F486095

General Info

Members Datasets Scaffolds Average Seq Length
933 260 1866 90

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_10875536|Ga0207686_108755361
Length 106
Sequence MRFQCKRRCAIKGTALMEERAFFRESETTKPATLNCPFCRTADTYDLRWMLRKKLDQVPRGADERDRARFAKFASYMVLLDDKAMCKNMRCRKRFDISGVKTMAFI

Samples

Sample ID Description Type Environment
1 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.29
Rhizosphere 98.18
Stem 0
Stem Tuber 0
Unclassified 31.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207686_10875536 3300025934 Unclassified 723
2 Ga0070658_10013746 3300005327 Bacteria 6496
3 Ga0070658_10169684 3300005327 Bacteria 1833
4 Ga0070658_10518154 3300005327 Bacteria 1031
5 Ga0070683_100000014 3300005329 Bacteria 221422
6 Ga0070683_100013387 3300005329 Bacteria 7153
7 Ga0070683_100063160 3300005329 Bacteria 3444
8 Ga0070683_100597462 3300005329 Bacteria 1056
9 Ga0070683_101151829 3300005329 Unclassified 745
10 Ga0070690_100332214 3300005330 Unclassified 1098
11 Ga0070690_100459870 3300005330 Unclassified 945
12 Ga0070670_100560167 3300005331 Bacteria 1020
13 Ga0070677_10275502 3300005333 Unclassified 845
14 Ga0068869_100134205 3300005334 Bacteria 1905
15 Ga0068869_100669496 3300005334 Bacteria 883
16 Ga0068869_100733719 3300005334 Bacteria 845
17 Ga0068869_100926823 3300005334 Bacteria 755
18 Ga0068869_101676166 3300005334 Unclassified 567
19 Ga0070666_10215784 3300005335 Unclassified 1352
20 Ga0070666_10414495 3300005335 Unclassified 969
21 Ga0070680_100012925 3300005336 Bacteria 6493
22 Ga0070680_100136492 3300005336 Bacteria 2055
23 Ga0070680_100544963 3300005336 Unclassified 994
24 Ga0070682_101140950 3300005337 Unclassified 655
25 Ga0068868_100040065 3300005338 Bacteria 3644
26 Ga0068868_100334953 3300005338 Bacteria 1292
27 Ga0068868_100538481 3300005338 Unclassified 1027
28 Ga0068868_100857179 3300005338 Unclassified 823
29 Ga0068868_101337175 3300005338 Bacteria 666
30 Ga0068868_101826086 3300005338 Unclassified 575
31 Ga0070660_100012404 3300005339 Bacteria 6086
32 Ga0070660_100015079 3300005339 Bacteria 5576
33 Ga0070660_100146388 3300005339 Unclassified 1898
34 Ga0070660_100979997 3300005339 Unclassified 714
35 Ga0070660_100992054 3300005339 Unclassified 710
36 Ga0070689_100301358 3300005340 Bacteria 1334
37 Ga0070689_100712878 3300005340 Bacteria 877
38 Ga0070661_100192209 3300005344 Bacteria 1557
39 Ga0070661_100194112 3300005344 Unclassified 1549
40 Ga0070661_101377743 3300005344 Unclassified 593
41 Ga0070692_10111049 3300005345 Unclassified 1516
42 Ga0070692_10452879 3300005345 Unclassified 822
43 Ga0070668_100985391 3300005347 Bacteria 757
44 Ga0070669_101022984 3300005353 Unclassified 709
45 Ga0070675_100333010 3300005354 Bacteria 1343
46 Ga0070675_100658216 3300005354 Bacteria 952
47 Ga0070671_100064253 3300005355 Bacteria 3057
48 Ga0070673_100589453 3300005364 Bacteria 1013
49 Ga0070673_100706139 3300005364 Bacteria 926
50 Ga0070688_100982058 3300005365 Bacteria 670
51 Ga0070659_100023643 3300005366 Bacteria 4705
52 Ga0070659_100509779 3300005366 Unclassified 1026
53 Ga0070667_100279820 3300005367 Bacteria 1498
54 Ga0070667_100547121 3300005367 Unclassified 1064
55 Ga0070667_100666401 3300005367 Unclassified 961
56 Ga0070667_100820531 3300005367 Bacteria 864
57 Ga0070667_101089331 3300005367 Unclassified 747
58 Ga0070703_10079443 3300005406 Bacteria 1114
59 Ga0070709_10259953 3300005434 Unclassified 1254
60 Ga0070709_10272952 3300005434 Bacteria 1226
61 Ga0070709_10377165 3300005434 Bacteria 1053
62 Ga0070709_11661435 3300005434 Bacteria 521
63 Ga0070714_100001627 3300005435 Bacteria 16344
64 Ga0070714_100060059 3300005435 Bacteria 3262
65 Ga0070714_100611602 3300005435 Unclassified 1047
66 Ga0070713_100006450 3300005436 Bacteria 8135
67 Ga0070713_100045240 3300005436 Unclassified 3606
68 Ga0070713_100095623 3300005436 Bacteria 2563
69 Ga0070713_100151526 3300005436 Bacteria 2063
70 Ga0070713_100655728 3300005436 Bacteria 1000
71 Ga0070713_101305934 3300005436 Bacteria 703
72 Ga0070713_101316820 3300005436 Unclassified 700
73 Ga0070713_101707203 3300005436 Bacteria 611
74 Ga0070713_101730703 3300005436 Bacteria 607
75 Ga0070710_10234072 3300005437 Bacteria 1174
76 Ga0070710_10360278 3300005437 Unclassified 965
77 Ga0070701_10610616 3300005438 Unclassified 723
78 Ga0070711_100125904 3300005439 Bacteria 1902
79 Ga0070711_100216503 3300005439 Bacteria 1486
80 Ga0070711_100224825 3300005439 Unclassified 1461
81 Ga0070711_100267744 3300005439 Bacteria 1347
82 Ga0070711_100494753 3300005439 Unclassified 1007
83 Ga0070711_101025342 3300005439 Bacteria 709
84 Ga0070711_102036924 3300005439 Unclassified 505
85 Ga0070700_101029170 3300005441 Bacteria 679
86 Ga0070694_100550700 3300005444 Bacteria 924
87 Ga0070694_101396612 3300005444 Unclassified 591
88 Ga0070663_100034849 3300005455 Unclassified 3488
89 Ga0070663_100520890 3300005455 Bacteria 990
90 Ga0070663_101561169 3300005455 Unclassified 588
91 Ga0070678_100304218 3300005456 Bacteria 1356
92 Ga0070662_100071033 3300005457 Bacteria 2566
93 Ga0070662_101011681 3300005457 Unclassified 712
94 Ga0070681_10003876 3300005458 Bacteria 14077
95 Ga0070681_10109146 3300005458 Bacteria 2707
96 Ga0070681_10122152 3300005458 Bacteria 2538
97 Ga0070681_10128307 3300005458 Bacteria 2469
98 Ga0070681_10175144 3300005458 Bacteria 2067
99 Ga0070681_10440425 3300005458 Bacteria 1215
100 Ga0070681_10445815 3300005458 Unclassified 1206
101 Ga0070681_11329617 3300005458 Viruses 642
102 Ga0070681_11851029 3300005458 Archaea 531
103 Ga0068867_100047067 3300005459 Unclassified 3170
104 Ga0068867_100076038 3300005459 Bacteria 2520
105 Ga0070706_100270815 3300005467 Bacteria 1585
106 Ga0070698_101766646 3300005471 Unclassified 571
107 Ga0070679_100000672 3300005530 Bacteria 29143
108 Ga0070679_100134246 3300005530 Bacteria 2456
109 Ga0070679_100217552 3300005530 Bacteria 1872
110 Ga0070679_100336428 3300005530 Bacteria 1458
111 Ga0070679_100451018 3300005530 Bacteria 1231
112 Ga0070679_100471249 3300005530 Bacteria 1200
113 Ga0070679_101895252 3300005530 Unclassified 545
114 Ga0070679_102012335 3300005530 Unclassified 527
115 Ga0070679_102076142 3300005530 Unclassified 518
116 Ga0070684_100000004 3300005535 Bacteria 231043
117 Ga0070684_100002053 3300005535 Bacteria 14823
118 Ga0070684_100032924 3300005535 Bacteria 4422
119 Ga0070684_100161089 3300005535 Bacteria 2035
120 Ga0070684_101220716 3300005535 Unclassified 707
121 Ga0070684_101899337 3300005535 Unclassified 562
122 Ga0070697_100701481 3300005536 Bacteria 893
123 Ga0070697_101348001 3300005536 Unclassified 637
124 Ga0068853_100052122 3300005539 Bacteria 3524
125 Ga0068853_100069398 3300005539 Bacteria 3066
126 Ga0068853_100226141 3300005539 Bacteria 1710
127 Ga0068853_100319631 3300005539 Bacteria 1439
128 Ga0068853_100324356 3300005539 Bacteria 1428
129 Ga0070672_100793579 3300005543 Bacteria 833
130 Ga0070672_101614835 3300005543 Bacteria 582
131 Ga0070686_100161288 3300005544 Bacteria 1579
132 Ga0070695_100480919 3300005545 Unclassified 957
133 Ga0070695_100747717 3300005545 Unclassified 780
134 Ga0070695_101185953 3300005545 Unclassified 627
135 Ga0070695_101658132 3300005545 Bacteria 534
136 Ga0070696_100001668 3300005546 Bacteria 14553
137 Ga0070693_100021041 3300005547 Bacteria 3450
138 Ga0070693_100287802 3300005547 Bacteria 1103
139 Ga0070693_100678173 3300005547 Bacteria 752
140 Ga0070693_101335872 3300005547 Bacteria 555
141 Ga0070665_100066694 3300005548 Bacteria 3610
142 Ga0070665_100971276 3300005548 Unclassified 862
143 Ga0070665_101400474 3300005548 Unclassified 708
144 Ga0070665_101820767 3300005548 Unclassified 615
145 Ga0070704_100153184 3300005549 Bacteria 1815
146 Ga0070704_100614351 3300005549 Unclassified 957
147 Ga0068855_100000743 3300005563 Bacteria 40089
148 Ga0068855_100007504 3300005563 Bacteria 13204
149 Ga0068855_100008839 3300005563 Bacteria 12174
150 Ga0068855_100010547 3300005563 Bacteria 11142
151 Ga0068855_100013771 3300005563 Bacteria 9749
152 Ga0068855_100017351 3300005563 Bacteria 8661
153 Ga0068855_100050508 3300005563 Unclassified 4900
154 Ga0068855_100133837 3300005563 Unclassified 2829
155 Ga0068855_100189049 3300005563 Bacteria 2324
156 Ga0068855_100221012 3300005563 Bacteria 2124
157 Ga0068855_100496264 3300005563 Unclassified 1327
158 Ga0068855_101476967 3300005563 Bacteria 699
159 Ga0070664_100032705 3300005564 Bacteria 4351
160 Ga0070664_100260087 3300005564 Bacteria 1562
161 Ga0070664_100716055 3300005564 Unclassified 933
162 Ga0068857_100003455 3300005577 Bacteria 13177
163 Ga0068857_100012474 3300005577 Bacteria 7401
164 Ga0068857_100018394 3300005577 Bacteria 6131
165 Ga0068857_100070481 3300005577 Unclassified 3114
166 Ga0068857_101774171 3300005577 Bacteria 604
167 Ga0068857_102198384 3300005577 Unclassified 542
168 Ga0068854_100313272 3300005578 Unclassified 1273
169 Ga0068854_100383682 3300005578 Bacteria 1158
170 Ga0068854_100413126 3300005578 Bacteria 1119
171 Ga0068856_100000435 3300005614 Bacteria 45888
172 Ga0068856_100003656 3300005614 Bacteria 15436
173 Ga0068856_100005743 3300005614 Bacteria 12227
174 Ga0068856_100150378 3300005614 Bacteria 2337
175 Ga0068856_100213383 3300005614 Bacteria 1945
176 Ga0068856_100335234 3300005614 Bacteria 1530
177 Ga0068856_101650104 3300005614 Bacteria 654
178 Ga0068852_100004004 3300005616 Bacteria 10362
179 Ga0068852_100009031 3300005616 Bacteria 7377
180 Ga0068852_100019346 3300005616 Bacteria 5387
181 Ga0068852_100063441 3300005616 Unclassified 3217
182 Ga0068852_100289389 3300005616 Bacteria 1582
183 Ga0068852_100435832 3300005616 Bacteria 1295
184 Ga0068852_100593882 3300005616 Bacteria 1111
185 Ga0068852_101189863 3300005616 Bacteria 783
186 Ga0068852_101622047 3300005616 Bacteria 669
187 Ga0068859_100061999 3300005617 Bacteria 3769
188 Ga0068859_100142353 3300005617 Bacteria 2472
189 Ga0068859_100238826 3300005617 Bacteria 1906
190 Ga0068859_100484798 3300005617 Bacteria 1332
191 Ga0068859_102075141 3300005617 Bacteria 628
192 Ga0068864_100015131 3300005618 Bacteria 6415
193 Ga0068864_100366788 3300005618 Bacteria 1362
194 Ga0068864_100417920 3300005618 Unclassified 1277
195 Ga0068864_100835903 3300005618 Bacteria 907
196 Ga0068866_10264470 3300005718 Unclassified 1058
197 Ga0068861_100491415 3300005719 Bacteria 1108
198 Ga0068851_10063170 3300005834 Bacteria 1901
199 Ga0068851_10253901 3300005834 Unclassified 998
200 Ga0068851_10481207 3300005834 Unclassified 742
201 Ga0068863_100057677 3300005841 Unclassified 3675
202 Ga0068863_100368259 3300005841 Bacteria 1402
203 Ga0068863_100410188 3300005841 Bacteria 1326
204 Ga0068863_100515644 3300005841 Bacteria 1178
205 Ga0068858_100009648 3300005842 Bacteria 9197
206 Ga0068858_100026586 3300005842 Bacteria 5376
207 Ga0068858_100039451 3300005842 Bacteria 4379
208 Ga0068858_100433216 3300005842 Bacteria 1265
209 Ga0068858_100854866 3300005842 Bacteria 889
210 Ga0068860_100008567 3300005843 Bacteria 10194
211 Ga0068860_100027240 3300005843 Bacteria 5505
212 Ga0068860_101792516 3300005843 Unclassified 635
213 Ga0068860_101866752 3300005843 Bacteria 623
214 Ga0070717_10014186 3300006028 Bacteria 6127
215 Ga0070717_10021313 3300006028 Bacteria 5105
216 Ga0070717_10946923 3300006028 Bacteria 784
217 Ga0070715_10105354 3300006163 Unclassified 1322
218 Ga0070712_100340008 3300006175 Unclassified 1225
219 Ga0097621_100053240 3300006237 Unclassified 3298
220 Ga0097621_100055287 3300006237 Unclassified 3241
221 Ga0097621_100056467 3300006237 Bacteria 3208
222 Ga0097621_100077082 3300006237 Unclassified 2766
223 Ga0097621_100080057 3300006237 Bacteria 2716
224 Ga0097621_100091483 3300006237 Unclassified 2546
225 Ga0097621_100264932 3300006237 Bacteria 1508
226 Ga0097621_100510808 3300006237 Bacteria 1089
227 Ga0097621_100652236 3300006237 Bacteria 966
228 Ga0097621_101030069 3300006237 Bacteria 771
229 Ga0068871_100068595 3300006358 Bacteria 2912
230 Ga0068871_100079800 3300006358 Bacteria 2708
231 Ga0068871_100080324 3300006358 Bacteria 2700
232 Ga0068871_100089038 3300006358 Bacteria 2569
233 Ga0068871_100116910 3300006358 Bacteria 2248
234 Ga0068871_100120264 3300006358 Unclassified 2218
235 Ga0068871_100215228 3300006358 Bacteria 1663
236 Ga0068871_100318600 3300006358 Bacteria 1369
237 Ga0068871_100941440 3300006358 Bacteria 802
238 Ga0068871_101495958 3300006358 Unclassified 638
239 Ga0068871_101551958 3300006358 Unclassified 626
240 Ga0075433_11725045 3300006852 Unclassified 539
241 Ga0075434_100406794 3300006871 Bacteria 1382
242 Ga0068865_100006046 3300006881 Bacteria 7378
243 Ga0068865_101246398 3300006881 Unclassified 659
244 Ga0075436_100024722 3300006914 Bacteria 4130
245 Ga0075436_100606390 3300006914 Bacteria 807
246 Ga0097620_100062000 3300006931 Bacteria 3769
247 Ga0097620_100142355 3300006931 Bacteria 2472
248 Ga0097620_100238829 3300006931 Bacteria 1906
249 Ga0097620_100484789 3300006931 Bacteria 1332
250 Ga0097620_102075127 3300006931 Bacteria 628
251 Ga0075435_101228331 3300007076 Bacteria 656
252 Ga0105240_10002045 3300009093 Bacteria 33208
253 Ga0105240_10004457 3300009093 Bacteria 21347
254 Ga0105240_10009269 3300009093 Bacteria 13960
255 Ga0105240_10113264 3300009093 Bacteria 3278
256 Ga0105240_10147077 3300009093 Bacteria 2811
257 Ga0105240_10158950 3300009093 Unclassified 2686
258 Ga0105240_10203841 3300009093 Bacteria 2316
259 Ga0105240_10216793 3300009093 Unclassified 2232
260 Ga0105240_10262022 3300009093 Bacteria 1994
261 Ga0105240_10294504 3300009093 Bacteria 1859
262 Ga0105240_10414782 3300009093 Unclassified 1514
263 Ga0105240_10450459 3300009093 Bacteria 1440
264 Ga0105240_11601207 3300009093 Unclassified 681
265 Ga0105245_10000473 3300009098 Bacteria 36745
266 Ga0105245_10011946 3300009098 Bacteria 7549
267 Ga0105245_10027132 3300009098 Bacteria 5045
268 Ga0105245_10065967 3300009098 Bacteria 3275
269 Ga0105245_10086231 3300009098 Bacteria 2879
270 Ga0105245_10115022 3300009098 Bacteria 2506
271 Ga0105245_10125723 3300009098 Bacteria 2400
272 Ga0105245_10166006 3300009098 Bacteria 2099
273 Ga0105245_10191889 3300009098 Bacteria 1957
274 Ga0105245_10361040 3300009098 Bacteria 1442
275 Ga0105245_11871093 3300009098 Bacteria 653
276 Ga0105245_12112836 3300009098 Unclassified 617
277 Ga0105245_13077058 3300009098 Unclassified 517
278 Ga0105247_10022691 3300009101 Unclassified 3780
279 Ga0105247_10132345 3300009101 Bacteria 1626
280 Ga0105247_10347403 3300009101 Bacteria 1042
281 Ga0105247_10787826 3300009101 Bacteria 724
282 Ga0105247_11042471 3300009101 Unclassified 641
283 Ga0114129_10086606 3300009147 Bacteria 4345
284 Ga0105243_10003924 3300009148 Bacteria 11872
285 Ga0105243_10042868 3300009148 Bacteria 3545
286 Ga0105243_10112364 3300009148 Bacteria 2282
287 Ga0105243_10133516 3300009148 Bacteria 2109
288 Ga0105243_10457419 3300009148 Bacteria 1199
289 Ga0105243_10784512 3300009148 Bacteria 937
290 Ga0105243_10821261 3300009148 Bacteria 918
291 Ga0105243_10864528 3300009148 Unclassified 897
292 Ga0105241_10001262 3300009174 Bacteria 19295
293 Ga0105241_10055702 3300009174 Unclassified 3030
294 Ga0105241_10112825 3300009174 Bacteria 2178
295 Ga0105241_10153333 3300009174 Unclassified 1887
296 Ga0105241_10215599 3300009174 Bacteria 1610
297 Ga0105241_11260318 3300009174 Unclassified 702
298 Ga0105241_12283251 3300009174 Bacteria 538
299 Ga0105242_10010341 3300009176 Bacteria 7154
300 Ga0105242_10040739 3300009176 Bacteria 3743
301 Ga0105242_10142029 3300009176 Bacteria 2084
302 Ga0105242_10387450 3300009176 Bacteria 1301
303 Ga0105242_10397465 3300009176 Unclassified 1285
304 Ga0105242_10628902 3300009176 Bacteria 1041
305 Ga0105242_10647843 3300009176 Bacteria 1027
306 Ga0105242_11510222 3300009176 Unclassified 703
307 Ga0105242_11585411 3300009176 Unclassified 688
308 Ga0105242_12281277 3300009176 Unclassified 587
309 Ga0105242_12284067 3300009176 Bacteria 587
310 Ga0105242_13160956 3300009176 Unclassified 511
311 Ga0105248_10060966 3300009177 Unclassified 4235
312 Ga0105248_10093654 3300009177 Bacteria 3383
313 Ga0105248_10193567 3300009177 Unclassified 2291
314 Ga0105248_10299609 3300009177 Unclassified 1810
315 Ga0105248_10311810 3300009177 Bacteria 1772
316 Ga0105248_10443809 3300009177 Unclassified 1462
317 Ga0105248_10781264 3300009177 Bacteria 1078
318 Ga0105248_11833224 3300009177 Bacteria 688
319 Ga0105248_12319062 3300009177 Unclassified 611
320 Ga0105248_12471922 3300009177 Bacteria 592
321 Ga0105237_10019590 3300009545 Bacteria 6989
322 Ga0105237_10022025 3300009545 Bacteria 6540
323 Ga0105237_10045921 3300009545 Bacteria 4395
324 Ga0105237_10049444 3300009545 Unclassified 4226
325 Ga0105237_10081573 3300009545 Bacteria 3226
326 Ga0105237_10138840 3300009545 Bacteria 2425
327 Ga0105237_10255558 3300009545 Bacteria 1754
328 Ga0105237_10301962 3300009545 Unclassified 1604
329 Ga0105237_10375385 3300009545 Unclassified 1427
330 Ga0105237_10903901 3300009545 Bacteria 890
331 Ga0105237_11007045 3300009545 Unclassified 840
332 Ga0105237_11228418 3300009545 Bacteria 756
333 Ga0105237_11830863 3300009545 Bacteria 615
334 Ga0105237_11880130 3300009545 Unclassified 607
335 Ga0105238_10004238 3300009551 Bacteria 14249
336 Ga0105238_10008726 3300009551 Bacteria 10140
337 Ga0105238_10037209 3300009551 Bacteria 4948
338 Ga0105238_10061383 3300009551 Bacteria 3762
339 Ga0105238_10061723 3300009551 Unclassified 3750
340 Ga0105238_10086694 3300009551 Bacteria 3118
341 Ga0105238_10091689 3300009551 Bacteria 3026
342 Ga0105238_10159543 3300009551 Bacteria 2231
343 Ga0105238_10194597 3300009551 Unclassified 2003
344 Ga0105238_10198447 3300009551 Unclassified 1982
345 Ga0105238_10459014 3300009551 Bacteria 1271
346 Ga0105238_11786722 3300009551 Unclassified 647
347 Ga0105238_11909810 3300009551 Unclassified 627
348 Ga0105238_12195368 3300009551 Bacteria 587
349 Ga0105249_10005911 3300009553 Bacteria 10597
350 Ga0105249_10625523 3300009553 Unclassified 1133
351 Ga0105239_10005444 3300010375 Bacteria 14937
352 Ga0105239_10007139 3300010375 Bacteria 12847
353 Ga0105239_10014670 3300010375 Bacteria 8689
354 Ga0105239_10015885 3300010375 Bacteria 8334
355 Ga0105239_10037677 3300010375 Bacteria 5298
356 Ga0105239_10064209 3300010375 Bacteria 4030
357 Ga0105239_10251335 3300010375 Bacteria 1986
358 Ga0105239_10352663 3300010375 Bacteria 1661
359 Ga0105239_10396508 3300010375 Unclassified 1561
360 Ga0105239_10603818 3300010375 Unclassified 1252
361 Ga0105239_11085708 3300010375 Unclassified 921
362 Ga0105239_13101157 3300010375 Bacteria 541
363 Ga0105246_10009575 3300011119 Bacteria 5970
364 Ga0105246_10028368 3300011119 Bacteria 3677
365 Ga0105246_10219805 3300011119 Bacteria 1488
366 Ga0105246_10297659 3300011119 Unclassified 1301
367 Ga0105246_12558123 3300011119 Unclassified 503
368 Ga0157370_10003623 3300013104 Bacteria 18073
369 Ga0157370_10003855 3300013104 Bacteria 17488
370 Ga0157370_10031553 3300013104 Bacteria 5180
371 Ga0157370_10045469 3300013104 Unclassified 4212
372 Ga0157370_10080310 3300013104 Bacteria 3070
373 Ga0157370_10151895 3300013104 Unclassified 2155
374 Ga0157370_10153438 3300013104 Bacteria 2143
375 Ga0157369_10002505 3300013105 Bacteria 21985
376 Ga0157369_10004511 3300013105 Bacteria 16388
377 Ga0157369_10011678 3300013105 Bacteria 9974
378 Ga0157369_10051355 3300013105 Bacteria 4462
379 Ga0157369_10185201 3300013105 Bacteria 2190
380 Ga0157369_10206126 3300013105 Bacteria 2062
381 Ga0157369_10408276 3300013105 Bacteria 1409
382 Ga0157369_10553178 3300013105 Unclassified 1189
383 Ga0157369_10625956 3300013105 Bacteria 1110
384 Ga0157369_11024465 3300013105 Bacteria 845
385 Ga0157369_11829796 3300013105 Bacteria 617
386 Ga0157369_12068855 3300013105 Unclassified 577
387 Ga0157374_10014270 3300013296 Bacteria 6949
388 Ga0157374_10056589 3300013296 Bacteria 3662
389 Ga0157374_10450090 3300013296 Bacteria 1289
390 Ga0157374_10514339 3300013296 Bacteria 1203
391 Ga0157374_10550737 3300013296 Unclassified 1161
392 Ga0157374_10559057 3300013296 Bacteria 1152
393 Ga0157374_10712432 3300013296 Bacteria 1017
394 Ga0157374_10804924 3300013296 Bacteria 956
395 Ga0157374_10810098 3300013296 Unclassified 952
396 Ga0157374_10832716 3300013296 Unclassified 939
397 Ga0157374_11975479 3300013296 Bacteria 609
398 Ga0157374_12159510 3300013296 Unclassified 584
399 Ga0157378_10001093 3300013297 Bacteria 24766
400 Ga0157378_10241069 3300013297 Bacteria 1727
401 Ga0157378_10290511 3300013297 Bacteria 1579
402 Ga0157378_10371912 3300013297 Bacteria 1401
403 Ga0157378_10393930 3300013297 Unclassified 1363
404 Ga0157378_10483477 3300013297 Unclassified 1234
405 Ga0157378_10691014 3300013297 Bacteria 1039
406 Ga0157378_10855013 3300013297 Bacteria 938
407 Ga0157378_10997818 3300013297 Bacteria 871
408 Ga0157378_11030667 3300013297 Unclassified 858
409 Ga0157378_11053761 3300013297 Bacteria 849
410 Ga0163162_10008263 3300013306 Bacteria 10158
411 Ga0163162_10383608 3300013306 Bacteria 1538
412 Ga0163162_10496623 3300013306 Unclassified 1351
413 Ga0163162_11526492 3300013306 Bacteria 761
414 Ga0163162_12090925 3300013306 Bacteria 649
415 Ga0163162_12540278 3300013306 Unclassified 589
416 Ga0163162_12770312 3300013306 Unclassified 564
417 Ga0157372_10029710 3300013307 Bacteria 5971
418 Ga0157372_10030108 3300013307 Bacteria 5934
419 Ga0157372_10106871 3300013307 Bacteria 3202
420 Ga0157372_10208587 3300013307 Bacteria 2264
421 Ga0157372_10623603 3300013307 Bacteria 1256
422 Ga0157372_10644845 3300013307 Bacteria 1233
423 Ga0157372_11076531 3300013307 Unclassified 930
424 Ga0157372_11134385 3300013307 Unclassified 904
425 Ga0157372_11401257 3300013307 Bacteria 806
426 Ga0157372_11880433 3300013307 Bacteria 688
427 Ga0157372_11935945 3300013307 Unclassified 678
428 Ga0157375_10003392 3300013308 Bacteria 13815
429 Ga0157375_10074026 3300013308 Unclassified 3426
430 Ga0157375_10140289 3300013308 Bacteria 2544
431 Ga0157375_10215893 3300013308 Bacteria 2076
432 Ga0157375_10342439 3300013308 Bacteria 1660
433 Ga0157375_10432326 3300013308 Bacteria 1482
434 Ga0157375_10820588 3300013308 Bacteria 1078
435 Ga0157375_11076288 3300013308 Bacteria 941
436 Ga0157375_11376758 3300013308 Bacteria 831
437 Ga0157375_12822568 3300013308 Unclassified 581
438 Ga0157375_13783914 3300013308 Unclassified 502
439 Ga0163163_10003045 3300014325 Bacteria 14186
440 Ga0163163_10109905 3300014325 Unclassified 2785
441 Ga0163163_10111840 3300014325 Bacteria 2760
442 Ga0163163_10135045 3300014325 Unclassified 2508
443 Ga0163163_10197774 3300014325 Bacteria 2058
444 Ga0163163_10240569 3300014325 Bacteria 1860
445 Ga0163163_10464194 3300014325 Bacteria 1327
446 Ga0163163_11602628 3300014325 Unclassified 712
447 Ga0163163_12307833 3300014325 Unclassified 597
448 Ga0163163_12745241 3300014325 Unclassified 549
449 Ga0157379_10077140 3300014968 Unclassified 2984
450 Ga0157379_10176471 3300014968 Bacteria 1929
451 Ga0157379_10197427 3300014968 Bacteria 1819
452 Ga0157379_10199337 3300014968 Bacteria 1810
453 Ga0157379_10777423 3300014968 Bacteria 903
454 Ga0157379_10897924 3300014968 Unclassified 840
455 Ga0157379_11197653 3300014968 Unclassified 730
456 Ga0157376_10054248 3300014969 Bacteria 3341
457 Ga0157376_10061634 3300014969 Bacteria 3154
458 Ga0157376_10069476 3300014969 Bacteria 2986
459 Ga0157376_10135915 3300014969 Bacteria 2200
460 Ga0157376_10488713 3300014969 Bacteria 1208
461 Ga0157376_10573715 3300014969 Unclassified 1119
462 Ga0157376_10822586 3300014969 Bacteria 943
463 Ga0157376_11505976 3300014969 Bacteria 706
464 Ga0157376_11867848 3300014969 Unclassified 637
465 Ga0157376_13122756 3300014969 Bacteria 502
466 Ga0163161_11291966 3300017792 Unclassified 634
467 Ga0163161_11645213 3300017792 Bacteria 567
468 Ga0206356_11032977 3300020070 Bacteria 759
469 Ga0206349_1804240 3300020075 Bacteria 968
470 Ga0206350_10234319 3300020080 Bacteria 1060
471 Ga0154015_1100450 3300020610 Unclassified 663
472 Ga0224712_10156283 3300022467 Unclassified 1014
473 Ga0207656_10044812 3300025321 Unclassified 1890
474 Ga0207682_10324360 3300025893 Unclassified 724
475 Ga0207692_10293299 3300025898 Bacteria 988
476 Ga0207692_10706094 3300025898 Unclassified 655
477 Ga0207692_10939265 3300025898 Unclassified 570
478 Ga0207642_10278645 3300025899 Bacteria 961
479 Ga0207642_11070350 3300025899 Bacteria 521
480 Ga0207680_10826561 3300025903 Unclassified 664
481 Ga0207647_10334083 3300025904 Bacteria 859
482 Ga0207685_10223323 3300025905 Bacteria 897
483 Ga0207699_10796653 3300025906 Bacteria 695
484 Ga0207699_10858336 3300025906 Bacteria 669
485 Ga0207645_10196382 3300025907 Unclassified 1327
486 Ga0207705_10049187 3300025909 Bacteria 3035
487 Ga0207705_10238140 3300025909 Bacteria 1386
488 Ga0207705_10354300 3300025909 Unclassified 1131
489 Ga0207654_10002640 3300025911 Bacteria 9098
490 Ga0207654_10024898 3300025911 Unclassified 3222
491 Ga0207654_10029661 3300025911 Bacteria 2997
492 Ga0207654_10103418 3300025911 Bacteria 1759
493 Ga0207654_10257471 3300025911 Bacteria 1172
494 Ga0207654_10554752 3300025911 Bacteria 816
495 Ga0207654_10644594 3300025911 Unclassified 758
496 Ga0207707_10001511 3300025912 Bacteria 21479
497 Ga0207707_10082370 3300025912 Bacteria 2809
498 Ga0207707_10094671 3300025912 Bacteria 2610
499 Ga0207707_10124742 3300025912 Bacteria 2252
500 Ga0207707_10148442 3300025912 Bacteria 2050
501 Ga0207707_10179975 3300025912 Unclassified 1846
502 Ga0207707_10264087 3300025912 Bacteria 1493
503 Ga0207707_10302070 3300025912 Bacteria 1384
504 Ga0207707_10443607 3300025912 Bacteria 1111
505 Ga0207695_10002528 3300025913 Bacteria 26861
506 Ga0207695_10014793 3300025913 Bacteria 9217
507 Ga0207695_10016736 3300025913 Bacteria 8564
508 Ga0207695_10043302 3300025913 Unclassified 4799
509 Ga0207695_10050274 3300025913 Unclassified 4387
510 Ga0207695_10064070 3300025913 Bacteria 3787
511 Ga0207695_10143336 3300025913 Unclassified 2335
512 Ga0207695_10144910 3300025913 Bacteria 2320
513 Ga0207695_10151597 3300025913 Bacteria 2257
514 Ga0207695_10155416 3300025913 Bacteria 2222
515 Ga0207695_10361298 3300025913 Bacteria 1338
516 Ga0207695_10814155 3300025913 Bacteria 814
517 Ga0207671_10013307 3300025914 Bacteria 6561
518 Ga0207671_10058791 3300025914 Bacteria 2851
519 Ga0207671_10066491 3300025914 Bacteria 2683
520 Ga0207671_10100774 3300025914 Bacteria 2187
521 Ga0207671_10139886 3300025914 Bacteria 1864
522 Ga0207671_10169708 3300025914 Unclassified 1694
523 Ga0207671_10183559 3300025914 Bacteria 1629
524 Ga0207671_10208334 3300025914 Bacteria 1529
525 Ga0207671_10326786 3300025914 Bacteria 1214
526 Ga0207693_10198393 3300025915 Unclassified 1578
527 Ga0207663_10184463 3300025916 Bacteria 1493
528 Ga0207663_10208080 3300025916 Bacteria 1416
529 Ga0207663_10788178 3300025916 Bacteria 756
530 Ga0207663_11265743 3300025916 Unclassified 594
531 Ga0207663_11390141 3300025916 Unclassified 565
532 Ga0207663_11444654 3300025916 Unclassified 554
533 Ga0207663_11543054 3300025916 Bacteria 535
534 Ga0207660_10018676 3300025917 Bacteria 4626
535 Ga0207660_10202807 3300025917 Unclassified 1550
536 Ga0207660_10381622 3300025917 Bacteria 1133
537 Ga0207662_11307045 3300025918 Unclassified 515
538 Ga0207657_10003464 3300025919 Bacteria 16835
539 Ga0207657_10050108 3300025919 Bacteria 3635
540 Ga0207657_10774792 3300025919 Unclassified 742
541 Ga0207649_10073612 3300025920 Bacteria 2189
542 Ga0207649_10247349 3300025920 Unclassified 1283
543 Ga0207652_10000983 3300025921 Bacteria 26410
544 Ga0207652_10108601 3300025921 Bacteria 2459
545 Ga0207652_10110809 3300025921 Bacteria 2434
546 Ga0207652_10362213 3300025921 Bacteria 1309
547 Ga0207652_10407308 3300025921 Bacteria 1227
548 Ga0207652_10710656 3300025921 Unclassified 896
549 Ga0207652_11217165 3300025921 Unclassified 655
550 Ga0207681_10153810 3300025923 Bacteria 1727
551 Ga0207681_10714008 3300025923 Bacteria 834
552 Ga0207681_11605889 3300025923 Unclassified 544
553 Ga0207694_10002685 3300025924 Bacteria 14390
554 Ga0207694_10005168 3300025924 Bacteria 10078
555 Ga0207694_10019172 3300025924 Bacteria 5171
556 Ga0207694_10072845 3300025924 Bacteria 2686
557 Ga0207694_10073556 3300025924 Bacteria 2674
558 Ga0207694_10083636 3300025924 Bacteria 2510
559 Ga0207694_10149439 3300025924 Bacteria 1881
560 Ga0207694_10195426 3300025924 Bacteria 1645
561 Ga0207694_10341351 3300025924 Bacteria 1239
562 Ga0207694_10372660 3300025924 Bacteria 1184
563 Ga0207694_10670737 3300025924 Bacteria 874
564 Ga0207694_11063335 3300025924 Unclassified 685
565 Ga0207659_10503371 3300025926 Bacteria 1026
566 Ga0207687_10004646 3300025927 Bacteria 9136
567 Ga0207687_10015748 3300025927 Unclassified 4963
568 Ga0207687_10032503 3300025927 Unclassified 3534
569 Ga0207687_10038980 3300025927 Bacteria 3251
570 Ga0207687_10171213 3300025927 Bacteria 1675
571 Ga0207687_10713625 3300025927 Bacteria 852
572 Ga0207687_11439199 3300025927 Unclassified 592
573 Ga0207687_11451760 3300025927 Bacteria 589
574 Ga0207700_10007324 3300025928 Bacteria 6736
575 Ga0207700_10027830 3300025928 Bacteria 3965
576 Ga0207700_10084363 3300025928 Bacteria 2490
577 Ga0207700_10138906 3300025928 Bacteria 1994
578 Ga0207700_10148670 3300025928 Unclassified 1934
579 Ga0207700_11291435 3300025928 Unclassified 650
580 Ga0207664_10005134 3300025929 Bacteria 8921
581 Ga0207664_10167013 3300025929 Bacteria 1881
582 Ga0207664_10795893 3300025929 Unclassified 850
583 Ga0207644_10008746 3300025931 Bacteria 6628
584 Ga0207644_10044730 3300025931 Unclassified 3147
585 Ga0207644_11856811 3300025931 Unclassified 504
586 Ga0207690_10054855 3300025932 Unclassified 2681
587 Ga0207690_10352735 3300025932 Unclassified 1164
588 Ga0207706_10045045 3300025933 Unclassified 3909
589 Ga0207686_10005864 3300025934 Bacteria 6591
590 Ga0207686_10022513 3300025934 Bacteria 3630
591 Ga0207686_10117536 3300025934 Bacteria 1804
592 Ga0207686_10440736 3300025934 Unclassified 1000
593 Ga0207686_10698986 3300025934 Unclassified 806
594 Ga0207686_11532620 3300025934 Unclassified 550
595 Ga0207709_10017010 3300025935 Bacteria 4053
596 Ga0207709_10053564 3300025935 Bacteria 2483
597 Ga0207709_10312969 3300025935 Unclassified 1172
598 Ga0207709_10476490 3300025935 Bacteria 970
599 Ga0207709_10498048 3300025935 Bacteria 950
600 Ga0207709_10735208 3300025935 Bacteria 792
601 Ga0207709_11466558 3300025935 Unclassified 566
602 Ga0207670_10079246 3300025936 Bacteria 2293
603 Ga0207670_10318720 3300025936 Unclassified 1223
604 Ga0207670_10481885 3300025936 Unclassified 1005
605 Ga0207670_11563298 3300025936 Archaea 561
606 Ga0207704_10028450 3300025938 Bacteria 3101
607 Ga0207704_10109305 3300025938 Bacteria 1864
608 Ga0207691_10766845 3300025940 Bacteria 812
609 Ga0207691_10847278 3300025940 Unclassified 767
610 Ga0207691_10989517 3300025940 Bacteria 702
611 Ga0207711_10002782 3300025941 Bacteria 15386
612 Ga0207711_10038016 3300025941 Unclassified 4092
613 Ga0207711_10123006 3300025941 Bacteria 2318
614 Ga0207711_10226705 3300025941 Bacteria 1711
615 Ga0207711_10322054 3300025941 Bacteria 1429
616 Ga0207711_10332991 3300025941 Unclassified 1404
617 Ga0207711_10716513 3300025941 Bacteria 933
618 Ga0207711_10796029 3300025941 Bacteria 880
619 Ga0207689_10023190 3300025942 Bacteria 5210
620 Ga0207689_10062184 3300025942 Bacteria 3070
621 Ga0207689_10140566 3300025942 Unclassified 1989
622 Ga0207689_11082131 3300025942 Unclassified 676
623 Ga0207661_10000055 3300025944 Bacteria 86544
624 Ga0207661_10002740 3300025944 Bacteria 12132
625 Ga0207661_10004091 3300025944 Bacteria 10192
626 Ga0207661_10036594 3300025944 Bacteria 3833
627 Ga0207661_10094248 3300025944 Unclassified 2500
628 Ga0207661_10377628 3300025944 Unclassified 1282
629 Ga0207661_10971156 3300025944 Unclassified 782
630 Ga0207679_10030945 3300025945 Bacteria 3742
631 Ga0207679_10081631 3300025945 Bacteria 2473
632 Ga0207667_10006134 3300025949 Bacteria 14605
633 Ga0207667_10017139 3300025949 Bacteria 8166
634 Ga0207667_10021796 3300025949 Bacteria 7092
635 Ga0207667_10029192 3300025949 Bacteria 5982
636 Ga0207667_10036620 3300025949 Bacteria 5256
637 Ga0207667_10056911 3300025949 Bacteria 4105
638 Ga0207667_10084552 3300025949 Bacteria 3285
639 Ga0207667_10108938 3300025949 Unclassified 2857
640 Ga0207667_10147698 3300025949 Unclassified 2420
641 Ga0207667_10151066 3300025949 Bacteria 2391
642 Ga0207667_10243357 3300025949 Bacteria 1841
643 Ga0207667_10923555 3300025949 Unclassified 864
644 Ga0207667_11068127 3300025949 Unclassified 792
645 Ga0207667_11121936 3300025949 Unclassified 769
646 Ga0207651_10621462 3300025960 Bacteria 946
647 Ga0207651_11590169 3300025960 Unclassified 589
648 Ga0207712_10024559 3300025961 Bacteria 3994
649 Ga0207712_10855375 3300025961 Bacteria 802
650 Ga0207668_10894344 3300025972 Bacteria 790
651 Ga0207640_10231556 3300025981 Bacteria 1422
652 Ga0207640_10484641 3300025981 Unclassified 1026
653 Ga0207640_11050723 3300025981 Bacteria 718
654 Ga0207640_11324456 3300025981 Unclassified 643
655 Ga0207658_10025037 3300025986 Unclassified 4177
656 Ga0207658_10605257 3300025986 Unclassified 985
657 Ga0207658_10752892 3300025986 Bacteria 882
658 Ga0207658_11021505 3300025986 Unclassified 754
659 Ga0207677_10018256 3300026023 Bacteria 4206
660 Ga0207677_10268547 3300026023 Bacteria 1394
661 Ga0207677_10432169 3300026023 Bacteria 1124
662 Ga0207677_10467293 3300026023 Bacteria 1084
663 Ga0207677_11724244 3300026023 Bacteria 581
664 Ga0207703_10021152 3300026035 Bacteria 5092
665 Ga0207703_10023856 3300026035 Bacteria 4810
666 Ga0207703_10074746 3300026035 Unclassified 2806
667 Ga0207703_10279538 3300026035 Bacteria 1515
668 Ga0207703_10351358 3300026035 Unclassified 1357
669 Ga0207703_11624350 3300026035 Unclassified 622
670 Ga0207639_10061766 3300026041 Bacteria 2895
671 Ga0207639_10065842 3300026041 Unclassified 2814
672 Ga0207639_10233690 3300026041 Bacteria 1595
673 Ga0207639_10303531 3300026041 Bacteria 1412
674 Ga0207639_11590777 3300026041 Unclassified 613
675 Ga0207678_10040724 3300026067 Bacteria 4027
676 Ga0207678_10180473 3300026067 Bacteria 1803
677 Ga0207708_11233737 3300026075 Bacteria 654
678 Ga0207702_10014293 3300026078 Bacteria 6591
679 Ga0207702_10024228 3300026078 Bacteria 5035
680 Ga0207702_10028834 3300026078 Bacteria 4616
681 Ga0207702_10114664 3300026078 Bacteria 2402
682 Ga0207702_10151013 3300026078 Bacteria 2113
683 Ga0207702_10159140 3300026078 Bacteria 2061
684 Ga0207702_11105201 3300026078 Unclassified 787
685 Ga0207702_11537413 3300026078 Bacteria 659
686 Ga0207702_11599206 3300026078 Unclassified 645
687 Ga0207641_10046718 3300026088 Unclassified 3650
688 Ga0207641_10566758 3300026088 Bacteria 1109
689 Ga0207641_11185271 3300026088 Unclassified 763
690 Ga0207641_11563325 3300026088 Unclassified 661
691 Ga0207641_11739057 3300026088 Bacteria 625
692 Ga0207648_10023517 3300026089 Bacteria 5518
693 Ga0207648_10035880 3300026089 Unclassified 4369
694 Ga0207648_10081606 3300026089 Bacteria 2821
695 Ga0207648_10950384 3300026089 Bacteria 804
696 Ga0207676_10098448 3300026095 Bacteria 2418
697 Ga0207676_10159296 3300026095 Unclassified 1953
698 Ga0207676_10296344 3300026095 Unclassified 1475
699 Ga0207676_11360607 3300026095 Bacteria 705
700 Ga0207676_11847345 3300026095 Bacteria 603
701 Ga0207674_10000085 3300026116 Bacteria 101076
702 Ga0207674_10000823 3300026116 Bacteria 40325
703 Ga0207674_10002265 3300026116 Bacteria 24383
704 Ga0207674_10017334 3300026116 Bacteria 7859
705 Ga0207674_10028755 3300026116 Bacteria 5863
706 Ga0207674_10692529 3300026116 Unclassified 984
707 Ga0207674_10813509 3300026116 Bacteria 901
708 Ga0207675_101062531 3300026118 Bacteria 829
709 Ga0207675_102616727 3300026118 Unclassified 514
710 Ga0207683_10201595 3300026121 Bacteria 1809
711 Ga0207683_10912273 3300026121 Unclassified 816
712 Ga0207698_10008916 3300026142 Bacteria 6360
713 Ga0207698_10014959 3300026142 Bacteria 5179
714 Ga0207698_10057037 3300026142 Bacteria 3019
715 Ga0207698_10061943 3300026142 Bacteria 2919
716 Ga0207698_10128525 3300026142 Unclassified 2161
717 Ga0207698_10743267 3300026142 Bacteria 979
718 Ga0207698_10900964 3300026142 Bacteria 892
719 Ga0207698_11042800 3300026142 Unclassified 829
720 Ga0268266_10322329 3300028379 Bacteria 1446
721 Ga0268266_10588028 3300028379 Unclassified 1069
722 Ga0268266_11442092 3300028379 Unclassified 664
723 Ga0268264_10403333 3300028381 Bacteria 1314
724 Ga0265338_10125255 3300028800 Unclassified 2040
725 Ga0265338_10271020 3300028800 Bacteria 1244
726 Ga0265338_10433275 3300028800 Unclassified 933
727 Ga0265332_10094999 3300031238 Unclassified 1259
728 Ga0265325_10445676 3300031241 Unclassified 564
729 Ga0265340_10037237 3300031247 Bacteria 2410
730 Ga0265316_10954647 3300031344 Unclassified 598
731 Ga0265313_10001123 3300031595 Bacteria 25577
732 Ga0265314_10010658 3300031711 Bacteria 7649
733 Ga0265314_10717267 3300031711 Unclassified 504
734 Ga0265342_10290768 3300031712 Unclassified 863
735 Ga0265342_10316259 3300031712 Unclassified 819
736 Ga0307510_10019662 3300033180 Bacteria 7912
737 Ga0373926_0104695 3300035083 Unclassified 1060
738 Ga0373934_0001519 3300035086 Bacteria 8512
739 Ga0373934_0046314 3300035086 Bacteria 1720
740 Ga0373934_0151424 3300035086 Unclassified 950
741 Ga0373940_0232819 3300035088 Bacteria 616
742 Ga0373944_0296790 3300035089 Bacteria 606
743 Ga0373923_0065100 3300035111 Bacteria 1555
744 Ga0373936_0017924 3300035113 Bacteria 2731
745 Ga0373936_0041205 3300035113 Bacteria 1852
746 Ga0373936_0075212 3300035113 Bacteria 1398
747 Ga0373936_0623547 3300035113 Unclassified 507
748 Ga0373945_0170327 3300035116 Unclassified 892
749 Ga0373953_0053170 3300035117 Bacteria 1641
750 Ga0373953_0065731 3300035117 Unclassified 1489
751 Ga0373953_0265421 3300035117 Unclassified 747
752 Ga0373954_0008113 3300035118 Bacteria 4601
753 Ga0373954_0011247 3300035118 Bacteria 3962
754 Ga0373954_0029120 3300035118 Bacteria 2542
755 Ga0373954_0137519 3300035118 Unclassified 1191
756 Ga0373954_0349709 3300035118 Unclassified 730
757 Ga0373954_0407536 3300035118 Bacteria 672
758 Ga0373956_0063359 3300035119 Bacteria 1677
759 Ga0373956_0099793 3300035119 Bacteria 1346
760 Ga0373956_0173784 3300035119 Bacteria 1017
761 Ga0373956_0255998 3300035119 Bacteria 832
762 Ga0373957_0087349 3300035120 Bacteria 1236
763 Ga0373957_0253023 3300035120 Unclassified 741
764 Ga0373943_0045750 3300035170 Bacteria 2134
765 Ga0373943_0234110 3300035170 Bacteria 1027
766 Ga0373943_0520727 3300035170 Unclassified 696
767 Ga0373943_0642672 3300035170 Archaea 627
768 Ga0373943_0948597 3300035170 Unclassified 515
769 Ga0373946_0570464 3300035171 Unclassified 585
770 Ga0373955_0014927 3300035172 Bacteria 3792
771 Ga0373955_0027920 3300035172 Bacteria 2922
772 Ga0373955_0419396 3300035172 Bacteria 814
773 Ga0373955_0520502 3300035172 Bacteria 727
774 Ga0373955_0848833 3300035172 Unclassified 562
775 Ga0373924_0066045 3300035410 Bacteria 1520
776 Ga0373931_1030058 3300035691 Unclassified 558
777 Ga0373935_0005931 3300035692 Bacteria 7242
778 Ga0373935_0085104 3300035692 Bacteria 2061
779 Ga0373935_0286698 3300035692 Bacteria 1160
780 Ga0373935_0488477 3300035692 Bacteria 893
781 Ga0373927_0002869 3300035695 Bacteria 12548
782 Ga0373927_0110629 3300035695 Bacteria 1790
783 Ga0373927_0133532 3300035695 Bacteria 1622
784 Ga0373927_0190741 3300035695 Unclassified 1345
785 Ga0373927_0401938 3300035695 Bacteria 904
786 Ga0373933_0097460 3300035724 Bacteria 1821
787 Ga0373933_0219684 3300035724 Bacteria 1219
788 Ga0373933_0386010 3300035724 Bacteria 912
789 Ga0373933_0820898 3300035724 Bacteria 612
790 Ga0373933_0864756 3300035724 Unclassified 595
791 Ga0373947_0005144 3300035725 Bacteria 7661
792 Ga0373947_0097692 3300035725 Bacteria 1841
793 Ga0373947_0961541 3300035725 Unclassified 583
794 Ga0373947_0988185 3300035725 Archaea 574
795 Ga0373937_0003452 3300036401 Bacteria 13274
796 Ga0373937_0007081 3300036401 Bacteria 9687
797 Ga0373937_0083043 3300036401 Bacteria 2964
798 Ga0373937_0091494 3300036401 Bacteria 2819
799 Ga0373937_0137588 3300036401 Bacteria 2284
800 Ga0373937_0227707 3300036401 Bacteria 1755
801 Ga0373937_0263554 3300036401 Bacteria 1625
802 Ga0373937_0559774 3300036401 Bacteria 1086
803 Ga0373937_0725387 3300036401 Bacteria 941
804 Ga0373937_0867289 3300036401 Unclassified 851
805 Ga0373937_1374531 3300036401 Bacteria 654
806 Ga0373925_0008278 3300037068 Bacteria 7568
807 Ga0373925_0258163 3300037068 Bacteria 1399
808 Ga0373925_0405939 3300037068 Bacteria 1112
809 Ga0373925_0506571 3300037068 Unclassified 991
810 Ga0373925_1307825 3300037068 Unclassified 595
811 Ga0395900_0036412 3300037418 Bacteria 5074
812 Ga0395900_0446244 3300037418 Bacteria 1251
813 Ga0395898_0588926 3300037466 Bacteria 1055
814 Ga0395898_0753667 3300037466 Bacteria 915
815 Ga0395905_0473414 3300037471 Bacteria 1152
816 Ga0436364_0310100 3300037853 Bacteria 2577
817 Ga0436364_0413027 3300037853 Unclassified 824
818 Ga0436364_1401413 3300037853 Bacteria 759
819 Ga0395901_0978418 3300038443 Bacteria 823
820 Ga0436365_0660380 3300039437 Bacteria 565
821 Ga0436362_1079586 3300039453 Bacteria 537
822 Ga0439448_0053415 3300042005 Unclassified 1326
823 Ga0451577_0356577 3300042876 Bacteria 1327
824 Ga0451577_0448452 3300042876 Unclassified 1172
825 Ga0451577_0504041 3300042876 Bacteria 1099
826 Ga0451577_0899110 3300042876 Bacteria 797
827 Ga0451577_1062343 3300042876 Bacteria 726
828 Ga0451577_1073866 3300042876 Bacteria 721
829 Ga0453683_0931478 3300044673 Unclassified 575
830 Ga0451576_0153840 3300045051 Bacteria 2399
831 Ga0451576_0461342 3300045051 Bacteria 1334
832 Ga0451576_0493739 3300045051 Bacteria 1286
833 Ga0451576_0708320 3300045051 Bacteria 1058
834 Ga0451576_2488695 3300045051 Bacteria 529
835 Ga0495592_0108247 3300046454 Bacteria 1970
836 Ga0495651_0666620 3300046462 Unclassified 651
837 Ga0495580_0001305 3300046472 Bacteria 22019
838 Ga0495580_0071830 3300046472 Unclassified 2418
839 Ga0495580_0297936 3300046472 Bacteria 1098
840 Ga0495580_0431620 3300046472 Bacteria 885
841 Ga0495580_0750249 3300046472 Unclassified 636
842 Ga0495582_0016592 3300046473 Bacteria 4032
843 Ga0495582_0598759 3300046473 Bacteria 638
844 Ga0495639_0038222 3300046475 Bacteria 2155
845 Ga0495664_0153463 3300046477 Bacteria 1397
846 Ga0495664_0249314 3300046477 Bacteria 1074
847 Ga0495664_0292577 3300046477 Bacteria 984
848 Ga0495594_0157174 3300046499 Bacteria 1292
849 Ga0495594_0448876 3300046499 Bacteria 733
850 Ga0495608_0487468 3300046511 Bacteria 747
851 Ga0495628_1118916 3300046516 Unclassified 537
852 Ga0495630_0455903 3300046517 Bacteria 980
853 Ga0495666_0094782 3300046526 Bacteria 1408
854 Ga0495666_0125338 3300046526 Unclassified 1201
855 Ga0495652_0196665 3300046529 Bacteria 1534
856 Ga0495652_0292768 3300046529 Unclassified 1187
857 Ga0495652_0416694 3300046529 Archaea 947
858 Ga0495652_0794918 3300046529 Unclassified 630
859 Ga0495665_0012672 3300046531 Bacteria 4564
860 Ga0495665_0051842 3300046531 Bacteria 2173
861 Ga0495665_0119415 3300046531 Bacteria 1381
862 Ga0495665_0281190 3300046531 Bacteria 854
863 Ga0495586_0070417 3300046535 Bacteria 1910
864 Ga0495586_0812777 3300046535 Unclassified 539
865 Ga0495587_0000764 3300046536 Bacteria 21422
866 Ga0495645_0590756 3300046543 Unclassified 684
867 Ga0495645_0710319 3300046543 Bacteria 609
868 Ga0495645_0714980 3300046543 Unclassified 607
869 Ga0495667_0242472 3300046559 Bacteria 1148
870 Ga0495667_0272823 3300046559 Unclassified 1074
871 Ga0495635_0129595 3300046663 Bacteria 1720
872 Ga0495635_0422612 3300046663 Bacteria 883
873 Ga0495635_0459842 3300046663 Archaea 841
874 Ga0495635_0560902 3300046663 Unclassified 748
875 Ga0495599_0296564 3300046678 Archaea 977
876 Ga0495599_0430791 3300046678 Bacteria 783
877 Ga0495623_0376090 3300046679 Unclassified 769
878 Ga0495658_0040510 3300046683 Bacteria 2590
879 Ga0495658_0050566 3300046683 Bacteria 2352
880 Ga0495613_0793617 3300046689 Bacteria 618
881 Ga0495600_0142625 3300046809 Unclassified 1554
882 Ga0495581_0358057 3300047315 Unclassified 852
883 Ga0495636_0035782 3300047318 Bacteria 2046
884 Ga0495674_0032221 3300047319 Bacteria 4756
885 Ga0495674_0164665 3300047319 Bacteria 1854
886 Ga0495674_0308587 3300047319 Unclassified 1291
887 Ga0495674_0979795 3300047319 Unclassified 649
888 Ga0495674_1350833 3300047319 Bacteria 533
889 Ga0495680_0389932 3300047322 Unclassified 963
890 Ga0495680_0438351 3300047322 Archaea 896
891 Ga0495680_0771755 3300047322 Bacteria 630
892 Ga0495675_0107191 3300047444 Bacteria 1746
893 Ga0495675_0229124 3300047444 Bacteria 1122
894 Ga0495684_0014155 3300047471 Bacteria 6137
895 Ga0495684_0127277 3300047471 Archaea 1916
896 Ga0495684_0202188 3300047471 Bacteria 1464
897 Ga0495684_0280936 3300047471 Bacteria 1201
898 Ga0495684_0290139 3300047471 Bacteria 1178
899 Ga0495684_0656412 3300047471 Bacteria 701
900 Ga0495602_0000355 3300048088 Bacteria 42648
901 Ga0495602_0528351 3300048088 Bacteria 821
902 Ga0495602_0789916 3300048088 Unclassified 638
903 Ga0496101_1478250 3300048904 Unclassified 529
904 Ga0496102_0352634 3300048905 Bacteria 1385
905 Ga0496102_0962131 3300048905 Bacteria 775
906 Ga0496104_0553036 3300048907 Bacteria 1062
907 Ga0496104_1066009 3300048907 Unclassified 712
908 Ga0496104_1268018 3300048907 Unclassified 640
909 Ga0496105_0556075 3300048908 Bacteria 895
910 Ga0496106_0399734 3300048909 Bacteria 1104
911 Ga0496110_0276950 3300048913 Bacteria 1528
912 Ga0496112_1621103 3300048915 Unclassified 560
913 Ga0496115_0298998 3300048918 Bacteria 1319
914 Ga0496115_0364873 3300048918 Unclassified 1176
915 Ga0501037_0151259 3300049573 Bacteria 1659
916 Ga0501038_0764720 3300049574 Unclassified 720
917 Ga0501043_1300640 3300049579 Unclassified 507
918 Ga0501047_0054636 3300049581 Unclassified 3863
919 Ga0501070_0042363 3300049586 Bacteria 3792
920 Ga0501035_0069227 3300049822 Bacteria 3129
921 Ga0501044_0034903 3300049823 Bacteria 5269
922 Ga0501044_0442462 3300049823 Unclassified 1207
923 nmdc:mga05p37_373991_c1 3300050507 Bacteria 1671
924 nmdc:mga06r32_1077259_c1 3300050510 Unclassified 753
925 nmdc:mga0n895_275818_c1 3300050512 Bacteria 1705
926 nmdc:mga0rr50_655170_c1 3300050513 Bacteria 896
927 nmdc:mga08x19_2973_c1 3300050514 Bacteria 10179
928 Ga0495601_0209827 3300053077 Bacteria 1272
929 Ga0495612_0256681 3300053078 Bacteria 778
930 Ga0495595_0463770 3300053084 Bacteria 644
931 Ga0495619_0175567 3300053085 Unclassified 1482
932 Ga0495619_0256470 3300053085 Bacteria 1212
933 Ga0501082_0000151 3300060353 Bacteria 58286
934 Ga0207686_10875536
935 Ga0070658_10013746
936 Ga0070658_10169684
937 Ga0070658_10518154
938 Ga0070683_100000014
939 Ga0070683_100013387
940 Ga0070683_100063160
941 Ga0070683_100597462
942 Ga0070683_101151829
943 Ga0070690_100332214
944 Ga0070690_100459870
945 Ga0070670_100560167
946 Ga0070677_10275502
947 Ga0068869_100134205
948 Ga0068869_100669496
949 Ga0068869_100733719
950 Ga0068869_100926823
951 Ga0068869_101676166
952 Ga0070666_10215784
953 Ga0070666_10414495
954 Ga0070680_100012925
955 Ga0070680_100136492
956 Ga0070680_100544963
957 Ga0070682_101140950
958 Ga0068868_100040065
959 Ga0068868_100334953
960 Ga0068868_100538481
961 Ga0068868_100857179
962 Ga0068868_101337175
963 Ga0068868_101826086
964 Ga0070660_100012404
965 Ga0070660_100015079
966 Ga0070660_100146388
967 Ga0070660_100979997
968 Ga0070660_100992054
969 Ga0070689_100301358
970 Ga0070689_100712878
971 Ga0070661_100192209
972 Ga0070661_100194112
973 Ga0070661_101377743
974 Ga0070692_10111049
975 Ga0070692_10452879
976 Ga0070668_100985391
977 Ga0070669_101022984
978 Ga0070675_100333010
979 Ga0070675_100658216
980 Ga0070671_100064253
981 Ga0070673_100589453
982 Ga0070673_100706139
983 Ga0070688_100982058
984 Ga0070659_100023643
985 Ga0070659_100509779
986 Ga0070667_100279820
987 Ga0070667_100547121
988 Ga0070667_100666401
989 Ga0070667_100820531
990 Ga0070667_101089331
991 Ga0070703_10079443
992 Ga0070709_10259953
993 Ga0070709_10272952
994 Ga0070709_10377165
995 Ga0070709_11661435
996 Ga0070714_100001627
997 Ga0070714_100060059
998 Ga0070714_100611602
999 Ga0070713_100006450
1000 Ga0070713_100045240
1001 Ga0070713_100095623
1002 Ga0070713_100151526
1003 Ga0070713_100655728
1004 Ga0070713_101305934
1005 Ga0070713_101316820
1006 Ga0070713_101707203
1007 Ga0070713_101730703
1008 Ga0070710_10234072
1009 Ga0070710_10360278
1010 Ga0070701_10610616
1011 Ga0070711_100125904
1012 Ga0070711_100216503
1013 Ga0070711_100224825
1014 Ga0070711_100267744
1015 Ga0070711_100494753
1016 Ga0070711_101025342
1017 Ga0070711_102036924
1018 Ga0070700_101029170
1019 Ga0070694_100550700
1020 Ga0070694_101396612
1021 Ga0070663_100034849
1022 Ga0070663_100520890
1023 Ga0070663_101561169
1024 Ga0070678_100304218
1025 Ga0070662_100071033
1026 Ga0070662_101011681
1027 Ga0070681_10003876
1028 Ga0070681_10109146
1029 Ga0070681_10122152
1030 Ga0070681_10128307
1031 Ga0070681_10175144
1032 Ga0070681_10440425
1033 Ga0070681_10445815
1034 Ga0070681_11329617
1035 Ga0070681_11851029
1036 Ga0068867_100047067
1037 Ga0068867_100076038
1038 Ga0070706_100270815
1039 Ga0070698_101766646
1040 Ga0070679_100000672
1041 Ga0070679_100134246
1042 Ga0070679_100217552
1043 Ga0070679_100336428
1044 Ga0070679_100451018
1045 Ga0070679_100471249
1046 Ga0070679_101895252
1047 Ga0070679_102012335
1048 Ga0070679_102076142
1049 Ga0070684_100000004
1050 Ga0070684_100002053
1051 Ga0070684_100032924
1052 Ga0070684_100161089
1053 Ga0070684_101220716
1054 Ga0070684_101899337
1055 Ga0070697_100701481
1056 Ga0070697_101348001
1057 Ga0068853_100052122
1058 Ga0068853_100069398
1059 Ga0068853_100226141
1060 Ga0068853_100319631
1061 Ga0068853_100324356
1062 Ga0070672_100793579
1063 Ga0070672_101614835
1064 Ga0070686_100161288
1065 Ga0070695_100480919
1066 Ga0070695_100747717
1067 Ga0070695_101185953
1068 Ga0070695_101658132
1069 Ga0070696_100001668
1070 Ga0070693_100021041
1071 Ga0070693_100287802
1072 Ga0070693_100678173
1073 Ga0070693_101335872
1074 Ga0070665_100066694
1075 Ga0070665_100971276
1076 Ga0070665_101400474
1077 Ga0070665_101820767
1078 Ga0070704_100153184
1079 Ga0070704_100614351
1080 Ga0068855_100000743
1081 Ga0068855_100007504
1082 Ga0068855_100008839
1083 Ga0068855_100010547
1084 Ga0068855_100013771
1085 Ga0068855_100017351
1086 Ga0068855_100050508
1087 Ga0068855_100133837
1088 Ga0068855_100189049
1089 Ga0068855_100221012
1090 Ga0068855_100496264
1091 Ga0068855_101476967
1092 Ga0070664_100032705
1093 Ga0070664_100260087
1094 Ga0070664_100716055
1095 Ga0068857_100003455
1096 Ga0068857_100012474
1097 Ga0068857_100018394
1098 Ga0068857_100070481
1099 Ga0068857_101774171
1100 Ga0068857_102198384
1101 Ga0068854_100313272
1102 Ga0068854_100383682
1103 Ga0068854_100413126
1104 Ga0068856_100000435
1105 Ga0068856_100003656
1106 Ga0068856_100005743
1107 Ga0068856_100150378
1108 Ga0068856_100213383
1109 Ga0068856_100335234
1110 Ga0068856_101650104
1111 Ga0068852_100004004
1112 Ga0068852_100009031
1113 Ga0068852_100019346
1114 Ga0068852_100063441
1115 Ga0068852_100289389
1116 Ga0068852_100435832
1117 Ga0068852_100593882
1118 Ga0068852_101189863
1119 Ga0068852_101622047
1120 Ga0068859_100061999
1121 Ga0068859_100142353
1122 Ga0068859_100238826
1123 Ga0068859_100484798
1124 Ga0068859_102075141
1125 Ga0068864_100015131
1126 Ga0068864_100366788
1127 Ga0068864_100417920
1128 Ga0068864_100835903
1129 Ga0068866_10264470
1130 Ga0068861_100491415
1131 Ga0068851_10063170
1132 Ga0068851_10253901
1133 Ga0068851_10481207
1134 Ga0068863_100057677
1135 Ga0068863_100368259
1136 Ga0068863_100410188
1137 Ga0068863_100515644
1138 Ga0068858_100009648
1139 Ga0068858_100026586
1140 Ga0068858_100039451
1141 Ga0068858_100433216
1142 Ga0068858_100854866
1143 Ga0068860_100008567
1144 Ga0068860_100027240
1145 Ga0068860_101792516
1146 Ga0068860_101866752
1147 Ga0070717_10014186
1148 Ga0070717_10021313
1149 Ga0070717_10946923
1150 Ga0070715_10105354
1151 Ga0070712_100340008
1152 Ga0097621_100053240
1153 Ga0097621_100055287
1154 Ga0097621_100056467
1155 Ga0097621_100077082
1156 Ga0097621_100080057
1157 Ga0097621_100091483
1158 Ga0097621_100264932
1159 Ga0097621_100510808
1160 Ga0097621_100652236
1161 Ga0097621_101030069
1162 Ga0068871_100068595
1163 Ga0068871_100079800
1164 Ga0068871_100080324
1165 Ga0068871_100089038
1166 Ga0068871_100116910
1167 Ga0068871_100120264
1168 Ga0068871_100215228
1169 Ga0068871_100318600
1170 Ga0068871_100941440
1171 Ga0068871_101495958
1172 Ga0068871_101551958
1173 Ga0075433_11725045
1174 Ga0075434_100406794
1175 Ga0068865_100006046
1176 Ga0068865_101246398
1177 Ga0075436_100024722
1178 Ga0075436_100606390
1179 Ga0097620_100062000
1180 Ga0097620_100142355
1181 Ga0097620_100238829
1182 Ga0097620_100484789
1183 Ga0097620_102075127
1184 Ga0075435_101228331
1185 Ga0105240_10002045
1186 Ga0105240_10004457
1187 Ga0105240_10009269
1188 Ga0105240_10113264
1189 Ga0105240_10147077
1190 Ga0105240_10158950
1191 Ga0105240_10203841
1192 Ga0105240_10216793
1193 Ga0105240_10262022
1194 Ga0105240_10294504
1195 Ga0105240_10414782
1196 Ga0105240_10450459
1197 Ga0105240_11601207
1198 Ga0105245_10000473
1199 Ga0105245_10011946
1200 Ga0105245_10027132
1201 Ga0105245_10065967
1202 Ga0105245_10086231
1203 Ga0105245_10115022
1204 Ga0105245_10125723
1205 Ga0105245_10166006
1206 Ga0105245_10191889
1207 Ga0105245_10361040
1208 Ga0105245_11871093
1209 Ga0105245_12112836
1210 Ga0105245_13077058
1211 Ga0105247_10022691
1212 Ga0105247_10132345
1213 Ga0105247_10347403
1214 Ga0105247_10787826
1215 Ga0105247_11042471
1216 Ga0114129_10086606
1217 Ga0105243_10003924
1218 Ga0105243_10042868
1219 Ga0105243_10112364
1220 Ga0105243_10133516
1221 Ga0105243_10457419
1222 Ga0105243_10784512
1223 Ga0105243_10821261
1224 Ga0105243_10864528
1225 Ga0105241_10001262
1226 Ga0105241_10055702
1227 Ga0105241_10112825
1228 Ga0105241_10153333
1229 Ga0105241_10215599
1230 Ga0105241_11260318
1231 Ga0105241_12283251
1232 Ga0105242_10010341
1233 Ga0105242_10040739
1234 Ga0105242_10142029
1235 Ga0105242_10387450
1236 Ga0105242_10397465
1237 Ga0105242_10628902
1238 Ga0105242_10647843
1239 Ga0105242_11510222
1240 Ga0105242_11585411
1241 Ga0105242_12281277
1242 Ga0105242_12284067
1243 Ga0105242_13160956
1244 Ga0105248_10060966
1245 Ga0105248_10093654
1246 Ga0105248_10193567
1247 Ga0105248_10299609
1248 Ga0105248_10311810
1249 Ga0105248_10443809
1250 Ga0105248_10781264
1251 Ga0105248_11833224
1252 Ga0105248_12319062
1253 Ga0105248_12471922
1254 Ga0105237_10019590
1255 Ga0105237_10022025
1256 Ga0105237_10045921
1257 Ga0105237_10049444
1258 Ga0105237_10081573
1259 Ga0105237_10138840
1260 Ga0105237_10255558
1261 Ga0105237_10301962
1262 Ga0105237_10375385
1263 Ga0105237_10903901
1264 Ga0105237_11007045
1265 Ga0105237_11228418
1266 Ga0105237_11830863
1267 Ga0105237_11880130
1268 Ga0105238_10004238
1269 Ga0105238_10008726
1270 Ga0105238_10037209
1271 Ga0105238_10061383
1272 Ga0105238_10061723
1273 Ga0105238_10086694
1274 Ga0105238_10091689
1275 Ga0105238_10159543
1276 Ga0105238_10194597
1277 Ga0105238_10198447
1278 Ga0105238_10459014
1279 Ga0105238_11786722
1280 Ga0105238_11909810
1281 Ga0105238_12195368
1282 Ga0105249_10005911
1283 Ga0105249_10625523
1284 Ga0105239_10005444
1285 Ga0105239_10007139
1286 Ga0105239_10014670
1287 Ga0105239_10015885
1288 Ga0105239_10037677
1289 Ga0105239_10064209
1290 Ga0105239_10251335
1291 Ga0105239_10352663
1292 Ga0105239_10396508
1293 Ga0105239_10603818
1294 Ga0105239_11085708
1295 Ga0105239_13101157
1296 Ga0105246_10009575
1297 Ga0105246_10028368
1298 Ga0105246_10219805
1299 Ga0105246_10297659
1300 Ga0105246_12558123
1301 Ga0157370_10003623
1302 Ga0157370_10003855
1303 Ga0157370_10031553
1304 Ga0157370_10045469
1305 Ga0157370_10080310
1306 Ga0157370_10151895
1307 Ga0157370_10153438
1308 Ga0157369_10002505
1309 Ga0157369_10004511
1310 Ga0157369_10011678
1311 Ga0157369_10051355
1312 Ga0157369_10185201
1313 Ga0157369_10206126
1314 Ga0157369_10408276
1315 Ga0157369_10553178
1316 Ga0157369_10625956
1317 Ga0157369_11024465
1318 Ga0157369_11829796
1319 Ga0157369_12068855
1320 Ga0157374_10014270
1321 Ga0157374_10056589
1322 Ga0157374_10450090
1323 Ga0157374_10514339
1324 Ga0157374_10550737
1325 Ga0157374_10559057
1326 Ga0157374_10712432
1327 Ga0157374_10804924
1328 Ga0157374_10810098
1329 Ga0157374_10832716
1330 Ga0157374_11975479
1331 Ga0157374_12159510
1332 Ga0157378_10001093
1333 Ga0157378_10241069
1334 Ga0157378_10290511
1335 Ga0157378_10371912
1336 Ga0157378_10393930
1337 Ga0157378_10483477
1338 Ga0157378_10691014
1339 Ga0157378_10855013
1340 Ga0157378_10997818
1341 Ga0157378_11030667
1342 Ga0157378_11053761
1343 Ga0163162_10008263
1344 Ga0163162_10383608
1345 Ga0163162_10496623
1346 Ga0163162_11526492
1347 Ga0163162_12090925
1348 Ga0163162_12540278
1349 Ga0163162_12770312
1350 Ga0157372_10029710
1351 Ga0157372_10030108
1352 Ga0157372_10106871
1353 Ga0157372_10208587
1354 Ga0157372_10623603
1355 Ga0157372_10644845
1356 Ga0157372_11076531
1357 Ga0157372_11134385
1358 Ga0157372_11401257
1359 Ga0157372_11880433
1360 Ga0157372_11935945
1361 Ga0157375_10003392
1362 Ga0157375_10074026
1363 Ga0157375_10140289
1364 Ga0157375_10215893
1365 Ga0157375_10342439
1366 Ga0157375_10432326
1367 Ga0157375_10820588
1368 Ga0157375_11076288
1369 Ga0157375_11376758
1370 Ga0157375_12822568
1371 Ga0157375_13783914
1372 Ga0163163_10003045
1373 Ga0163163_10109905
1374 Ga0163163_10111840
1375 Ga0163163_10135045
1376 Ga0163163_10197774
1377 Ga0163163_10240569
1378 Ga0163163_10464194
1379 Ga0163163_11602628
1380 Ga0163163_12307833
1381 Ga0163163_12745241
1382 Ga0157379_10077140
1383 Ga0157379_10176471
1384 Ga0157379_10197427
1385 Ga0157379_10199337
1386 Ga0157379_10777423
1387 Ga0157379_10897924
1388 Ga0157379_11197653
1389 Ga0157376_10054248
1390 Ga0157376_10061634
1391 Ga0157376_10069476
1392 Ga0157376_10135915
1393 Ga0157376_10488713
1394 Ga0157376_10573715
1395 Ga0157376_10822586
1396 Ga0157376_11505976
1397 Ga0157376_11867848
1398 Ga0157376_13122756
1399 Ga0163161_11291966
1400 Ga0163161_11645213
1401 Ga0206356_11032977
1402 Ga0206349_1804240
1403 Ga0206350_10234319
1404 Ga0154015_1100450
1405 Ga0224712_10156283
1406 Ga0207656_10044812
1407 Ga0207682_10324360
1408 Ga0207692_10293299
1409 Ga0207692_10706094
1410 Ga0207692_10939265
1411 Ga0207642_10278645
1412 Ga0207642_11070350
1413 Ga0207680_10826561
1414 Ga0207647_10334083
1415 Ga0207685_10223323
1416 Ga0207699_10796653
1417 Ga0207699_10858336
1418 Ga0207645_10196382
1419 Ga0207705_10049187
1420 Ga0207705_10238140
1421 Ga0207705_10354300
1422 Ga0207654_10002640
1423 Ga0207654_10024898
1424 Ga0207654_10029661
1425 Ga0207654_10103418
1426 Ga0207654_10257471
1427 Ga0207654_10554752
1428 Ga0207654_10644594
1429 Ga0207707_10001511
1430 Ga0207707_10082370
1431 Ga0207707_10094671
1432 Ga0207707_10124742
1433 Ga0207707_10148442
1434 Ga0207707_10179975
1435 Ga0207707_10264087
1436 Ga0207707_10302070
1437 Ga0207707_10443607
1438 Ga0207695_10002528
1439 Ga0207695_10014793
1440 Ga0207695_10016736
1441 Ga0207695_10043302
1442 Ga0207695_10050274
1443 Ga0207695_10064070
1444 Ga0207695_10143336
1445 Ga0207695_10144910
1446 Ga0207695_10151597
1447 Ga0207695_10155416
1448 Ga0207695_10361298
1449 Ga0207695_10814155
1450 Ga0207671_10013307
1451 Ga0207671_10058791
1452 Ga0207671_10066491
1453 Ga0207671_10100774
1454 Ga0207671_10139886
1455 Ga0207671_10169708
1456 Ga0207671_10183559
1457 Ga0207671_10208334
1458 Ga0207671_10326786
1459 Ga0207693_10198393
1460 Ga0207663_10184463
1461 Ga0207663_10208080
1462 Ga0207663_10788178
1463 Ga0207663_11265743
1464 Ga0207663_11390141
1465 Ga0207663_11444654
1466 Ga0207663_11543054
1467 Ga0207660_10018676
1468 Ga0207660_10202807
1469 Ga0207660_10381622
1470 Ga0207662_11307045
1471 Ga0207657_10003464
1472 Ga0207657_10050108
1473 Ga0207657_10774792
1474 Ga0207649_10073612
1475 Ga0207649_10247349
1476 Ga0207652_10000983
1477 Ga0207652_10108601
1478 Ga0207652_10110809
1479 Ga0207652_10362213
1480 Ga0207652_10407308
1481 Ga0207652_10710656
1482 Ga0207652_11217165
1483 Ga0207681_10153810
1484 Ga0207681_10714008
1485 Ga0207681_11605889
1486 Ga0207694_10002685
1487 Ga0207694_10005168
1488 Ga0207694_10019172
1489 Ga0207694_10072845
1490 Ga0207694_10073556
1491 Ga0207694_10083636
1492 Ga0207694_10149439
1493 Ga0207694_10195426
1494 Ga0207694_10341351
1495 Ga0207694_10372660
1496 Ga0207694_10670737
1497 Ga0207694_11063335
1498 Ga0207659_10503371
1499 Ga0207687_10004646
1500 Ga0207687_10015748
1501 Ga0207687_10032503
1502 Ga0207687_10038980
1503 Ga0207687_10171213
1504 Ga0207687_10713625
1505 Ga0207687_11439199
1506 Ga0207687_11451760
1507 Ga0207700_10007324
1508 Ga0207700_10027830
1509 Ga0207700_10084363
1510 Ga0207700_10138906
1511 Ga0207700_10148670
1512 Ga0207700_11291435
1513 Ga0207664_10005134
1514 Ga0207664_10167013
1515 Ga0207664_10795893
1516 Ga0207644_10008746
1517 Ga0207644_10044730
1518 Ga0207644_11856811
1519 Ga0207690_10054855
1520 Ga0207690_10352735
1521 Ga0207706_10045045
1522 Ga0207686_10005864
1523 Ga0207686_10022513
1524 Ga0207686_10117536
1525 Ga0207686_10440736
1526 Ga0207686_10698986
1527 Ga0207686_11532620
1528 Ga0207709_10017010
1529 Ga0207709_10053564
1530 Ga0207709_10312969
1531 Ga0207709_10476490
1532 Ga0207709_10498048
1533 Ga0207709_10735208
1534 Ga0207709_11466558
1535 Ga0207670_10079246
1536 Ga0207670_10318720
1537 Ga0207670_10481885
1538 Ga0207670_11563298
1539 Ga0207704_10028450
1540 Ga0207704_10109305
1541 Ga0207691_10766845
1542 Ga0207691_10847278
1543 Ga0207691_10989517
1544 Ga0207711_10002782
1545 Ga0207711_10038016
1546 Ga0207711_10123006
1547 Ga0207711_10226705
1548 Ga0207711_10322054
1549 Ga0207711_10332991
1550 Ga0207711_10716513
1551 Ga0207711_10796029
1552 Ga0207689_10023190
1553 Ga0207689_10062184
1554 Ga0207689_10140566
1555 Ga0207689_11082131
1556 Ga0207661_10000055
1557 Ga0207661_10002740
1558 Ga0207661_10004091
1559 Ga0207661_10036594
1560 Ga0207661_10094248
1561 Ga0207661_10377628
1562 Ga0207661_10971156
1563 Ga0207679_10030945
1564 Ga0207679_10081631
1565 Ga0207667_10006134
1566 Ga0207667_10017139
1567 Ga0207667_10021796
1568 Ga0207667_10029192
1569 Ga0207667_10036620
1570 Ga0207667_10056911
1571 Ga0207667_10084552
1572 Ga0207667_10108938
1573 Ga0207667_10147698
1574 Ga0207667_10151066
1575 Ga0207667_10243357
1576 Ga0207667_10923555
1577 Ga0207667_11068127
1578 Ga0207667_11121936
1579 Ga0207651_10621462
1580 Ga0207651_11590169
1581 Ga0207712_10024559
1582 Ga0207712_10855375
1583 Ga0207668_10894344
1584 Ga0207640_10231556
1585 Ga0207640_10484641
1586 Ga0207640_11050723
1587 Ga0207640_11324456
1588 Ga0207658_10025037
1589 Ga0207658_10605257
1590 Ga0207658_10752892
1591 Ga0207658_11021505
1592 Ga0207677_10018256
1593 Ga0207677_10268547
1594 Ga0207677_10432169
1595 Ga0207677_10467293
1596 Ga0207677_11724244
1597 Ga0207703_10021152
1598 Ga0207703_10023856
1599 Ga0207703_10074746
1600 Ga0207703_10279538
1601 Ga0207703_10351358
1602 Ga0207703_11624350
1603 Ga0207639_10061766
1604 Ga0207639_10065842
1605 Ga0207639_10233690
1606 Ga0207639_10303531
1607 Ga0207639_11590777
1608 Ga0207678_10040724
1609 Ga0207678_10180473
1610 Ga0207708_11233737
1611 Ga0207702_10014293
1612 Ga0207702_10024228
1613 Ga0207702_10028834
1614 Ga0207702_10114664
1615 Ga0207702_10151013
1616 Ga0207702_10159140
1617 Ga0207702_11105201
1618 Ga0207702_11537413
1619 Ga0207702_11599206
1620 Ga0207641_10046718
1621 Ga0207641_10566758
1622 Ga0207641_11185271
1623 Ga0207641_11563325
1624 Ga0207641_11739057
1625 Ga0207648_10023517
1626 Ga0207648_10035880
1627 Ga0207648_10081606
1628 Ga0207648_10950384
1629 Ga0207676_10098448
1630 Ga0207676_10159296
1631 Ga0207676_10296344
1632 Ga0207676_11360607
1633 Ga0207676_11847345
1634 Ga0207674_10000085
1635 Ga0207674_10000823
1636 Ga0207674_10002265
1637 Ga0207674_10017334
1638 Ga0207674_10028755
1639 Ga0207674_10692529
1640 Ga0207674_10813509
1641 Ga0207675_101062531
1642 Ga0207675_102616727
1643 Ga0207683_10201595
1644 Ga0207683_10912273
1645 Ga0207698_10008916
1646 Ga0207698_10014959
1647 Ga0207698_10057037
1648 Ga0207698_10061943
1649 Ga0207698_10128525
1650 Ga0207698_10743267
1651 Ga0207698_10900964
1652 Ga0207698_11042800
1653 Ga0268266_10322329
1654 Ga0268266_10588028
1655 Ga0268266_11442092
1656 Ga0268264_10403333
1657 Ga0265338_10125255
1658 Ga0265338_10271020
1659 Ga0265338_10433275
1660 Ga0265332_10094999
1661 Ga0265325_10445676
1662 Ga0265340_10037237
1663 Ga0265316_10954647
1664 Ga0265313_10001123
1665 Ga0265314_10010658
1666 Ga0265314_10717267
1667 Ga0265342_10290768
1668 Ga0265342_10316259
1669 Ga0307510_10019662
1670 Ga0373926_0104695
1671 Ga0373934_0001519
1672 Ga0373934_0046314
1673 Ga0373934_0151424
1674 Ga0373940_0232819
1675 Ga0373944_0296790
1676 Ga0373923_0065100
1677 Ga0373936_0017924
1678 Ga0373936_0041205
1679 Ga0373936_0075212
1680 Ga0373936_0623547
1681 Ga0373945_0170327
1682 Ga0373953_0053170
1683 Ga0373953_0065731
1684 Ga0373953_0265421
1685 Ga0373954_0008113
1686 Ga0373954_0011247
1687 Ga0373954_0029120
1688 Ga0373954_0137519
1689 Ga0373954_0349709
1690 Ga0373954_0407536
1691 Ga0373956_0063359
1692 Ga0373956_0099793
1693 Ga0373956_0173784
1694 Ga0373956_0255998
1695 Ga0373957_0087349
1696 Ga0373957_0253023
1697 Ga0373943_0045750
1698 Ga0373943_0234110
1699 Ga0373943_0520727
1700 Ga0373943_0642672
1701 Ga0373943_0948597
1702 Ga0373946_0570464
1703 Ga0373955_0014927
1704 Ga0373955_0027920
1705 Ga0373955_0419396
1706 Ga0373955_0520502
1707 Ga0373955_0848833
1708 Ga0373924_0066045
1709 Ga0373931_1030058
1710 Ga0373935_0005931
1711 Ga0373935_0085104
1712 Ga0373935_0286698
1713 Ga0373935_0488477
1714 Ga0373927_0002869
1715 Ga0373927_0110629
1716 Ga0373927_0133532
1717 Ga0373927_0190741
1718 Ga0373927_0401938
1719 Ga0373933_0097460
1720 Ga0373933_0219684
1721 Ga0373933_0386010
1722 Ga0373933_0820898
1723 Ga0373933_0864756
1724 Ga0373947_0005144
1725 Ga0373947_0097692
1726 Ga0373947_0961541
1727 Ga0373947_0988185
1728 Ga0373937_0003452
1729 Ga0373937_0007081
1730 Ga0373937_0083043
1731 Ga0373937_0091494
1732 Ga0373937_0137588
1733 Ga0373937_0227707
1734 Ga0373937_0263554
1735 Ga0373937_0559774
1736 Ga0373937_0725387
1737 Ga0373937_0867289
1738 Ga0373937_1374531
1739 Ga0373925_0008278
1740 Ga0373925_0258163
1741 Ga0373925_0405939
1742 Ga0373925_0506571
1743 Ga0373925_1307825
1744 Ga0395900_0036412
1745 Ga0395900_0446244
1746 Ga0395898_0588926
1747 Ga0395898_0753667
1748 Ga0395905_0473414
1749 Ga0436364_0310100
1750 Ga0436364_0413027
1751 Ga0436364_1401413
1752 Ga0395901_0978418
1753 Ga0436365_0660380
1754 Ga0436362_1079586
1755 Ga0439448_0053415
1756 Ga0451577_0356577
1757 Ga0451577_0448452
1758 Ga0451577_0504041
1759 Ga0451577_0899110
1760 Ga0451577_1062343
1761 Ga0451577_1073866
1762 Ga0453683_0931478
1763 Ga0451576_0153840
1764 Ga0451576_0461342
1765 Ga0451576_0493739
1766 Ga0451576_0708320
1767 Ga0451576_2488695
1768 Ga0495592_0108247
1769 Ga0495651_0666620
1770 Ga0495580_0001305
1771 Ga0495580_0071830
1772 Ga0495580_0297936
1773 Ga0495580_0431620
1774 Ga0495580_0750249
1775 Ga0495582_0016592
1776 Ga0495582_0598759
1777 Ga0495639_0038222
1778 Ga0495664_0153463
1779 Ga0495664_0249314
1780 Ga0495664_0292577
1781 Ga0495594_0157174
1782 Ga0495594_0448876
1783 Ga0495608_0487468
1784 Ga0495628_1118916
1785 Ga0495630_0455903
1786 Ga0495666_0094782
1787 Ga0495666_0125338
1788 Ga0495652_0196665
1789 Ga0495652_0292768
1790 Ga0495652_0416694
1791 Ga0495652_0794918
1792 Ga0495665_0012672
1793 Ga0495665_0051842
1794 Ga0495665_0119415
1795 Ga0495665_0281190
1796 Ga0495586_0070417
1797 Ga0495586_0812777
1798 Ga0495587_0000764
1799 Ga0495645_0590756
1800 Ga0495645_0710319
1801 Ga0495645_0714980
1802 Ga0495667_0242472
1803 Ga0495667_0272823
1804 Ga0495635_0129595
1805 Ga0495635_0422612
1806 Ga0495635_0459842
1807 Ga0495635_0560902
1808 Ga0495599_0296564
1809 Ga0495599_0430791
1810 Ga0495623_0376090
1811 Ga0495658_0040510
1812 Ga0495658_0050566
1813 Ga0495613_0793617
1814 Ga0495600_0142625
1815 Ga0495581_0358057
1816 Ga0495636_0035782
1817 Ga0495674_0032221
1818 Ga0495674_0164665
1819 Ga0495674_0308587
1820 Ga0495674_0979795
1821 Ga0495674_1350833
1822 Ga0495680_0389932
1823 Ga0495680_0438351
1824 Ga0495680_0771755
1825 Ga0495675_0107191
1826 Ga0495675_0229124
1827 Ga0495684_0014155
1828 Ga0495684_0127277
1829 Ga0495684_0202188
1830 Ga0495684_0280936
1831 Ga0495684_0290139
1832 Ga0495684_0656412
1833 Ga0495602_0000355
1834 Ga0495602_0528351
1835 Ga0495602_0789916
1836 Ga0496101_1478250
1837 Ga0496102_0352634
1838 Ga0496102_0962131
1839 Ga0496104_0553036
1840 Ga0496104_1066009
1841 Ga0496104_1268018
1842 Ga0496105_0556075
1843 Ga0496106_0399734
1844 Ga0496110_0276950
1845 Ga0496112_1621103
1846 Ga0496115_0298998
1847 Ga0496115_0364873
1848 Ga0501037_0151259
1849 Ga0501038_0764720
1850 Ga0501043_1300640
1851 Ga0501047_0054636
1852 Ga0501070_0042363
1853 Ga0501035_0069227
1854 Ga0501044_0034903
1855 Ga0501044_0442462
1856 nmdc:mga05p37_373991_c1
1857 nmdc:mga06r32_1077259_c1
1858 nmdc:mga0n895_275818_c1
1859 nmdc:mga0rr50_655170_c1
1860 nmdc:mga08x19_2973_c1
1861 Ga0495601_0209827
1862 Ga0495612_0256681
1863 Ga0495595_0463770
1864 Ga0495619_0175567
1865 Ga0495619_0256470
1866 Ga0501082_0000151

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5msg-assembly1.cif.gz_B influenza b polymerase bound to vrna promoter and capped rna primer 0.6322 7 39
7dbi-assembly1.cif.gz_A crystal structure of the peroxisomal acyl-coa hydrolase mpah 0.5896 5 43
7dbl-assembly2.cif.gz_C acyl-coa hydrolase mpah' mutant s139a in complex with mpa 0.5573 5 47
8fuv-assembly1.cif.gz_F pseudomonas phage e217 extended sheath and tail tube 0.5404 9 47
7dbl-assembly2.cif.gz_D acyl-coa hydrolase mpah' mutant s139a in complex with mpa 0.5395 7 46
ID Description Score Start End Superfamily
af_K7MV31_210_358_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7262 5 39 2.120.10.80
af_P75867_326_566_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.6515 7 35 3.30.230.10
3n2zB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6361 8 38 3.40.50.1820
af_P47912_40_551_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.6357 9 39 3.40.50.12780
6d04A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6076 3 36 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A1F2VEJ9-F1-model_v4 Uncharacterized protein 0.9718 1 90
AF-A0A7W7ZTC8-F1-model_v4 Uncharacterized protein 0.9675 1 90
AF-A0A1F2VEJ9-F1-model_v4 Uncharacterized protein 0.9614 1 90
AF-A0A1Q7K0I8-F1-model_v4 Uncharacterized protein 0.9604 1 90
AF-A0A7W7ZTC8-F1-model_v4 Uncharacterized protein 0.9571 1 90

Map