748 399
410 iso_pu_bacteria 2721755514 2722840918 399
411 iso_pu_bacteria 2721755685 2723567704 399
412 iso_pu_bacteria 2721755810 2724045241 399
413 iso_pu_bacteria 2721755819 2724090492 399
414 iso_pu_bacteria 2721755822 2724104969 399
415 iso_pu_bacteria 2724679232 2725952546 399
416 iso_pu_bacteria 2728369365 2730165056 399
417 iso_pu_bacteria 2728369397 2730298995 399
418 iso_pu_bacteria 2738541333 2739032856 399
419 iso_pu_bacteria 2751185821 2753462043 399
420 iso_pu_bacteria 2765235942 2766065884 399
421 iso_pu_bacteria 2791355094 2792639051 399
422 iso_pu_bacteria 2791355253 2793280290 399
423 iso_pu_bacteria 2791355259 2793314529 399
424 iso_pu_bacteria 2791355260 2793320356 399
425 iso_pu_bacteria 2791355264 2793348895 399
426 iso_pu_bacteria 2791355266 2793362568 399
427 iso_pu_bacteria 2802428858 2802720057 399
428 iso_pu_bacteria 2802428859 2802727010 399
429 iso_pu_bacteria 2802428860 2802731987 399
430 iso_pu_bacteria 2802428861 2802739318 399
431 iso_pu_bacteria 2802428862 2802745701 399
432 iso_pu_bacteria 2802428863 2802752302 399
433 iso_pu_bacteria 2802429633 2806043836 399
434 iso_pu_bacteria 2802429634 2806050233 399
435 iso_pu_bacteria 2802429635 2806057049 399
436 iso_pu_bacteria 2802429636 2806064431 399
437 iso_pu_bacteria 2802429637 2806071698 399
438 iso_pu_bacteria 2838016132 2838017638 399
439 iso_pu_bacteria 2838022645 2838027562 399
440 iso_pu_bacteria 2838042994 2838043983 399
441 iso_pu_bacteria 2838068647 2838070128 399
442 iso_pu_bacteria 2838074704 2838076844 399
443 iso_pu_bacteria 2838680041 2838683453 399
444 iso_pu_bacteria 2838686498 2838687040 399
445 iso_pu_bacteria 2838694306 2838697604 399
446 iso_pu_bacteria 2838707686 2838710720 399
447 iso_pu_bacteria 2838729681 2838729987 399
448 iso_pu_bacteria 2838742623 2838742998 399
449 iso_pu_bacteria 2841851746 2841852484 399
450 iso_pu_bacteria 2841864319 2841870797 399
451 iso_pu_bacteria 2842077413 2842078893 399
452 iso_pu_bacteria 2842110456 2842113255 399
453 iso_pu_bacteria 2842118031 2842118597 399
454 iso_pu_bacteria 2842156927 2842158056 399
455 iso_pu_bacteria 2842163707 2842168780 399
456 iso_pu_bacteria 2842180545 2842181675 399
457 iso_pu_bacteria 2842198810 2842203572 399
458 iso_pu_bacteria 2842217011 2842217951 399
459 iso_pu_bacteria 2842229732 2842230274 399
460 iso_pu_bacteria 2842237096 2842240509 399
461 iso_pu_bacteria 2842243621 2842244176 399
462 iso_pu_bacteria 2842257432 2842257738 399
463 iso_pu_bacteria 2842264693 2842266281 399
464 iso_pu_bacteria 2842271015 2842271422 399
465 iso_pu_bacteria 2842291075 2842292555 399
466 iso_pu_bacteria 2842304105 2842305050 399
467 iso_pu_bacteria 2842341865 2842346473 399
468 iso_pu_bacteria 2842363717 2842368948 399
469 iso_pu_bacteria 2842370503 2842374084 399
470 iso_pu_bacteria 2842377471 2842378953 399
471 iso_pu_bacteria 2842384541 2842385108 399
472 iso_pu_bacteria 2842395702 2842399869 399
473 iso_pu_bacteria 2842422224 2842423742 399
474 iso_pu_bacteria 2842428310 2842430744 399
475 iso_pu_bacteria 2842434925 2842437269 399
476 iso_pu_bacteria 2842441272 2842443639 399
477 iso_pu_bacteria 2842462802 2842464887 399
478 iso_pu_bacteria 2842469257 2842471887 399
479 iso_pu_bacteria 2844454524 2844458407 399
480 iso_pu_bacteria 2847417321 2847419412 399
481 iso_pu_bacteria 2848992105 2848994440 399
482 iso_pu_bacteria 2850079185 2850081483 399
483 iso_pu_bacteria 2855825444 2855826359 399
484 iso_pu_bacteria 2855839649 2855841749 399
485 iso_pu_bacteria 2855872281 2855872506 399
486 iso_pu_bacteria 2857516855 2857517419 399
487 iso_pu_bacteria 2858800743 2858802534 399
488 iso_pu_bacteria 2915980308 2915981468 399
489 iso_pu_bacteria 2915986958 2915991462 399
490 iso_pu_bacteria 2915993759 2915998719 399
491 iso_pu_bacteria 2916000859 2916003467 399
492 iso_pu_bacteria 2916014648 2916019559 399
493 iso_pu_bacteria 2916021584 2916024939 399
494 iso_pu_bacteria 2916028427 2916033752 399
495 iso_pu_bacteria 2916035215 2916037885 399
496 iso_pu_bacteria 2916041962 2916045315 399
497 iso_pu_bacteria 2916048683 2916049061 399
498 iso_pu_bacteria 2916055098 2916055701 399
499 iso_pu_bacteria 2916061851 2916064875 399
500 iso_pu_bacteria 2916068649 2916075169 399
501 iso_pu_bacteria 2916076590 2916083216 399
502 iso_pu_bacteria 2920822456 2920825230 399
503 iso_pu_bacteria 2921201388 2921201851 399
504 iso_pu_bacteria 2921208531 2921209529 399
505 iso_pu_bacteria 2921237296 2921240911 399
506 iso_pu_bacteria 2921244191 2921246755 399
507 iso_pu_bacteria 2921250672 2921252115 399
508 iso_pu_bacteria 2921257292 2921263784 399
509 iso_pu_bacteria 2921263974 2921266228 399
510 iso_pu_bacteria 2921282425 2921287994 399
511 iso_pu_bacteria 2921289301 2921290937 399
512 iso_pu_bacteria 2921296804 2921299056 399
513 iso_pu_bacteria 2924144063 2924146735 399
514 iso_pu_bacteria 2924150972 2924157973 399
515 iso_pu_bacteria 2924158325 2924159293 399
516 iso_pu_bacteria 2924165586 2924169141 399
517 iso_pu_bacteria 2924172951 2924174550 399
518 iso_pu_bacteria 2924179722 2924182981 399
519 iso_pu_bacteria 2924186466 2924192692 399
520 iso_pu_bacteria 2924193448 2924195403 399
521 iso_pu_bacteria 2924200457 2924203306 399
522 iso_pu_bacteria 2924207177 2924210725 399
523 iso_pu_bacteria 2924221636 2924223275 399
524 iso_pu_bacteria 2924228884 2924230539 399
525 iso_pu_bacteria 2933570622 2933570858 399
526 iso_pu_bacteria 2933586486 2933588689 399
527 iso_pu_bacteria 2933599457 2933600934 399
528 iso_pu_bacteria 2935894831 2935897010 399
529 iso_pu_bacteria 2935901341 2935901944 399
530 iso_pu_bacteria 2936367885 2936372023 399
531 iso_pu_bacteria 2936375103 2936379886 399
532 iso_pu_bacteria 2936996657 2937000723 399
533 iso_pu_bacteria 2937002841 2937004540 399
534 iso_pu_bacteria 2937009748 2937011216 399
535 iso_pu_bacteria 2937016420 2937019805 399
536 iso_pu_bacteria 2937023124 2937024602 399
537 iso_pu_bacteria 2937029754 2937030315 399
538 iso_pu_bacteria 2937036028 2937042697 399
539 iso_pu_bacteria 2937042894 2937047961 399
540 iso_pu_bacteria 2937049772 2937056172 399
541 iso_pu_bacteria 2937056579 2937063552 399
542 iso_pu_bacteria 2937063883 2937067792 399
543 iso_pu_bacteria 2937071275 2937074409 399
544 iso_pu_bacteria 2937078374 2937080247 399
545 iso_pu_bacteria 2937084907 2937086365 399
546 iso_pu_bacteria 2937091812 2937097239 399
547 iso_pu_bacteria 2937098957 2937103017 399
548 iso_pu_bacteria 2937106411 2937111275 399
549 iso_pu_bacteria 2937113482 2937116125 399
550 iso_pu_bacteria 2937119839 2937122003 399
551 iso_pu_bacteria 2937126314 2937128844 399
552 iso_pu_bacteria 2957375807 2957376356 399
553 iso_pu_bacteria 2957382221 2957384259 399
554 iso_pu_bacteria 2957388812 2957390722 399
555 iso_pu_bacteria 2957395598 2957395878 399
556 iso_pu_bacteria 2957402308 2957404484 399
557 iso_pu_bacteria 2957408893 2957412071 399
558 iso_pu_bacteria 2957415311 2957421227 399
559 iso_pu_bacteria 2957422303 2957429636 399
560 iso_pu_bacteria 2957430029 2957431734 399
561 iso_pu_bacteria 2957437181 2957439384 399
562 iso_pu_bacteria 2957443900 2957446890 399
563 iso_pu_bacteria 2957450854 2957453732 399
564 iso_pu_bacteria 2957457609 2957461928 399
565 iso_pu_bacteria 2957464669 2957467026 399
566 iso_pu_bacteria 2957471148 2957472941 399
567 iso_pu_bacteria 2957478035 2957479586 399
568 iso_pu_bacteria 2957484790 2957490444 399
569 iso_pu_bacteria 2957491536 2957494125 399
570 iso_pu_bacteria 2957498199 2957503328 399
571 iso_pu_bacteria 2957505466 2957510632 399
572 iso_pu_bacteria 2960584000 2960584501 399
573 iso_pu_bacteria 2960591022 2960592115 399
574 iso_pu_bacteria 2960597568 2960599975 399
575 iso_pu_bacteria 2960603979 2960610607 399
576 iso_pu_bacteria 2960610863 2960612298 399
577 iso_pu_bacteria 2960617483 2960620482 399
578 iso_pu_bacteria 2960624210 2960624463 399
579 iso_pu_bacteria 2960631154 2960632075 399
580 iso_pu_bacteria 2960637947 2960644106 399
581 iso_pu_bacteria 2960645483 2960648397 399
582 iso_pu_bacteria 2960652885 2960656508 399
583 iso_pu_bacteria 2960660292 2960665549 399
584 iso_pu_bacteria 2960667422 2960669676 399
585 iso_pu_bacteria 2960674078 2960675142 399
586 iso_pu_bacteria 2960680706 2960681650 399
587 iso_pu_bacteria 2960687367 2960692517 399
588 iso_pu_bacteria 2960693952 2960694774 399
589 iso_pu_bacteria 2964607997 2964614143 399
590 iso_pu_bacteria 2964615318 2964617730 399
591 iso_pu_bacteria 2964621998 2964623615 399
592 iso_pu_bacteria 2964628898 2964632604 399
593 iso_pu_bacteria 2964636051 2964640801 399
594 iso_pu_bacteria 2964643177 2964645668 399
595 iso_pu_bacteria 2964649959 2964651573 399
596 iso_pu_bacteria 2964656573 2964660543 399
597 iso_pu_bacteria 2964663802 2964666905 399
598 iso_pu_bacteria 2964670856 2964671979 399
599 iso_pu_bacteria 2964678106 2964682892 399
600 iso_pu_bacteria 2964685014 2964688500 399
601 iso_pu_bacteria 2964691889 2964692497 399
602 iso_pu_bacteria 2964698721 2964701625 399
603 iso_pu_bacteria 2964705432 2964711075 399
604 iso_pu_bacteria 2964712639 2964715142 399
605 iso_pu_bacteria 2964719344 2964720696 399
606 iso_pu_bacteria 2967664464 2967665107 399
607 iso_pu_bacteria 2967671571 2967678396 399
608 iso_pu_bacteria 2967678726 2967684408 399
609 iso_pu_bacteria 2967686174 2967692104 399
610 iso_pu_bacteria 2967693043 2967694661 399
611 iso_pu_bacteria 2967699805 2967706447 399
612 iso_pu_bacteria 2967706974 2967708639 399
613 iso_pu_bacteria 2967714385 2967714892 399
614 iso_pu_bacteria 2967721400 2967726106 399
615 iso_pu_bacteria 2967728569 2967728966 399
616 iso_pu_bacteria 2967735183 2967737165 399
617 iso_pu_bacteria 2967742019 2967742780 399
618 iso_pu_bacteria 2967748971 2967751585 399
619 iso_pu_bacteria 2967755722 2967757895 399
620 iso_pu_bacteria 2967762386 2967767686 399
621 iso_pu_bacteria 2967769361 2967772103 399
622 iso_pu_bacteria 2967775926 2967778998 399
623 iso_pu_bacteria 2970019648 2970021044 399
624 iso_pu_bacteria 2970026789 2970028316 399
625 iso_pu_bacteria 2970033650 2970040307 399
626 iso_pu_bacteria 2970040964 2970042657 399
627 iso_pu_bacteria 2970047711 2970050988 399
628 iso_pu_bacteria 2970054988 2970056718 399
629 iso_pu_bacteria 2970061556 2970067160 399
630 iso_pu_bacteria 2970068827 2970071604 399
631 iso_pu_bacteria 2970076120 2970078280 399
632 iso_pu_bacteria 2970082768 2970085262 399
633 iso_pu_bacteria 2970088815 2970092564 399
634 iso_pu_bacteria 2970095765 2970097233 399
635 iso_pu_bacteria 2970102677 2970107981 399
636 iso_pu_bacteria 2970109326 2970110726 399
637 iso_pu_bacteria 2970116247 2970117372 399
638 iso_pu_bacteria 2970122695 2970125795 399
639 iso_pu_bacteria 2970129317 2970131148 399
640 iso_pu_bacteria 2970136068 2970136310 399
641 iso_pu_bacteria 2970143518 2970146701 399
642 iso_pu_bacteria 2970149975 2970151598 399
643 iso_pu_bacteria 2970156795 2970159585 399
644 iso_pu_bacteria 2970164137 2970166960 399
645 iso_pu_bacteria 2970170962 2970174260 399
646 iso_pu_bacteria 2970177841 2970180842 399
647 iso_pu_bacteria 2970184632 2970189187 399
648 iso_pu_bacteria 2970191845 2970193617 399
649 iso_pu_bacteria 2977516862 2977519133 399
650 iso_pu_bacteria 2977523885 2977528852 399
651 iso_pu_bacteria 2977530762 2977534028 399
652 iso_pu_bacteria 2977537788 2977539643 399
653 iso_pu_bacteria 2977544691 2977546387 399
654 iso_pu_bacteria 2977551784 2977558449 399
655 iso_pu_bacteria 2977558990 2977563190 399
656 iso_pu_bacteria 2977565890 2977567683 399
657 iso_pu_bacteria 2977572785 2977575729 399
658 iso_pu_bacteria 2977579622 2977581980 399
659 iso_pu_bacteria 2996893221 2996894316 399
660 iso_pu_bacteria 639633055 639649202 399
661 iso_pu_bacteria 643692032 643826327 399
662 iso_pu_bacteria 648276728 648739228 399
663 iso_pu_bacteria 8003992118 8003994183 399
664 iso_pu_bacteria 8003999396 8004001825 399
665 iso_pu_bacteria 8005282627 8005283243 399
666 iso_pu_bacteria 8005307578 8005312845 399
667 iso_pu_bacteria 8005376324 8005380939 399
668 iso_pu_bacteria 8005460587 8005463698 399
669 iso_pu_bacteria 8005497431 8005500910 399
670 iso_pu_bacteria 8005556819 8005557004 399
671 iso_pu_bacteria 8005563573 8005568004 399
672 iso_pu_bacteria 8005570704 8005573451 399
673 iso_pu_bacteria 8005619151 8005622283 399
674 iso_pu_bacteria 8005626139 8005632237 399
675 iso_pu_bacteria 8005695170 8005697411 399
676 iso_pu_bacteria 8018163183 8018164615 399
677 iso_pu_bacteria 8023680758 8023683157 399
678 iso_pu_bacteria 8024479707 8024482852 399
679 iso_pu_bacteria 8057874678 8057877662 399
680 3300003215 JGI25153J46596_10019777 JGI25153J46596_100197772 400
681 3300003792 Ga0055540_1006937 Ga0055540_10069372 400
682 3300005262 Ga0065165_1002171 Ga0065165_10021716 400
683 3300005347 Ga0070668_100076750 Ga0070668_1000767502 400
684 3300009177 Ga0105248_10059648 Ga0105248_100596482 400
685 3300025258 Ga0209129_1008363 Ga0209129_10083632 400
686 3300025297 Ga0209758_1000413 Ga0209758_100041318 400
687 3300025303 Ga0209051_1000314 Ga0209051_100031444 400
688 3300025304 Ga0209257_1005915 Ga0209257_10059155 400
689 3300028794 Ga0307515_10087514 Ga0307515_100875143 400
690 3300053125 Ga0500618_000314 Ga0500618_000314_30473_31714 400
691 iso_pu_bacteria 2510917030 2511199043 400
692 iso_pu_bacteria 2513237093 2513633371 400
693 iso_pu_bacteria 2582581298 2585222846 400
694 iso_pu_bacteria 2585427529 2585545429 400
695 iso_pu_bacteria 2615840624 2616293349 400
696 iso_pu_bacteria 2643221557 2643803072 400
697 iso_pu_bacteria 2643221610 2644063434 400
698 iso_pu_bacteria 2643221668 2644374717 400
699 iso_pu_bacteria 2643221675 2644414197 400
700 iso_pu_bacteria 2643221680 2644447725 400
701 iso_pu_bacteria 2643221726 2644690198 400
702 iso_pu_bacteria 2718217927 2719386424 400
703 iso_pu_bacteria 2718218423 2721400128 400
704 iso_pu_bacteria 2721755809 2724038941 400
705 iso_pu_bacteria 2791355256 2793294422 400
706 iso_pu_bacteria 2791355261 2793329525 400
707 iso_pu_bacteria 2791355262 2793334505 400
708 iso_pu_bacteria 2791355263 2793339222 400
709 iso_pu_bacteria 2791355265 2793351817 400
710 iso_pu_bacteria 2791355267 2793368858 400
711 iso_pu_bacteria 2802429605 2805928786 400
712 iso_pu_bacteria 2802429606 2805935068 400
713 iso_pu_bacteria 2838668709 2838670375 400
714 iso_pu_bacteria 2838701080 2838702746 400
715 iso_pu_bacteria 2842146304 2842147996 400
716 iso_pu_bacteria 2842192696 2842197372 400
717 iso_pu_bacteria 2842205361 2842205466 400
718 iso_pu_bacteria 2842250916 2842253062 400
719 iso_pu_bacteria 2842278818 2842278923 400
720 iso_pu_bacteria 2842285085 2842285586 400
721 iso_pu_bacteria 2842317721 2842320724 400
722 iso_pu_bacteria 2842402390 2842402946 400
723 iso_pu_bacteria 2842409023 2842409682 400
724 iso_pu_bacteria 2842415677 2842416333 400
725 iso_pu_bacteria 2842489311 2842491992 400
726 iso_pu_bacteria 2842495871 2842496812 400
727 iso_pu_bacteria 2936381700 2936382789 400
728 iso_pu_bacteria 3005445848 3005448460 400
729 iso_pu_bacteria 8005275841 8005281221 400
730 iso_pu_bacteria 8005289223 8005292222 400
731 iso_pu_bacteria 8005301065 8005303137 400
732 iso_pu_bacteria 8005382845 8005389110 400
733 iso_pu_bacteria 8005395548 8005396090 400
734 iso_pu_bacteria 8005688590 8005692095 400
735 iso_pu_bacteria 8018127388 8018134105 400
736 iso_pu_bacteria 8018176218 8018181314 400
737 iso_pu_bacteria 8024501048 8024504434 400
738 iso_pu_bacteria 8056375014 8056375945 400
739 iso_pu_bacteria 8056382006 8056386736 400
740 3300003771 Ga0055526_1007119 Ga0055526_10071194 401
741 3300003775 Ga0055524_1008133 Ga0055524_10081334 401
742 3300005455 Ga0070663_100090599 Ga0070663_1000905991 401
743 3300014325 Ga0163163_10314648 Ga0163163_103146481 401
744 3300025297 Ga0209758_1012550 Ga0209758_10125503 401
745 3300025299 Ga0209256_1011618 Ga0209256_10116184 401
746 3300025302 Ga0207426_1000869 Ga0207426_100086927 401
747 3300025972 Ga0207668_10119362 Ga0207668_101193622 401
748 3300026067 Ga0207678_10036250 Ga0207678_100362504 401
749 3300047443 Ga0495687_043767 Ga0495687_043767_189_1436 401
750 3300050492 nmdc:mga0yw44_175_c1 nmdc:mga0yw44_175_c1_14644_15870 401
751 3300053125 Ga0500618_013335 Ga0500618_013335_592_1812 401
752 iso_pu_bacteria 2519899620 2520377177 401
753 iso_pu_bacteria 2537561587 2537875420 401
754 iso_pu_bacteria 2554235003 2554248247 401
755 iso_pu_bacteria 2558860242 2559295363 401
756 iso_pu_bacteria 2599185210 2599601675 401
757 iso_pu_bacteria 2600255279 2601610065 401
758 iso_pu_bacteria 2600255308 2601746840 401
759 iso_pu_bacteria 2643221568 2643856755 401
760 iso_pu_bacteria 2643221582 2643920326 401
761 iso_pu_bacteria 2643221634 2644193525 401
762 iso_pu_bacteria 2643221693 2644521943 401
763 iso_pu_bacteria 2721755556 2723027489 401
764 iso_pu_bacteria 2728369352 2730108425 401
765 iso_pu_bacteria 2808606387 2808987903 401
766 iso_pu_bacteria 2818991439 2819559076 401
767 iso_pu_bacteria 2838675328 2838675759 401
768 iso_pu_bacteria 2838714209 2838714641 401
769 iso_pu_bacteria 2838719591 2838721558 401
770 iso_pu_bacteria 2838724970 2838725401 401
771 iso_pu_bacteria 2841846520 2841848510 401
772 iso_pu_bacteria 2841859092 2841862140 401
773 iso_pu_bacteria 2842124991 2842125459 401
774 iso_pu_bacteria 2842130223 2842130654 401
775 iso_pu_bacteria 2842152218 2842154176 401
776 iso_pu_bacteria 2842170452 2842170885 401
777 iso_pu_bacteria 2842175837 2842177796 401
778 iso_pu_bacteria 2842187318 2842187750 401
779 iso_pu_bacteria 2842211629 2842212061 401
780 iso_pu_bacteria 2842224351 2842226320 401
781 iso_pu_bacteria 2842515876 2842518924 401
782 iso_pu_bacteria 2899792073 2899796035 401
783 iso_pu_bacteria 2899845264 2899850613 401
784 iso_pu_bacteria 2919114240 2919114679 401
785 iso_pu_bacteria 2919166419 2919169257 401
786 iso_pu_bacteria 2926754445 2926755695 401
787 iso_pu_bacteria 2926760298 2926762813 401
788 iso_pu_bacteria 2929138655 2929140885 401
789 iso_pu_bacteria 2933006813 2933008821 401
790 iso_pu_bacteria 2933011516 2933014902 401
791 iso_pu_bacteria 2933594066 2933596580 401
792 iso_pu_bacteria 2978969890 2978974633 401
793 iso_pu_bacteria 2979089926 2979094697 401
794 iso_pu_bacteria 2979095461 2979100738 401
795 iso_pu_bacteria 2979100975 2979103929 401
796 iso_pu_bacteria 2984509177 2984511503 401
797 iso_pu_bacteria 2984518228 2984522136 401
798 iso_pu_bacteria 2984537506 2984541434 401
799 iso_pu_bacteria 2984587000 2984589955 401
800 iso_pu_bacteria 2984601300 2984603711 401
801 iso_pu_bacteria 650716007 650740572 401
802 iso_pu_bacteria 8003570095 8003571640 401
803 iso_pu_bacteria 8054460903 8054462991 401
804 3300048913 Ga0496110_0054085 Ga0496110_0054085_1795_3009 402
805 3300048914 Ga0496111_0000410 Ga0496111_0000410_17593_18807 402
806 3300048925 Ga0496122_0023427 Ga0496122_0023427_748_1962 402
807 3300048926 Ga0496123_0012395 Ga0496123_0012395_811_2025 402
808 3300049579 Ga0501043_0075689 Ga0501043_0075689_238_1464 402
809 3300049580 Ga0501046_0091893 Ga0501046_0091893_1045_2271 402
810 iso_pu_bacteria 2582581304 2585255100 402
811 iso_pu_bacteria 2585427594 2585843242 402
812 iso_pu_bacteria 2600254933 2600374344 402
813 iso_pu_bacteria 2738541293 2738800101 402
814 3300003354 JGI25160J50197_1001033 JGI25160J50197_10010333 403
815 3300003374 JGI25161J50226_1001190 JGI25161J50226_10011908 403
816 3300003790 Ga0055528_1015849 Ga0055528_10158492 403
817 3300004625 Ga0055543_1000776 Ga0055543_100077616 403
818 3300005262 Ga0065165_1014683 Ga0065165_10146832 403
819 3300006038 Ga0075365_10001261 Ga0075365_100012616 403
820 3300006177 Ga0075362_10009317 Ga0075362_100093173 403
821 3300006186 Ga0075369_10013710 Ga0075369_100137102 403
822 3300006195 Ga0075366_10003507 Ga0075366_100035072 403
823 3300006353 Ga0075370_10020671 Ga0075370_100206712 403
824 3300025273 Ga0209673_1000151 Ga0209673_100015187 403
825 3300025295 Ga0209564_1023864 Ga0209564_10238642 403
826 3300025297 Ga0209758_1001750 Ga0209758_100175013 403
827 3300025299 Ga0209256_1003401 Ga0209256_10034014 403
828 3300025302 Ga0207426_1000449 Ga0207426_100044914 403
829 3300025303 Ga0209051_1017349 Ga0209051_10173492 403
830 3300025303 Ga0209051_1022199 Ga0209051_10221992 403
831 3300031995 Ga0307409_100204536 Ga0307409_1002045362 403
832 3300046500 Ga0495596_0044584 Ga0495596_0044584_244_1530 403
833 3300046513 Ga0495616_0020484 Ga0495616_0020484_489_1775 403
834 3300046518 Ga0495631_0020323 Ga0495631_0020323_229_1515 403
835 3300046522 Ga0495643_0005737 Ga0495643_0005737_5772_7058 403
836 3300046530 Ga0495654_0000110 Ga0495654_0000110_80201_81418 403
837 3300046538 Ga0495609_0073448 Ga0495609_0073448_119_1405 403
838 3300046542 Ga0495597_0015155 Ga0495597_0015155_550_1836 403
839 3300046660 Ga0495625_0155673 Ga0495625_0155673_299_1516 403
840 3300046694 Ga0495649_0001505 Ga0495649_0001505_4080_5366 403
841 3300047472 Ga0495686_0034160 Ga0495686_0034160_725_2011 403
842 3300048090 Ga0495615_0001484 Ga0495615_0001484_551_1837 403
843 3300048091 Ga0495626_0049814 Ga0495626_0049814_415_1701 403
844 3300050489 nmdc:mga03683_535_c1 nmdc:mga03683_535_c1_7848_9134 403
845 3300050492 nmdc:mga0yw44_6023_c1 nmdc:mga0yw44_6023_c1_4386_5672 403
846 3300050493 nmdc:mga0k408_35280_c1 nmdc:mga0k408_35280_c1_1268_2554 403
847 3300050494 nmdc:mga06z11_25678_c1 nmdc:mga06z11_25678_c1_1226_2512 403
848 3300053134 Ga0500658_0000465 Ga0500658_0000465_10297_11583 403
849 3300053153 Ga0500616_0077548 Ga0500616_0077548_142_1428 403
850 iso_pu_bacteria 2513237088 2513596490 403
851 3300025923 Ga0207681_10213427 Ga0207681_102134272 404
852 3300048909 Ga0496106_0001376 Ga0496106_0001376_4202_5452 404
853 3300048924 Ga0496121_0010348 Ga0496121_0010348_4743_5993 404
854 3300048925 Ga0496122_0046471 Ga0496122_0046471_1812_3062 404
855 3300048926 Ga0496123_0025971 Ga0496123_0025971_1922_3172 404
856 3300053134 Ga0500658_0033020 Ga0500658_0033020_487_1737 404
857 3300053139 Ga0500568_0002224 Ga0500568_0002224_3730_4980 404
858 3300053156 Ga0500622_0000458 Ga0500622_0000458_4040_5290 404
859 iso_pu_bacteria 2510917028 2511187070 404
860 iso_pu_bacteria 2513237138 2513865615 404
861 iso_pu_bacteria 2534681796 2535516881 404
862 iso_pu_bacteria 2582581294 2585202255 404
863 iso_pu_bacteria 2582581299 2585231759 404
864 iso_pu_bacteria 2582581867 2585402382 404
865 iso_pu_bacteria 2585427590 2585822931 404
866 iso_pu_bacteria 2599185156 2599331766 404
867 iso_pu_bacteria 2643221599 2644003141 404
868 iso_pu_bacteria 2643221643 2644238662 404
869 iso_pu_bacteria 2842922631 2842924171 404
870 iso_pu_bacteria 2919100787 2919107643 404
871 iso_pu_bacteria 3005452660 3005454652 404
872 iso_pu_bacteria 8005542996 8005545634 404
873 iso_pu_bacteria 8024486573 8024488041 404
874 3300046663 Ga0495635_0105198 Ga0495635_0105198_478_1704 405
875 3300046675 Ga0495657_0074542 Ga0495657_0074542_563_1789 405
876 3300046809 Ga0495600_0018256 Ga0495600_0018256_1927_3153 405
877 3300047317 Ga0495604_0010846 Ga0495604_0010846_2435_3661 405
878 3300048924 Ga0496121_0001116 Ga0496121_0001116_14119_15348 405
879 3300053148 Ga0500590_000286 Ga0500590_000286_2775_4001 405
880 iso_pu_bacteria 2513237144 2513908986 405
881 iso_pu_bacteria 2513237146 2513925369 405
882 iso_pu_bacteria 2599185170 2599417285 405
883 iso_pu_bacteria 2838035591 2838038515 405
884 iso_pu_bacteria 2838661181 2838661574 405
885 iso_pu_bacteria 3005409236 3005414583 405
886 iso_pu_bacteria 2510917022 2511135416 406
887 iso_pu_bacteria 2524023209 2524459603 406
888 iso_pu_bacteria 2582581307 2585271153 406
889 iso_pu_bacteria 2582581308 2585277498 406
890 iso_pu_bacteria 2582581315 2585323318 406
891 iso_pu_bacteria 2582581316 2585331461 406
892 iso_pu_bacteria 2585427527 2585535125 406
893 iso_pu_bacteria 2585427530 2585555975 406
894 iso_pu_bacteria 2585427531 2585558877 406
895 iso_pu_bacteria 2585427608 2585898259 406
896 iso_pu_bacteria 2585427609 2585904153 406
897 iso_pu_bacteria 2585428125 2587980730 406
898 iso_pu_bacteria 2615840626 2616308973 406
899 iso_pu_bacteria 2615840698 2616554243 406
900 iso_pu_bacteria 2617270742 2617384703 406
901 iso_pu_bacteria 2667528174 2671111415 406
902 iso_pu_bacteria 2775507266 2778175430 406
903 iso_pu_bacteria 2818991448 2819609163 406
904 iso_pu_bacteria 2818991453 2819637608 406
905 iso_pu_bacteria 2838029111 2838029791 406
906 iso_pu_bacteria 2842298080 2842301384 406
907 iso_pu_bacteria 2842357229 2842357921 406
908 iso_pu_bacteria 2842475841 2842476924 406
909 iso_pu_bacteria 2842482326 2842484546 406
910 iso_pu_bacteria 2842502639 2842503319 406
911 iso_pu_bacteria 2842509118 2842511115 406
912 iso_pu_bacteria 2852387548 2852390240 406
913 iso_pu_bacteria 2919408235 2919409994 406
914 iso_pu_bacteria 3005416602 3005417390 406
915 iso_pu_bacteria 8005314921 8005315821 406
916 iso_pu_bacteria 8005645114 8005648151 406
917 iso_pu_bacteria 8005682033 8005682875 406
918 iso_pu_bacteria 8046767195 8046771947 406
919 iso_pu_bacteria 8057575449 8057575723 406
920 iso_pu_bacteria 8005484373 8005489173 407
921 iso_pu_bacteria 2923556063 2923558588 408
922 iso_pu_bacteria 2996887358 2996889022 408
923 iso_pu_bacteria 8005258706 8005260321 408
924 iso_pu_bacteria 8005321885 8005323549 408
925 3300002737 JGI25162J39368_1000368 JGI25162J39368_10003685 410
926 3300003214 JGI25165J46597_1000516 JGI25165J46597_100051629 410
927 3300003322 rootL2_10010590 rootL2_1001059012 410
928 3300003856 Ga0058692_1015739 Ga0058692_10157392 410
929 3300025233 Ga0209437_100098 Ga0209437_100098153 410
930 3300025261 Ga0209233_1000095 Ga0209233_1000095270 410
931 3300027312 Ga0209371_1008531 Ga0209371_10085312 410
932 3300030500 Ga0268256_1011027 Ga0268256_10110272 410
933 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001308 411
934 3300002705 JGI25156J39149_1000001 JGI25156J39149_100000125 411
935 3300002738 JGI25154J39366_1000122 JGI25154J39366_100012232 411
936 3300002741 JGI25157J39369_1000044 JGI25157J39369_100004424 411
937 3300025206 Ga0209435_100012 Ga0209435_100012358 411
938 3300025246 Ga0209646_1000026 Ga0209646_1000026358 411
939 3300025250 Ga0209026_1000014 Ga0209026_1000014358 411
940 3300025256 Ga0209759_1000012 Ga0209759_1000012358 411

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13406

SLT_2

Transglycosylase SLT domain

38

316

0.97

PF01471

PG_binding_1

Putative peptidoglycan binding domain

334

390

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ao7-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-anhnam-pentapeptide 0.9125 43 410
5ao8-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-nam-pentapeptide 0.9122 43 410
5ao8-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-nam-pentapeptide 0.8961 43 410
5ao7-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-anhnam-pentapeptide 0.8941 43 410
5o8x-assembly2.cif.gz_B the x-ray structure of catenated lytic transglycosylase sltb1 from pseudomonas aeruginosa 0.8508 50 340
ID Description Score Start End Superfamily
af_P41052_109_361_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.8647 94 340 1.10.530.10
af_P41052_109_361_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.8301 94 340 1.10.530.10
af_Q54VI7_470_563_1.10.101.10 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.8249 359 410 1.10.101.10
4anrA02 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7816 88 342 1.10.530.10
4anrA02 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7778 88 342 1.10.530.10
ID Description Score Start End GO Terms
AF-A0A3D5IH63-F1-model_v4 deleted 0.9779 61 411
AF-A0A3D5IH63-F1-model_v4 deleted 0.9752 61 411
AF-A0A060BV06-F1-model_v4 CAZy families GH103 protein 0.9679 223 366 GO:0008933
GO:0009253
AF-A0A0F9D1A0-F1-model_v4 Peptidoglycan binding-like domain-containing protein 0.9605 253 411 GO:0008933
GO:0009253
AF-A0A7C9VBJ2-F1-model_v4 Lytic murein transglycosylase 0.9603 75 410 GO:0008933
GO:0009253

Feature Viewer

pLDDT pTM Quality
86.46 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map