F486095
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 933 | 260 | 1866 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300025934|Ga0207686_10875536|Ga0207686_108755361 |
| Length | 106 |
| Sequence | MRFQCKRRCAIKGTALMEERAFFRESETTKPATLNCPFCRTADTYDLRWMLRKKLDQVPRGADERDRARFAKFASYMVLLDDKAMCKNMRCRKRFDISGVKTMAFI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 167 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 173 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 174 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 184 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 203 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 204 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.29 |
| Rhizosphere | 98.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 31.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207686_10875536 | 3300025934 | Unclassified | 723 |
| 2 | Ga0070658_10013746 | 3300005327 | Bacteria | 6496 |
| 3 | Ga0070658_10169684 | 3300005327 | Bacteria | 1833 |
| 4 | Ga0070658_10518154 | 3300005327 | Bacteria | 1031 |
| 5 | Ga0070683_100000014 | 3300005329 | Bacteria | 221422 |
| 6 | Ga0070683_100013387 | 3300005329 | Bacteria | 7153 |
| 7 | Ga0070683_100063160 | 3300005329 | Bacteria | 3444 |
| 8 | Ga0070683_100597462 | 3300005329 | Bacteria | 1056 |
| 9 | Ga0070683_101151829 | 3300005329 | Unclassified | 745 |
| 10 | Ga0070690_100332214 | 3300005330 | Unclassified | 1098 |
| 11 | Ga0070690_100459870 | 3300005330 | Unclassified | 945 |
| 12 | Ga0070670_100560167 | 3300005331 | Bacteria | 1020 |
| 13 | Ga0070677_10275502 | 3300005333 | Unclassified | 845 |
| 14 | Ga0068869_100134205 | 3300005334 | Bacteria | 1905 |
| 15 | Ga0068869_100669496 | 3300005334 | Bacteria | 883 |
| 16 | Ga0068869_100733719 | 3300005334 | Bacteria | 845 |
| 17 | Ga0068869_100926823 | 3300005334 | Bacteria | 755 |
| 18 | Ga0068869_101676166 | 3300005334 | Unclassified | 567 |
| 19 | Ga0070666_10215784 | 3300005335 | Unclassified | 1352 |
| 20 | Ga0070666_10414495 | 3300005335 | Unclassified | 969 |
| 21 | Ga0070680_100012925 | 3300005336 | Bacteria | 6493 |
| 22 | Ga0070680_100136492 | 3300005336 | Bacteria | 2055 |
| 23 | Ga0070680_100544963 | 3300005336 | Unclassified | 994 |
| 24 | Ga0070682_101140950 | 3300005337 | Unclassified | 655 |
| 25 | Ga0068868_100040065 | 3300005338 | Bacteria | 3644 |
| 26 | Ga0068868_100334953 | 3300005338 | Bacteria | 1292 |
| 27 | Ga0068868_100538481 | 3300005338 | Unclassified | 1027 |
| 28 | Ga0068868_100857179 | 3300005338 | Unclassified | 823 |
| 29 | Ga0068868_101337175 | 3300005338 | Bacteria | 666 |
| 30 | Ga0068868_101826086 | 3300005338 | Unclassified | 575 |
| 31 | Ga0070660_100012404 | 3300005339 | Bacteria | 6086 |
| 32 | Ga0070660_100015079 | 3300005339 | Bacteria | 5576 |
| 33 | Ga0070660_100146388 | 3300005339 | Unclassified | 1898 |
| 34 | Ga0070660_100979997 | 3300005339 | Unclassified | 714 |
| 35 | Ga0070660_100992054 | 3300005339 | Unclassified | 710 |
| 36 | Ga0070689_100301358 | 3300005340 | Bacteria | 1334 |
| 37 | Ga0070689_100712878 | 3300005340 | Bacteria | 877 |
| 38 | Ga0070661_100192209 | 3300005344 | Bacteria | 1557 |
| 39 | Ga0070661_100194112 | 3300005344 | Unclassified | 1549 |
| 40 | Ga0070661_101377743 | 3300005344 | Unclassified | 593 |
| 41 | Ga0070692_10111049 | 3300005345 | Unclassified | 1516 |
| 42 | Ga0070692_10452879 | 3300005345 | Unclassified | 822 |
| 43 | Ga0070668_100985391 | 3300005347 | Bacteria | 757 |
| 44 | Ga0070669_101022984 | 3300005353 | Unclassified | 709 |
| 45 | Ga0070675_100333010 | 3300005354 | Bacteria | 1343 |
| 46 | Ga0070675_100658216 | 3300005354 | Bacteria | 952 |
| 47 | Ga0070671_100064253 | 3300005355 | Bacteria | 3057 |
| 48 | Ga0070673_100589453 | 3300005364 | Bacteria | 1013 |
| 49 | Ga0070673_100706139 | 3300005364 | Bacteria | 926 |
| 50 | Ga0070688_100982058 | 3300005365 | Bacteria | 670 |
| 51 | Ga0070659_100023643 | 3300005366 | Bacteria | 4705 |
| 52 | Ga0070659_100509779 | 3300005366 | Unclassified | 1026 |
| 53 | Ga0070667_100279820 | 3300005367 | Bacteria | 1498 |
| 54 | Ga0070667_100547121 | 3300005367 | Unclassified | 1064 |
| 55 | Ga0070667_100666401 | 3300005367 | Unclassified | 961 |
| 56 | Ga0070667_100820531 | 3300005367 | Bacteria | 864 |
| 57 | Ga0070667_101089331 | 3300005367 | Unclassified | 747 |
| 58 | Ga0070703_10079443 | 3300005406 | Bacteria | 1114 |
| 59 | Ga0070709_10259953 | 3300005434 | Unclassified | 1254 |
| 60 | Ga0070709_10272952 | 3300005434 | Bacteria | 1226 |
| 61 | Ga0070709_10377165 | 3300005434 | Bacteria | 1053 |
| 62 | Ga0070709_11661435 | 3300005434 | Bacteria | 521 |
| 63 | Ga0070714_100001627 | 3300005435 | Bacteria | 16344 |
| 64 | Ga0070714_100060059 | 3300005435 | Bacteria | 3262 |
| 65 | Ga0070714_100611602 | 3300005435 | Unclassified | 1047 |
| 66 | Ga0070713_100006450 | 3300005436 | Bacteria | 8135 |
| 67 | Ga0070713_100045240 | 3300005436 | Unclassified | 3606 |
| 68 | Ga0070713_100095623 | 3300005436 | Bacteria | 2563 |
| 69 | Ga0070713_100151526 | 3300005436 | Bacteria | 2063 |
| 70 | Ga0070713_100655728 | 3300005436 | Bacteria | 1000 |
| 71 | Ga0070713_101305934 | 3300005436 | Bacteria | 703 |
| 72 | Ga0070713_101316820 | 3300005436 | Unclassified | 700 |
| 73 | Ga0070713_101707203 | 3300005436 | Bacteria | 611 |
| 74 | Ga0070713_101730703 | 3300005436 | Bacteria | 607 |
| 75 | Ga0070710_10234072 | 3300005437 | Bacteria | 1174 |
| 76 | Ga0070710_10360278 | 3300005437 | Unclassified | 965 |
| 77 | Ga0070701_10610616 | 3300005438 | Unclassified | 723 |
| 78 | Ga0070711_100125904 | 3300005439 | Bacteria | 1902 |
| 79 | Ga0070711_100216503 | 3300005439 | Bacteria | 1486 |
| 80 | Ga0070711_100224825 | 3300005439 | Unclassified | 1461 |
| 81 | Ga0070711_100267744 | 3300005439 | Bacteria | 1347 |
| 82 | Ga0070711_100494753 | 3300005439 | Unclassified | 1007 |
| 83 | Ga0070711_101025342 | 3300005439 | Bacteria | 709 |
| 84 | Ga0070711_102036924 | 3300005439 | Unclassified | 505 |
| 85 | Ga0070700_101029170 | 3300005441 | Bacteria | 679 |
| 86 | Ga0070694_100550700 | 3300005444 | Bacteria | 924 |
| 87 | Ga0070694_101396612 | 3300005444 | Unclassified | 591 |
| 88 | Ga0070663_100034849 | 3300005455 | Unclassified | 3488 |
| 89 | Ga0070663_100520890 | 3300005455 | Bacteria | 990 |
| 90 | Ga0070663_101561169 | 3300005455 | Unclassified | 588 |
| 91 | Ga0070678_100304218 | 3300005456 | Bacteria | 1356 |
| 92 | Ga0070662_100071033 | 3300005457 | Bacteria | 2566 |
| 93 | Ga0070662_101011681 | 3300005457 | Unclassified | 712 |
| 94 | Ga0070681_10003876 | 3300005458 | Bacteria | 14077 |
| 95 | Ga0070681_10109146 | 3300005458 | Bacteria | 2707 |
| 96 | Ga0070681_10122152 | 3300005458 | Bacteria | 2538 |
| 97 | Ga0070681_10128307 | 3300005458 | Bacteria | 2469 |
| 98 | Ga0070681_10175144 | 3300005458 | Bacteria | 2067 |
| 99 | Ga0070681_10440425 | 3300005458 | Bacteria | 1215 |
| 100 | Ga0070681_10445815 | 3300005458 | Unclassified | 1206 |
| 101 | Ga0070681_11329617 | 3300005458 | Viruses | 642 |
| 102 | Ga0070681_11851029 | 3300005458 | Archaea | 531 |
| 103 | Ga0068867_100047067 | 3300005459 | Unclassified | 3170 |
| 104 | Ga0068867_100076038 | 3300005459 | Bacteria | 2520 |
| 105 | Ga0070706_100270815 | 3300005467 | Bacteria | 1585 |
| 106 | Ga0070698_101766646 | 3300005471 | Unclassified | 571 |
| 107 | Ga0070679_100000672 | 3300005530 | Bacteria | 29143 |
| 108 | Ga0070679_100134246 | 3300005530 | Bacteria | 2456 |
| 109 | Ga0070679_100217552 | 3300005530 | Bacteria | 1872 |
| 110 | Ga0070679_100336428 | 3300005530 | Bacteria | 1458 |
| 111 | Ga0070679_100451018 | 3300005530 | Bacteria | 1231 |
| 112 | Ga0070679_100471249 | 3300005530 | Bacteria | 1200 |
| 113 | Ga0070679_101895252 | 3300005530 | Unclassified | 545 |
| 114 | Ga0070679_102012335 | 3300005530 | Unclassified | 527 |
| 115 | Ga0070679_102076142 | 3300005530 | Unclassified | 518 |
| 116 | Ga0070684_100000004 | 3300005535 | Bacteria | 231043 |
| 117 | Ga0070684_100002053 | 3300005535 | Bacteria | 14823 |
| 118 | Ga0070684_100032924 | 3300005535 | Bacteria | 4422 |
| 119 | Ga0070684_100161089 | 3300005535 | Bacteria | 2035 |
| 120 | Ga0070684_101220716 | 3300005535 | Unclassified | 707 |
| 121 | Ga0070684_101899337 | 3300005535 | Unclassified | 562 |
| 122 | Ga0070697_100701481 | 3300005536 | Bacteria | 893 |
| 123 | Ga0070697_101348001 | 3300005536 | Unclassified | 637 |
| 124 | Ga0068853_100052122 | 3300005539 | Bacteria | 3524 |
| 125 | Ga0068853_100069398 | 3300005539 | Bacteria | 3066 |
| 126 | Ga0068853_100226141 | 3300005539 | Bacteria | 1710 |
| 127 | Ga0068853_100319631 | 3300005539 | Bacteria | 1439 |
| 128 | Ga0068853_100324356 | 3300005539 | Bacteria | 1428 |
| 129 | Ga0070672_100793579 | 3300005543 | Bacteria | 833 |
| 130 | Ga0070672_101614835 | 3300005543 | Bacteria | 582 |
| 131 | Ga0070686_100161288 | 3300005544 | Bacteria | 1579 |
| 132 | Ga0070695_100480919 | 3300005545 | Unclassified | 957 |
| 133 | Ga0070695_100747717 | 3300005545 | Unclassified | 780 |
| 134 | Ga0070695_101185953 | 3300005545 | Unclassified | 627 |
| 135 | Ga0070695_101658132 | 3300005545 | Bacteria | 534 |
| 136 | Ga0070696_100001668 | 3300005546 | Bacteria | 14553 |
| 137 | Ga0070693_100021041 | 3300005547 | Bacteria | 3450 |
| 138 | Ga0070693_100287802 | 3300005547 | Bacteria | 1103 |
| 139 | Ga0070693_100678173 | 3300005547 | Bacteria | 752 |
| 140 | Ga0070693_101335872 | 3300005547 | Bacteria | 555 |
| 141 | Ga0070665_100066694 | 3300005548 | Bacteria | 3610 |
| 142 | Ga0070665_100971276 | 3300005548 | Unclassified | 862 |
| 143 | Ga0070665_101400474 | 3300005548 | Unclassified | 708 |
| 144 | Ga0070665_101820767 | 3300005548 | Unclassified | 615 |
| 145 | Ga0070704_100153184 | 3300005549 | Bacteria | 1815 |
| 146 | Ga0070704_100614351 | 3300005549 | Unclassified | 957 |
| 147 | Ga0068855_100000743 | 3300005563 | Bacteria | 40089 |
| 148 | Ga0068855_100007504 | 3300005563 | Bacteria | 13204 |
| 149 | Ga0068855_100008839 | 3300005563 | Bacteria | 12174 |
| 150 | Ga0068855_100010547 | 3300005563 | Bacteria | 11142 |
| 151 | Ga0068855_100013771 | 3300005563 | Bacteria | 9749 |
| 152 | Ga0068855_100017351 | 3300005563 | Bacteria | 8661 |
| 153 | Ga0068855_100050508 | 3300005563 | Unclassified | 4900 |
| 154 | Ga0068855_100133837 | 3300005563 | Unclassified | 2829 |
| 155 | Ga0068855_100189049 | 3300005563 | Bacteria | 2324 |
| 156 | Ga0068855_100221012 | 3300005563 | Bacteria | 2124 |
| 157 | Ga0068855_100496264 | 3300005563 | Unclassified | 1327 |
| 158 | Ga0068855_101476967 | 3300005563 | Bacteria | 699 |
| 159 | Ga0070664_100032705 | 3300005564 | Bacteria | 4351 |
| 160 | Ga0070664_100260087 | 3300005564 | Bacteria | 1562 |
| 161 | Ga0070664_100716055 | 3300005564 | Unclassified | 933 |
| 162 | Ga0068857_100003455 | 3300005577 | Bacteria | 13177 |
| 163 | Ga0068857_100012474 | 3300005577 | Bacteria | 7401 |
| 164 | Ga0068857_100018394 | 3300005577 | Bacteria | 6131 |
| 165 | Ga0068857_100070481 | 3300005577 | Unclassified | 3114 |
| 166 | Ga0068857_101774171 | 3300005577 | Bacteria | 604 |
| 167 | Ga0068857_102198384 | 3300005577 | Unclassified | 542 |
| 168 | Ga0068854_100313272 | 3300005578 | Unclassified | 1273 |
| 169 | Ga0068854_100383682 | 3300005578 | Bacteria | 1158 |
| 170 | Ga0068854_100413126 | 3300005578 | Bacteria | 1119 |
| 171 | Ga0068856_100000435 | 3300005614 | Bacteria | 45888 |
| 172 | Ga0068856_100003656 | 3300005614 | Bacteria | 15436 |
| 173 | Ga0068856_100005743 | 3300005614 | Bacteria | 12227 |
| 174 | Ga0068856_100150378 | 3300005614 | Bacteria | 2337 |
| 175 | Ga0068856_100213383 | 3300005614 | Bacteria | 1945 |
| 176 | Ga0068856_100335234 | 3300005614 | Bacteria | 1530 |
| 177 | Ga0068856_101650104 | 3300005614 | Bacteria | 654 |
| 178 | Ga0068852_100004004 | 3300005616 | Bacteria | 10362 |
| 179 | Ga0068852_100009031 | 3300005616 | Bacteria | 7377 |
| 180 | Ga0068852_100019346 | 3300005616 | Bacteria | 5387 |
| 181 | Ga0068852_100063441 | 3300005616 | Unclassified | 3217 |
| 182 | Ga0068852_100289389 | 3300005616 | Bacteria | 1582 |
| 183 | Ga0068852_100435832 | 3300005616 | Bacteria | 1295 |
| 184 | Ga0068852_100593882 | 3300005616 | Bacteria | 1111 |
| 185 | Ga0068852_101189863 | 3300005616 | Bacteria | 783 |
| 186 | Ga0068852_101622047 | 3300005616 | Bacteria | 669 |
| 187 | Ga0068859_100061999 | 3300005617 | Bacteria | 3769 |
| 188 | Ga0068859_100142353 | 3300005617 | Bacteria | 2472 |
| 189 | Ga0068859_100238826 | 3300005617 | Bacteria | 1906 |
| 190 | Ga0068859_100484798 | 3300005617 | Bacteria | 1332 |
| 191 | Ga0068859_102075141 | 3300005617 | Bacteria | 628 |
| 192 | Ga0068864_100015131 | 3300005618 | Bacteria | 6415 |
| 193 | Ga0068864_100366788 | 3300005618 | Bacteria | 1362 |
| 194 | Ga0068864_100417920 | 3300005618 | Unclassified | 1277 |
| 195 | Ga0068864_100835903 | 3300005618 | Bacteria | 907 |
| 196 | Ga0068866_10264470 | 3300005718 | Unclassified | 1058 |
| 197 | Ga0068861_100491415 | 3300005719 | Bacteria | 1108 |
| 198 | Ga0068851_10063170 | 3300005834 | Bacteria | 1901 |
| 199 | Ga0068851_10253901 | 3300005834 | Unclassified | 998 |
| 200 | Ga0068851_10481207 | 3300005834 | Unclassified | 742 |
| 201 | Ga0068863_100057677 | 3300005841 | Unclassified | 3675 |
| 202 | Ga0068863_100368259 | 3300005841 | Bacteria | 1402 |
| 203 | Ga0068863_100410188 | 3300005841 | Bacteria | 1326 |
| 204 | Ga0068863_100515644 | 3300005841 | Bacteria | 1178 |
| 205 | Ga0068858_100009648 | 3300005842 | Bacteria | 9197 |
| 206 | Ga0068858_100026586 | 3300005842 | Bacteria | 5376 |
| 207 | Ga0068858_100039451 | 3300005842 | Bacteria | 4379 |
| 208 | Ga0068858_100433216 | 3300005842 | Bacteria | 1265 |
| 209 | Ga0068858_100854866 | 3300005842 | Bacteria | 889 |
| 210 | Ga0068860_100008567 | 3300005843 | Bacteria | 10194 |
| 211 | Ga0068860_100027240 | 3300005843 | Bacteria | 5505 |
| 212 | Ga0068860_101792516 | 3300005843 | Unclassified | 635 |
| 213 | Ga0068860_101866752 | 3300005843 | Bacteria | 623 |
| 214 | Ga0070717_10014186 | 3300006028 | Bacteria | 6127 |
| 215 | Ga0070717_10021313 | 3300006028 | Bacteria | 5105 |
| 216 | Ga0070717_10946923 | 3300006028 | Bacteria | 784 |
| 217 | Ga0070715_10105354 | 3300006163 | Unclassified | 1322 |
| 218 | Ga0070712_100340008 | 3300006175 | Unclassified | 1225 |
| 219 | Ga0097621_100053240 | 3300006237 | Unclassified | 3298 |
| 220 | Ga0097621_100055287 | 3300006237 | Unclassified | 3241 |
| 221 | Ga0097621_100056467 | 3300006237 | Bacteria | 3208 |
| 222 | Ga0097621_100077082 | 3300006237 | Unclassified | 2766 |
| 223 | Ga0097621_100080057 | 3300006237 | Bacteria | 2716 |
| 224 | Ga0097621_100091483 | 3300006237 | Unclassified | 2546 |
| 225 | Ga0097621_100264932 | 3300006237 | Bacteria | 1508 |
| 226 | Ga0097621_100510808 | 3300006237 | Bacteria | 1089 |
| 227 | Ga0097621_100652236 | 3300006237 | Bacteria | 966 |
| 228 | Ga0097621_101030069 | 3300006237 | Bacteria | 771 |
| 229 | Ga0068871_100068595 | 3300006358 | Bacteria | 2912 |
| 230 | Ga0068871_100079800 | 3300006358 | Bacteria | 2708 |
| 231 | Ga0068871_100080324 | 3300006358 | Bacteria | 2700 |
| 232 | Ga0068871_100089038 | 3300006358 | Bacteria | 2569 |
| 233 | Ga0068871_100116910 | 3300006358 | Bacteria | 2248 |
| 234 | Ga0068871_100120264 | 3300006358 | Unclassified | 2218 |
| 235 | Ga0068871_100215228 | 3300006358 | Bacteria | 1663 |
| 236 | Ga0068871_100318600 | 3300006358 | Bacteria | 1369 |
| 237 | Ga0068871_100941440 | 3300006358 | Bacteria | 802 |
| 238 | Ga0068871_101495958 | 3300006358 | Unclassified | 638 |
| 239 | Ga0068871_101551958 | 3300006358 | Unclassified | 626 |
| 240 | Ga0075433_11725045 | 3300006852 | Unclassified | 539 |
| 241 | Ga0075434_100406794 | 3300006871 | Bacteria | 1382 |
| 242 | Ga0068865_100006046 | 3300006881 | Bacteria | 7378 |
| 243 | Ga0068865_101246398 | 3300006881 | Unclassified | 659 |
| 244 | Ga0075436_100024722 | 3300006914 | Bacteria | 4130 |
| 245 | Ga0075436_100606390 | 3300006914 | Bacteria | 807 |
| 246 | Ga0097620_100062000 | 3300006931 | Bacteria | 3769 |
| 247 | Ga0097620_100142355 | 3300006931 | Bacteria | 2472 |
| 248 | Ga0097620_100238829 | 3300006931 | Bacteria | 1906 |
| 249 | Ga0097620_100484789 | 3300006931 | Bacteria | 1332 |
| 250 | Ga0097620_102075127 | 3300006931 | Bacteria | 628 |
| 251 | Ga0075435_101228331 | 3300007076 | Bacteria | 656 |
| 252 | Ga0105240_10002045 | 3300009093 | Bacteria | 33208 |
| 253 | Ga0105240_10004457 | 3300009093 | Bacteria | 21347 |
| 254 | Ga0105240_10009269 | 3300009093 | Bacteria | 13960 |
| 255 | Ga0105240_10113264 | 3300009093 | Bacteria | 3278 |
| 256 | Ga0105240_10147077 | 3300009093 | Bacteria | 2811 |
| 257 | Ga0105240_10158950 | 3300009093 | Unclassified | 2686 |
| 258 | Ga0105240_10203841 | 3300009093 | Bacteria | 2316 |
| 259 | Ga0105240_10216793 | 3300009093 | Unclassified | 2232 |
| 260 | Ga0105240_10262022 | 3300009093 | Bacteria | 1994 |
| 261 | Ga0105240_10294504 | 3300009093 | Bacteria | 1859 |
| 262 | Ga0105240_10414782 | 3300009093 | Unclassified | 1514 |
| 263 | Ga0105240_10450459 | 3300009093 | Bacteria | 1440 |
| 264 | Ga0105240_11601207 | 3300009093 | Unclassified | 681 |
| 265 | Ga0105245_10000473 | 3300009098 | Bacteria | 36745 |
| 266 | Ga0105245_10011946 | 3300009098 | Bacteria | 7549 |
| 267 | Ga0105245_10027132 | 3300009098 | Bacteria | 5045 |
| 268 | Ga0105245_10065967 | 3300009098 | Bacteria | 3275 |
| 269 | Ga0105245_10086231 | 3300009098 | Bacteria | 2879 |
| 270 | Ga0105245_10115022 | 3300009098 | Bacteria | 2506 |
| 271 | Ga0105245_10125723 | 3300009098 | Bacteria | 2400 |
| 272 | Ga0105245_10166006 | 3300009098 | Bacteria | 2099 |
| 273 | Ga0105245_10191889 | 3300009098 | Bacteria | 1957 |
| 274 | Ga0105245_10361040 | 3300009098 | Bacteria | 1442 |
| 275 | Ga0105245_11871093 | 3300009098 | Bacteria | 653 |
| 276 | Ga0105245_12112836 | 3300009098 | Unclassified | 617 |
| 277 | Ga0105245_13077058 | 3300009098 | Unclassified | 517 |
| 278 | Ga0105247_10022691 | 3300009101 | Unclassified | 3780 |
| 279 | Ga0105247_10132345 | 3300009101 | Bacteria | 1626 |
| 280 | Ga0105247_10347403 | 3300009101 | Bacteria | 1042 |
| 281 | Ga0105247_10787826 | 3300009101 | Bacteria | 724 |
| 282 | Ga0105247_11042471 | 3300009101 | Unclassified | 641 |
| 283 | Ga0114129_10086606 | 3300009147 | Bacteria | 4345 |
| 284 | Ga0105243_10003924 | 3300009148 | Bacteria | 11872 |
| 285 | Ga0105243_10042868 | 3300009148 | Bacteria | 3545 |
| 286 | Ga0105243_10112364 | 3300009148 | Bacteria | 2282 |
| 287 | Ga0105243_10133516 | 3300009148 | Bacteria | 2109 |
| 288 | Ga0105243_10457419 | 3300009148 | Bacteria | 1199 |
| 289 | Ga0105243_10784512 | 3300009148 | Bacteria | 937 |
| 290 | Ga0105243_10821261 | 3300009148 | Bacteria | 918 |
| 291 | Ga0105243_10864528 | 3300009148 | Unclassified | 897 |
| 292 | Ga0105241_10001262 | 3300009174 | Bacteria | 19295 |
| 293 | Ga0105241_10055702 | 3300009174 | Unclassified | 3030 |
| 294 | Ga0105241_10112825 | 3300009174 | Bacteria | 2178 |
| 295 | Ga0105241_10153333 | 3300009174 | Unclassified | 1887 |
| 296 | Ga0105241_10215599 | 3300009174 | Bacteria | 1610 |
| 297 | Ga0105241_11260318 | 3300009174 | Unclassified | 702 |
| 298 | Ga0105241_12283251 | 3300009174 | Bacteria | 538 |
| 299 | Ga0105242_10010341 | 3300009176 | Bacteria | 7154 |
| 300 | Ga0105242_10040739 | 3300009176 | Bacteria | 3743 |
| 301 | Ga0105242_10142029 | 3300009176 | Bacteria | 2084 |
| 302 | Ga0105242_10387450 | 3300009176 | Bacteria | 1301 |
| 303 | Ga0105242_10397465 | 3300009176 | Unclassified | 1285 |
| 304 | Ga0105242_10628902 | 3300009176 | Bacteria | 1041 |
| 305 | Ga0105242_10647843 | 3300009176 | Bacteria | 1027 |
| 306 | Ga0105242_11510222 | 3300009176 | Unclassified | 703 |
| 307 | Ga0105242_11585411 | 3300009176 | Unclassified | 688 |
| 308 | Ga0105242_12281277 | 3300009176 | Unclassified | 587 |
| 309 | Ga0105242_12284067 | 3300009176 | Bacteria | 587 |
| 310 | Ga0105242_13160956 | 3300009176 | Unclassified | 511 |
| 311 | Ga0105248_10060966 | 3300009177 | Unclassified | 4235 |
| 312 | Ga0105248_10093654 | 3300009177 | Bacteria | 3383 |
| 313 | Ga0105248_10193567 | 3300009177 | Unclassified | 2291 |
| 314 | Ga0105248_10299609 | 3300009177 | Unclassified | 1810 |
| 315 | Ga0105248_10311810 | 3300009177 | Bacteria | 1772 |
| 316 | Ga0105248_10443809 | 3300009177 | Unclassified | 1462 |
| 317 | Ga0105248_10781264 | 3300009177 | Bacteria | 1078 |
| 318 | Ga0105248_11833224 | 3300009177 | Bacteria | 688 |
| 319 | Ga0105248_12319062 | 3300009177 | Unclassified | 611 |
| 320 | Ga0105248_12471922 | 3300009177 | Bacteria | 592 |
| 321 | Ga0105237_10019590 | 3300009545 | Bacteria | 6989 |
| 322 | Ga0105237_10022025 | 3300009545 | Bacteria | 6540 |
| 323 | Ga0105237_10045921 | 3300009545 | Bacteria | 4395 |
| 324 | Ga0105237_10049444 | 3300009545 | Unclassified | 4226 |
| 325 | Ga0105237_10081573 | 3300009545 | Bacteria | 3226 |
| 326 | Ga0105237_10138840 | 3300009545 | Bacteria | 2425 |
| 327 | Ga0105237_10255558 | 3300009545 | Bacteria | 1754 |
| 328 | Ga0105237_10301962 | 3300009545 | Unclassified | 1604 |
| 329 | Ga0105237_10375385 | 3300009545 | Unclassified | 1427 |
| 330 | Ga0105237_10903901 | 3300009545 | Bacteria | 890 |
| 331 | Ga0105237_11007045 | 3300009545 | Unclassified | 840 |
| 332 | Ga0105237_11228418 | 3300009545 | Bacteria | 756 |
| 333 | Ga0105237_11830863 | 3300009545 | Bacteria | 615 |
| 334 | Ga0105237_11880130 | 3300009545 | Unclassified | 607 |
| 335 | Ga0105238_10004238 | 3300009551 | Bacteria | 14249 |
| 336 | Ga0105238_10008726 | 3300009551 | Bacteria | 10140 |
| 337 | Ga0105238_10037209 | 3300009551 | Bacteria | 4948 |
| 338 | Ga0105238_10061383 | 3300009551 | Bacteria | 3762 |
| 339 | Ga0105238_10061723 | 3300009551 | Unclassified | 3750 |
| 340 | Ga0105238_10086694 | 3300009551 | Bacteria | 3118 |
| 341 | Ga0105238_10091689 | 3300009551 | Bacteria | 3026 |
| 342 | Ga0105238_10159543 | 3300009551 | Bacteria | 2231 |
| 343 | Ga0105238_10194597 | 3300009551 | Unclassified | 2003 |
| 344 | Ga0105238_10198447 | 3300009551 | Unclassified | 1982 |
| 345 | Ga0105238_10459014 | 3300009551 | Bacteria | 1271 |
| 346 | Ga0105238_11786722 | 3300009551 | Unclassified | 647 |
| 347 | Ga0105238_11909810 | 3300009551 | Unclassified | 627 |
| 348 | Ga0105238_12195368 | 3300009551 | Bacteria | 587 |
| 349 | Ga0105249_10005911 | 3300009553 | Bacteria | 10597 |
| 350 | Ga0105249_10625523 | 3300009553 | Unclassified | 1133 |
| 351 | Ga0105239_10005444 | 3300010375 | Bacteria | 14937 |
| 352 | Ga0105239_10007139 | 3300010375 | Bacteria | 12847 |
| 353 | Ga0105239_10014670 | 3300010375 | Bacteria | 8689 |
| 354 | Ga0105239_10015885 | 3300010375 | Bacteria | 8334 |
| 355 | Ga0105239_10037677 | 3300010375 | Bacteria | 5298 |
| 356 | Ga0105239_10064209 | 3300010375 | Bacteria | 4030 |
| 357 | Ga0105239_10251335 | 3300010375 | Bacteria | 1986 |
| 358 | Ga0105239_10352663 | 3300010375 | Bacteria | 1661 |
| 359 | Ga0105239_10396508 | 3300010375 | Unclassified | 1561 |
| 360 | Ga0105239_10603818 | 3300010375 | Unclassified | 1252 |
| 361 | Ga0105239_11085708 | 3300010375 | Unclassified | 921 |
| 362 | Ga0105239_13101157 | 3300010375 | Bacteria | 541 |
| 363 | Ga0105246_10009575 | 3300011119 | Bacteria | 5970 |
| 364 | Ga0105246_10028368 | 3300011119 | Bacteria | 3677 |
| 365 | Ga0105246_10219805 | 3300011119 | Bacteria | 1488 |
| 366 | Ga0105246_10297659 | 3300011119 | Unclassified | 1301 |
| 367 | Ga0105246_12558123 | 3300011119 | Unclassified | 503 |
| 368 | Ga0157370_10003623 | 3300013104 | Bacteria | 18073 |
| 369 | Ga0157370_10003855 | 3300013104 | Bacteria | 17488 |
| 370 | Ga0157370_10031553 | 3300013104 | Bacteria | 5180 |
| 371 | Ga0157370_10045469 | 3300013104 | Unclassified | 4212 |
| 372 | Ga0157370_10080310 | 3300013104 | Bacteria | 3070 |
| 373 | Ga0157370_10151895 | 3300013104 | Unclassified | 2155 |
| 374 | Ga0157370_10153438 | 3300013104 | Bacteria | 2143 |
| 375 | Ga0157369_10002505 | 3300013105 | Bacteria | 21985 |
| 376 | Ga0157369_10004511 | 3300013105 | Bacteria | 16388 |
| 377 | Ga0157369_10011678 | 3300013105 | Bacteria | 9974 |
| 378 | Ga0157369_10051355 | 3300013105 | Bacteria | 4462 |
| 379 | Ga0157369_10185201 | 3300013105 | Bacteria | 2190 |
| 380 | Ga0157369_10206126 | 3300013105 | Bacteria | 2062 |
| 381 | Ga0157369_10408276 | 3300013105 | Bacteria | 1409 |
| 382 | Ga0157369_10553178 | 3300013105 | Unclassified | 1189 |
| 383 | Ga0157369_10625956 | 3300013105 | Bacteria | 1110 |
| 384 | Ga0157369_11024465 | 3300013105 | Bacteria | 845 |
| 385 | Ga0157369_11829796 | 3300013105 | Bacteria | 617 |
| 386 | Ga0157369_12068855 | 3300013105 | Unclassified | 577 |
| 387 | Ga0157374_10014270 | 3300013296 | Bacteria | 6949 |
| 388 | Ga0157374_10056589 | 3300013296 | Bacteria | 3662 |
| 389 | Ga0157374_10450090 | 3300013296 | Bacteria | 1289 |
| 390 | Ga0157374_10514339 | 3300013296 | Bacteria | 1203 |
| 391 | Ga0157374_10550737 | 3300013296 | Unclassified | 1161 |
| 392 | Ga0157374_10559057 | 3300013296 | Bacteria | 1152 |
| 393 | Ga0157374_10712432 | 3300013296 | Bacteria | 1017 |
| 394 | Ga0157374_10804924 | 3300013296 | Bacteria | 956 |
| 395 | Ga0157374_10810098 | 3300013296 | Unclassified | 952 |
| 396 | Ga0157374_10832716 | 3300013296 | Unclassified | 939 |
| 397 | Ga0157374_11975479 | 3300013296 | Bacteria | 609 |
| 398 | Ga0157374_12159510 | 3300013296 | Unclassified | 584 |
| 399 | Ga0157378_10001093 | 3300013297 | Bacteria | 24766 |
| 400 | Ga0157378_10241069 | 3300013297 | Bacteria | 1727 |
| 401 | Ga0157378_10290511 | 3300013297 | Bacteria | 1579 |
| 402 | Ga0157378_10371912 | 3300013297 | Bacteria | 1401 |
| 403 | Ga0157378_10393930 | 3300013297 | Unclassified | 1363 |
| 404 | Ga0157378_10483477 | 3300013297 | Unclassified | 1234 |
| 405 | Ga0157378_10691014 | 3300013297 | Bacteria | 1039 |
| 406 | Ga0157378_10855013 | 3300013297 | Bacteria | 938 |
| 407 | Ga0157378_10997818 | 3300013297 | Bacteria | 871 |
| 408 | Ga0157378_11030667 | 3300013297 | Unclassified | 858 |
| 409 | Ga0157378_11053761 | 3300013297 | Bacteria | 849 |
| 410 | Ga0163162_10008263 | 3300013306 | Bacteria | 10158 |
| 411 | Ga0163162_10383608 | 3300013306 | Bacteria | 1538 |
| 412 | Ga0163162_10496623 | 3300013306 | Unclassified | 1351 |
| 413 | Ga0163162_11526492 | 3300013306 | Bacteria | 761 |
| 414 | Ga0163162_12090925 | 3300013306 | Bacteria | 649 |
| 415 | Ga0163162_12540278 | 3300013306 | Unclassified | 589 |
| 416 | Ga0163162_12770312 | 3300013306 | Unclassified | 564 |
| 417 | Ga0157372_10029710 | 3300013307 | Bacteria | 5971 |
| 418 | Ga0157372_10030108 | 3300013307 | Bacteria | 5934 |
| 419 | Ga0157372_10106871 | 3300013307 | Bacteria | 3202 |
| 420 | Ga0157372_10208587 | 3300013307 | Bacteria | 2264 |
| 421 | Ga0157372_10623603 | 3300013307 | Bacteria | 1256 |
| 422 | Ga0157372_10644845 | 3300013307 | Bacteria | 1233 |
| 423 | Ga0157372_11076531 | 3300013307 | Unclassified | 930 |
| 424 | Ga0157372_11134385 | 3300013307 | Unclassified | 904 |
| 425 | Ga0157372_11401257 | 3300013307 | Bacteria | 806 |
| 426 | Ga0157372_11880433 | 3300013307 | Bacteria | 688 |
| 427 | Ga0157372_11935945 | 3300013307 | Unclassified | 678 |
| 428 | Ga0157375_10003392 | 3300013308 | Bacteria | 13815 |
| 429 | Ga0157375_10074026 | 3300013308 | Unclassified | 3426 |
| 430 | Ga0157375_10140289 | 3300013308 | Bacteria | 2544 |
| 431 | Ga0157375_10215893 | 3300013308 | Bacteria | 2076 |
| 432 | Ga0157375_10342439 | 3300013308 | Bacteria | 1660 |
| 433 | Ga0157375_10432326 | 3300013308 | Bacteria | 1482 |
| 434 | Ga0157375_10820588 | 3300013308 | Bacteria | 1078 |
| 435 | Ga0157375_11076288 | 3300013308 | Bacteria | 941 |
| 436 | Ga0157375_11376758 | 3300013308 | Bacteria | 831 |
| 437 | Ga0157375_12822568 | 3300013308 | Unclassified | 581 |
| 438 | Ga0157375_13783914 | 3300013308 | Unclassified | 502 |
| 439 | Ga0163163_10003045 | 3300014325 | Bacteria | 14186 |
| 440 | Ga0163163_10109905 | 3300014325 | Unclassified | 2785 |
| 441 | Ga0163163_10111840 | 3300014325 | Bacteria | 2760 |
| 442 | Ga0163163_10135045 | 3300014325 | Unclassified | 2508 |
| 443 | Ga0163163_10197774 | 3300014325 | Bacteria | 2058 |
| 444 | Ga0163163_10240569 | 3300014325 | Bacteria | 1860 |
| 445 | Ga0163163_10464194 | 3300014325 | Bacteria | 1327 |
| 446 | Ga0163163_11602628 | 3300014325 | Unclassified | 712 |
| 447 | Ga0163163_12307833 | 3300014325 | Unclassified | 597 |
| 448 | Ga0163163_12745241 | 3300014325 | Unclassified | 549 |
| 449 | Ga0157379_10077140 | 3300014968 | Unclassified | 2984 |
| 450 | Ga0157379_10176471 | 3300014968 | Bacteria | 1929 |
| 451 | Ga0157379_10197427 | 3300014968 | Bacteria | 1819 |
| 452 | Ga0157379_10199337 | 3300014968 | Bacteria | 1810 |
| 453 | Ga0157379_10777423 | 3300014968 | Bacteria | 903 |
| 454 | Ga0157379_10897924 | 3300014968 | Unclassified | 840 |
| 455 | Ga0157379_11197653 | 3300014968 | Unclassified | 730 |
| 456 | Ga0157376_10054248 | 3300014969 | Bacteria | 3341 |
| 457 | Ga0157376_10061634 | 3300014969 | Bacteria | 3154 |
| 458 | Ga0157376_10069476 | 3300014969 | Bacteria | 2986 |
| 459 | Ga0157376_10135915 | 3300014969 | Bacteria | 2200 |
| 460 | Ga0157376_10488713 | 3300014969 | Bacteria | 1208 |
| 461 | Ga0157376_10573715 | 3300014969 | Unclassified | 1119 |
| 462 | Ga0157376_10822586 | 3300014969 | Bacteria | 943 |
| 463 | Ga0157376_11505976 | 3300014969 | Bacteria | 706 |
| 464 | Ga0157376_11867848 | 3300014969 | Unclassified | 637 |
| 465 | Ga0157376_13122756 | 3300014969 | Bacteria | 502 |
| 466 | Ga0163161_11291966 | 3300017792 | Unclassified | 634 |
| 467 | Ga0163161_11645213 | 3300017792 | Bacteria | 567 |
| 468 | Ga0206356_11032977 | 3300020070 | Bacteria | 759 |
| 469 | Ga0206349_1804240 | 3300020075 | Bacteria | 968 |
| 470 | Ga0206350_10234319 | 3300020080 | Bacteria | 1060 |
| 471 | Ga0154015_1100450 | 3300020610 | Unclassified | 663 |
| 472 | Ga0224712_10156283 | 3300022467 | Unclassified | 1014 |
| 473 | Ga0207656_10044812 | 3300025321 | Unclassified | 1890 |
| 474 | Ga0207682_10324360 | 3300025893 | Unclassified | 724 |
| 475 | Ga0207692_10293299 | 3300025898 | Bacteria | 988 |
| 476 | Ga0207692_10706094 | 3300025898 | Unclassified | 655 |
| 477 | Ga0207692_10939265 | 3300025898 | Unclassified | 570 |
| 478 | Ga0207642_10278645 | 3300025899 | Bacteria | 961 |
| 479 | Ga0207642_11070350 | 3300025899 | Bacteria | 521 |
| 480 | Ga0207680_10826561 | 3300025903 | Unclassified | 664 |
| 481 | Ga0207647_10334083 | 3300025904 | Bacteria | 859 |
| 482 | Ga0207685_10223323 | 3300025905 | Bacteria | 897 |
| 483 | Ga0207699_10796653 | 3300025906 | Bacteria | 695 |
| 484 | Ga0207699_10858336 | 3300025906 | Bacteria | 669 |
| 485 | Ga0207645_10196382 | 3300025907 | Unclassified | 1327 |
| 486 | Ga0207705_10049187 | 3300025909 | Bacteria | 3035 |
| 487 | Ga0207705_10238140 | 3300025909 | Bacteria | 1386 |
| 488 | Ga0207705_10354300 | 3300025909 | Unclassified | 1131 |
| 489 | Ga0207654_10002640 | 3300025911 | Bacteria | 9098 |
| 490 | Ga0207654_10024898 | 3300025911 | Unclassified | 3222 |
| 491 | Ga0207654_10029661 | 3300025911 | Bacteria | 2997 |
| 492 | Ga0207654_10103418 | 3300025911 | Bacteria | 1759 |
| 493 | Ga0207654_10257471 | 3300025911 | Bacteria | 1172 |
| 494 | Ga0207654_10554752 | 3300025911 | Bacteria | 816 |
| 495 | Ga0207654_10644594 | 3300025911 | Unclassified | 758 |
| 496 | Ga0207707_10001511 | 3300025912 | Bacteria | 21479 |
| 497 | Ga0207707_10082370 | 3300025912 | Bacteria | 2809 |
| 498 | Ga0207707_10094671 | 3300025912 | Bacteria | 2610 |
| 499 | Ga0207707_10124742 | 3300025912 | Bacteria | 2252 |
| 500 | Ga0207707_10148442 | 3300025912 | Bacteria | 2050 |
| 501 | Ga0207707_10179975 | 3300025912 | Unclassified | 1846 |
| 502 | Ga0207707_10264087 | 3300025912 | Bacteria | 1493 |
| 503 | Ga0207707_10302070 | 3300025912 | Bacteria | 1384 |
| 504 | Ga0207707_10443607 | 3300025912 | Bacteria | 1111 |
| 505 | Ga0207695_10002528 | 3300025913 | Bacteria | 26861 |
| 506 | Ga0207695_10014793 | 3300025913 | Bacteria | 9217 |
| 507 | Ga0207695_10016736 | 3300025913 | Bacteria | 8564 |
| 508 | Ga0207695_10043302 | 3300025913 | Unclassified | 4799 |
| 509 | Ga0207695_10050274 | 3300025913 | Unclassified | 4387 |
| 510 | Ga0207695_10064070 | 3300025913 | Bacteria | 3787 |
| 511 | Ga0207695_10143336 | 3300025913 | Unclassified | 2335 |
| 512 | Ga0207695_10144910 | 3300025913 | Bacteria | 2320 |
| 513 | Ga0207695_10151597 | 3300025913 | Bacteria | 2257 |
| 514 | Ga0207695_10155416 | 3300025913 | Bacteria | 2222 |
| 515 | Ga0207695_10361298 | 3300025913 | Bacteria | 1338 |
| 516 | Ga0207695_10814155 | 3300025913 | Bacteria | 814 |
| 517 | Ga0207671_10013307 | 3300025914 | Bacteria | 6561 |
| 518 | Ga0207671_10058791 | 3300025914 | Bacteria | 2851 |
| 519 | Ga0207671_10066491 | 3300025914 | Bacteria | 2683 |
| 520 | Ga0207671_10100774 | 3300025914 | Bacteria | 2187 |
| 521 | Ga0207671_10139886 | 3300025914 | Bacteria | 1864 |
| 522 | Ga0207671_10169708 | 3300025914 | Unclassified | 1694 |
| 523 | Ga0207671_10183559 | 3300025914 | Bacteria | 1629 |
| 524 | Ga0207671_10208334 | 3300025914 | Bacteria | 1529 |
| 525 | Ga0207671_10326786 | 3300025914 | Bacteria | 1214 |
| 526 | Ga0207693_10198393 | 3300025915 | Unclassified | 1578 |
| 527 | Ga0207663_10184463 | 3300025916 | Bacteria | 1493 |
| 528 | Ga0207663_10208080 | 3300025916 | Bacteria | 1416 |
| 529 | Ga0207663_10788178 | 3300025916 | Bacteria | 756 |
| 530 | Ga0207663_11265743 | 3300025916 | Unclassified | 594 |
| 531 | Ga0207663_11390141 | 3300025916 | Unclassified | 565 |
| 532 | Ga0207663_11444654 | 3300025916 | Unclassified | 554 |
| 533 | Ga0207663_11543054 | 3300025916 | Bacteria | 535 |
| 534 | Ga0207660_10018676 | 3300025917 | Bacteria | 4626 |
| 535 | Ga0207660_10202807 | 3300025917 | Unclassified | 1550 |
| 536 | Ga0207660_10381622 | 3300025917 | Bacteria | 1133 |
| 537 | Ga0207662_11307045 | 3300025918 | Unclassified | 515 |
| 538 | Ga0207657_10003464 | 3300025919 | Bacteria | 16835 |
| 539 | Ga0207657_10050108 | 3300025919 | Bacteria | 3635 |
| 540 | Ga0207657_10774792 | 3300025919 | Unclassified | 742 |
| 541 | Ga0207649_10073612 | 3300025920 | Bacteria | 2189 |
| 542 | Ga0207649_10247349 | 3300025920 | Unclassified | 1283 |
| 543 | Ga0207652_10000983 | 3300025921 | Bacteria | 26410 |
| 544 | Ga0207652_10108601 | 3300025921 | Bacteria | 2459 |
| 545 | Ga0207652_10110809 | 3300025921 | Bacteria | 2434 |
| 546 | Ga0207652_10362213 | 3300025921 | Bacteria | 1309 |
| 547 | Ga0207652_10407308 | 3300025921 | Bacteria | 1227 |
| 548 | Ga0207652_10710656 | 3300025921 | Unclassified | 896 |
| 549 | Ga0207652_11217165 | 3300025921 | Unclassified | 655 |
| 550 | Ga0207681_10153810 | 3300025923 | Bacteria | 1727 |
| 551 | Ga0207681_10714008 | 3300025923 | Bacteria | 834 |
| 552 | Ga0207681_11605889 | 3300025923 | Unclassified | 544 |
| 553 | Ga0207694_10002685 | 3300025924 | Bacteria | 14390 |
| 554 | Ga0207694_10005168 | 3300025924 | Bacteria | 10078 |
| 555 | Ga0207694_10019172 | 3300025924 | Bacteria | 5171 |
| 556 | Ga0207694_10072845 | 3300025924 | Bacteria | 2686 |
| 557 | Ga0207694_10073556 | 3300025924 | Bacteria | 2674 |
| 558 | Ga0207694_10083636 | 3300025924 | Bacteria | 2510 |
| 559 | Ga0207694_10149439 | 3300025924 | Bacteria | 1881 |
| 560 | Ga0207694_10195426 | 3300025924 | Bacteria | 1645 |
| 561 | Ga0207694_10341351 | 3300025924 | Bacteria | 1239 |
| 562 | Ga0207694_10372660 | 3300025924 | Bacteria | 1184 |
| 563 | Ga0207694_10670737 | 3300025924 | Bacteria | 874 |
| 564 | Ga0207694_11063335 | 3300025924 | Unclassified | 685 |
| 565 | Ga0207659_10503371 | 3300025926 | Bacteria | 1026 |
| 566 | Ga0207687_10004646 | 3300025927 | Bacteria | 9136 |
| 567 | Ga0207687_10015748 | 3300025927 | Unclassified | 4963 |
| 568 | Ga0207687_10032503 | 3300025927 | Unclassified | 3534 |
| 569 | Ga0207687_10038980 | 3300025927 | Bacteria | 3251 |
| 570 | Ga0207687_10171213 | 3300025927 | Bacteria | 1675 |
| 571 | Ga0207687_10713625 | 3300025927 | Bacteria | 852 |
| 572 | Ga0207687_11439199 | 3300025927 | Unclassified | 592 |
| 573 | Ga0207687_11451760 | 3300025927 | Bacteria | 589 |
| 574 | Ga0207700_10007324 | 3300025928 | Bacteria | 6736 |
| 575 | Ga0207700_10027830 | 3300025928 | Bacteria | 3965 |
| 576 | Ga0207700_10084363 | 3300025928 | Bacteria | 2490 |
| 577 | Ga0207700_10138906 | 3300025928 | Bacteria | 1994 |
| 578 | Ga0207700_10148670 | 3300025928 | Unclassified | 1934 |
| 579 | Ga0207700_11291435 | 3300025928 | Unclassified | 650 |
| 580 | Ga0207664_10005134 | 3300025929 | Bacteria | 8921 |
| 581 | Ga0207664_10167013 | 3300025929 | Bacteria | 1881 |
| 582 | Ga0207664_10795893 | 3300025929 | Unclassified | 850 |
| 583 | Ga0207644_10008746 | 3300025931 | Bacteria | 6628 |
| 584 | Ga0207644_10044730 | 3300025931 | Unclassified | 3147 |
| 585 | Ga0207644_11856811 | 3300025931 | Unclassified | 504 |
| 586 | Ga0207690_10054855 | 3300025932 | Unclassified | 2681 |
| 587 | Ga0207690_10352735 | 3300025932 | Unclassified | 1164 |
| 588 | Ga0207706_10045045 | 3300025933 | Unclassified | 3909 |
| 589 | Ga0207686_10005864 | 3300025934 | Bacteria | 6591 |
| 590 | Ga0207686_10022513 | 3300025934 | Bacteria | 3630 |
| 591 | Ga0207686_10117536 | 3300025934 | Bacteria | 1804 |
| 592 | Ga0207686_10440736 | 3300025934 | Unclassified | 1000 |
| 593 | Ga0207686_10698986 | 3300025934 | Unclassified | 806 |
| 594 | Ga0207686_11532620 | 3300025934 | Unclassified | 550 |
| 595 | Ga0207709_10017010 | 3300025935 | Bacteria | 4053 |
| 596 | Ga0207709_10053564 | 3300025935 | Bacteria | 2483 |
| 597 | Ga0207709_10312969 | 3300025935 | Unclassified | 1172 |
| 598 | Ga0207709_10476490 | 3300025935 | Bacteria | 970 |
| 599 | Ga0207709_10498048 | 3300025935 | Bacteria | 950 |
| 600 | Ga0207709_10735208 | 3300025935 | Bacteria | 792 |
| 601 | Ga0207709_11466558 | 3300025935 | Unclassified | 566 |
| 602 | Ga0207670_10079246 | 3300025936 | Bacteria | 2293 |
| 603 | Ga0207670_10318720 | 3300025936 | Unclassified | 1223 |
| 604 | Ga0207670_10481885 | 3300025936 | Unclassified | 1005 |
| 605 | Ga0207670_11563298 | 3300025936 | Archaea | 561 |
| 606 | Ga0207704_10028450 | 3300025938 | Bacteria | 3101 |
| 607 | Ga0207704_10109305 | 3300025938 | Bacteria | 1864 |
| 608 | Ga0207691_10766845 | 3300025940 | Bacteria | 812 |
| 609 | Ga0207691_10847278 | 3300025940 | Unclassified | 767 |
| 610 | Ga0207691_10989517 | 3300025940 | Bacteria | 702 |
| 611 | Ga0207711_10002782 | 3300025941 | Bacteria | 15386 |
| 612 | Ga0207711_10038016 | 3300025941 | Unclassified | 4092 |
| 613 | Ga0207711_10123006 | 3300025941 | Bacteria | 2318 |
| 614 | Ga0207711_10226705 | 3300025941 | Bacteria | 1711 |
| 615 | Ga0207711_10322054 | 3300025941 | Bacteria | 1429 |
| 616 | Ga0207711_10332991 | 3300025941 | Unclassified | 1404 |
| 617 | Ga0207711_10716513 | 3300025941 | Bacteria | 933 |
| 618 | Ga0207711_10796029 | 3300025941 | Bacteria | 880 |
| 619 | Ga0207689_10023190 | 3300025942 | Bacteria | 5210 |
| 620 | Ga0207689_10062184 | 3300025942 | Bacteria | 3070 |
| 621 | Ga0207689_10140566 | 3300025942 | Unclassified | 1989 |
| 622 | Ga0207689_11082131 | 3300025942 | Unclassified | 676 |
| 623 | Ga0207661_10000055 | 3300025944 | Bacteria | 86544 |
| 624 | Ga0207661_10002740 | 3300025944 | Bacteria | 12132 |
| 625 | Ga0207661_10004091 | 3300025944 | Bacteria | 10192 |
| 626 | Ga0207661_10036594 | 3300025944 | Bacteria | 3833 |
| 627 | Ga0207661_10094248 | 3300025944 | Unclassified | 2500 |
| 628 | Ga0207661_10377628 | 3300025944 | Unclassified | 1282 |
| 629 | Ga0207661_10971156 | 3300025944 | Unclassified | 782 |
| 630 | Ga0207679_10030945 | 3300025945 | Bacteria | 3742 |
| 631 | Ga0207679_10081631 | 3300025945 | Bacteria | 2473 |
| 632 | Ga0207667_10006134 | 3300025949 | Bacteria | 14605 |
| 633 | Ga0207667_10017139 | 3300025949 | Bacteria | 8166 |
| 634 | Ga0207667_10021796 | 3300025949 | Bacteria | 7092 |
| 635 | Ga0207667_10029192 | 3300025949 | Bacteria | 5982 |
| 636 | Ga0207667_10036620 | 3300025949 | Bacteria | 5256 |
| 637 | Ga0207667_10056911 | 3300025949 | Bacteria | 4105 |
| 638 | Ga0207667_10084552 | 3300025949 | Bacteria | 3285 |
| 639 | Ga0207667_10108938 | 3300025949 | Unclassified | 2857 |
| 640 | Ga0207667_10147698 | 3300025949 | Unclassified | 2420 |
| 641 | Ga0207667_10151066 | 3300025949 | Bacteria | 2391 |
| 642 | Ga0207667_10243357 | 3300025949 | Bacteria | 1841 |
| 643 | Ga0207667_10923555 | 3300025949 | Unclassified | 864 |
| 644 | Ga0207667_11068127 | 3300025949 | Unclassified | 792 |
| 645 | Ga0207667_11121936 | 3300025949 | Unclassified | 769 |
| 646 | Ga0207651_10621462 | 3300025960 | Bacteria | 946 |
| 647 | Ga0207651_11590169 | 3300025960 | Unclassified | 589 |
| 648 | Ga0207712_10024559 | 3300025961 | Bacteria | 3994 |
| 649 | Ga0207712_10855375 | 3300025961 | Bacteria | 802 |
| 650 | Ga0207668_10894344 | 3300025972 | Bacteria | 790 |
| 651 | Ga0207640_10231556 | 3300025981 | Bacteria | 1422 |
| 652 | Ga0207640_10484641 | 3300025981 | Unclassified | 1026 |
| 653 | Ga0207640_11050723 | 3300025981 | Bacteria | 718 |
| 654 | Ga0207640_11324456 | 3300025981 | Unclassified | 643 |
| 655 | Ga0207658_10025037 | 3300025986 | Unclassified | 4177 |
| 656 | Ga0207658_10605257 | 3300025986 | Unclassified | 985 |
| 657 | Ga0207658_10752892 | 3300025986 | Bacteria | 882 |
| 658 | Ga0207658_11021505 | 3300025986 | Unclassified | 754 |
| 659 | Ga0207677_10018256 | 3300026023 | Bacteria | 4206 |
| 660 | Ga0207677_10268547 | 3300026023 | Bacteria | 1394 |
| 661 | Ga0207677_10432169 | 3300026023 | Bacteria | 1124 |
| 662 | Ga0207677_10467293 | 3300026023 | Bacteria | 1084 |
| 663 | Ga0207677_11724244 | 3300026023 | Bacteria | 581 |
| 664 | Ga0207703_10021152 | 3300026035 | Bacteria | 5092 |
| 665 | Ga0207703_10023856 | 3300026035 | Bacteria | 4810 |
| 666 | Ga0207703_10074746 | 3300026035 | Unclassified | 2806 |
| 667 | Ga0207703_10279538 | 3300026035 | Bacteria | 1515 |
| 668 | Ga0207703_10351358 | 3300026035 | Unclassified | 1357 |
| 669 | Ga0207703_11624350 | 3300026035 | Unclassified | 622 |
| 670 | Ga0207639_10061766 | 3300026041 | Bacteria | 2895 |
| 671 | Ga0207639_10065842 | 3300026041 | Unclassified | 2814 |
| 672 | Ga0207639_10233690 | 3300026041 | Bacteria | 1595 |
| 673 | Ga0207639_10303531 | 3300026041 | Bacteria | 1412 |
| 674 | Ga0207639_11590777 | 3300026041 | Unclassified | 613 |
| 675 | Ga0207678_10040724 | 3300026067 | Bacteria | 4027 |
| 676 | Ga0207678_10180473 | 3300026067 | Bacteria | 1803 |
| 677 | Ga0207708_11233737 | 3300026075 | Bacteria | 654 |
| 678 | Ga0207702_10014293 | 3300026078 | Bacteria | 6591 |
| 679 | Ga0207702_10024228 | 3300026078 | Bacteria | 5035 |
| 680 | Ga0207702_10028834 | 3300026078 | Bacteria | 4616 |
| 681 | Ga0207702_10114664 | 3300026078 | Bacteria | 2402 |
| 682 | Ga0207702_10151013 | 3300026078 | Bacteria | 2113 |
| 683 | Ga0207702_10159140 | 3300026078 | Bacteria | 2061 |
| 684 | Ga0207702_11105201 | 3300026078 | Unclassified | 787 |
| 685 | Ga0207702_11537413 | 3300026078 | Bacteria | 659 |
| 686 | Ga0207702_11599206 | 3300026078 | Unclassified | 645 |
| 687 | Ga0207641_10046718 | 3300026088 | Unclassified | 3650 |
| 688 | Ga0207641_10566758 | 3300026088 | Bacteria | 1109 |
| 689 | Ga0207641_11185271 | 3300026088 | Unclassified | 763 |
| 690 | Ga0207641_11563325 | 3300026088 | Unclassified | 661 |
| 691 | Ga0207641_11739057 | 3300026088 | Bacteria | 625 |
| 692 | Ga0207648_10023517 | 3300026089 | Bacteria | 5518 |
| 693 | Ga0207648_10035880 | 3300026089 | Unclassified | 4369 |
| 694 | Ga0207648_10081606 | 3300026089 | Bacteria | 2821 |
| 695 | Ga0207648_10950384 | 3300026089 | Bacteria | 804 |
| 696 | Ga0207676_10098448 | 3300026095 | Bacteria | 2418 |
| 697 | Ga0207676_10159296 | 3300026095 | Unclassified | 1953 |
| 698 | Ga0207676_10296344 | 3300026095 | Unclassified | 1475 |
| 699 | Ga0207676_11360607 | 3300026095 | Bacteria | 705 |
| 700 | Ga0207676_11847345 | 3300026095 | Bacteria | 603 |
| 701 | Ga0207674_10000085 | 3300026116 | Bacteria | 101076 |
| 702 | Ga0207674_10000823 | 3300026116 | Bacteria | 40325 |
| 703 | Ga0207674_10002265 | 3300026116 | Bacteria | 24383 |
| 704 | Ga0207674_10017334 | 3300026116 | Bacteria | 7859 |
| 705 | Ga0207674_10028755 | 3300026116 | Bacteria | 5863 |
| 706 | Ga0207674_10692529 | 3300026116 | Unclassified | 984 |
| 707 | Ga0207674_10813509 | 3300026116 | Bacteria | 901 |
| 708 | Ga0207675_101062531 | 3300026118 | Bacteria | 829 |
| 709 | Ga0207675_102616727 | 3300026118 | Unclassified | 514 |
| 710 | Ga0207683_10201595 | 3300026121 | Bacteria | 1809 |
| 711 | Ga0207683_10912273 | 3300026121 | Unclassified | 816 |
| 712 | Ga0207698_10008916 | 3300026142 | Bacteria | 6360 |
| 713 | Ga0207698_10014959 | 3300026142 | Bacteria | 5179 |
| 714 | Ga0207698_10057037 | 3300026142 | Bacteria | 3019 |
| 715 | Ga0207698_10061943 | 3300026142 | Bacteria | 2919 |
| 716 | Ga0207698_10128525 | 3300026142 | Unclassified | 2161 |
| 717 | Ga0207698_10743267 | 3300026142 | Bacteria | 979 |
| 718 | Ga0207698_10900964 | 3300026142 | Bacteria | 892 |
| 719 | Ga0207698_11042800 | 3300026142 | Unclassified | 829 |
| 720 | Ga0268266_10322329 | 3300028379 | Bacteria | 1446 |
| 721 | Ga0268266_10588028 | 3300028379 | Unclassified | 1069 |
| 722 | Ga0268266_11442092 | 3300028379 | Unclassified | 664 |
| 723 | Ga0268264_10403333 | 3300028381 | Bacteria | 1314 |
| 724 | Ga0265338_10125255 | 3300028800 | Unclassified | 2040 |
| 725 | Ga0265338_10271020 | 3300028800 | Bacteria | 1244 |
| 726 | Ga0265338_10433275 | 3300028800 | Unclassified | 933 |
| 727 | Ga0265332_10094999 | 3300031238 | Unclassified | 1259 |
| 728 | Ga0265325_10445676 | 3300031241 | Unclassified | 564 |
| 729 | Ga0265340_10037237 | 3300031247 | Bacteria | 2410 |
| 730 | Ga0265316_10954647 | 3300031344 | Unclassified | 598 |
| 731 | Ga0265313_10001123 | 3300031595 | Bacteria | 25577 |
| 732 | Ga0265314_10010658 | 3300031711 | Bacteria | 7649 |
| 733 | Ga0265314_10717267 | 3300031711 | Unclassified | 504 |
| 734 | Ga0265342_10290768 | 3300031712 | Unclassified | 863 |
| 735 | Ga0265342_10316259 | 3300031712 | Unclassified | 819 |
| 736 | Ga0307510_10019662 | 3300033180 | Bacteria | 7912 |
| 737 | Ga0373926_0104695 | 3300035083 | Unclassified | 1060 |
| 738 | Ga0373934_0001519 | 3300035086 | Bacteria | 8512 |
| 739 | Ga0373934_0046314 | 3300035086 | Bacteria | 1720 |
| 740 | Ga0373934_0151424 | 3300035086 | Unclassified | 950 |
| 741 | Ga0373940_0232819 | 3300035088 | Bacteria | 616 |
| 742 | Ga0373944_0296790 | 3300035089 | Bacteria | 606 |
| 743 | Ga0373923_0065100 | 3300035111 | Bacteria | 1555 |
| 744 | Ga0373936_0017924 | 3300035113 | Bacteria | 2731 |
| 745 | Ga0373936_0041205 | 3300035113 | Bacteria | 1852 |
| 746 | Ga0373936_0075212 | 3300035113 | Bacteria | 1398 |
| 747 | Ga0373936_0623547 | 3300035113 | Unclassified | 507 |
| 748 | Ga0373945_0170327 | 3300035116 | Unclassified | 892 |
| 749 | Ga0373953_0053170 | 3300035117 | Bacteria | 1641 |
| 750 | Ga0373953_0065731 | 3300035117 | Unclassified | 1489 |
| 751 | Ga0373953_0265421 | 3300035117 | Unclassified | 747 |
| 752 | Ga0373954_0008113 | 3300035118 | Bacteria | 4601 |
| 753 | Ga0373954_0011247 | 3300035118 | Bacteria | 3962 |
| 754 | Ga0373954_0029120 | 3300035118 | Bacteria | 2542 |
| 755 | Ga0373954_0137519 | 3300035118 | Unclassified | 1191 |
| 756 | Ga0373954_0349709 | 3300035118 | Unclassified | 730 |
| 757 | Ga0373954_0407536 | 3300035118 | Bacteria | 672 |
| 758 | Ga0373956_0063359 | 3300035119 | Bacteria | 1677 |
| 759 | Ga0373956_0099793 | 3300035119 | Bacteria | 1346 |
| 760 | Ga0373956_0173784 | 3300035119 | Bacteria | 1017 |
| 761 | Ga0373956_0255998 | 3300035119 | Bacteria | 832 |
| 762 | Ga0373957_0087349 | 3300035120 | Bacteria | 1236 |
| 763 | Ga0373957_0253023 | 3300035120 | Unclassified | 741 |
| 764 | Ga0373943_0045750 | 3300035170 | Bacteria | 2134 |
| 765 | Ga0373943_0234110 | 3300035170 | Bacteria | 1027 |
| 766 | Ga0373943_0520727 | 3300035170 | Unclassified | 696 |
| 767 | Ga0373943_0642672 | 3300035170 | Archaea | 627 |
| 768 | Ga0373943_0948597 | 3300035170 | Unclassified | 515 |
| 769 | Ga0373946_0570464 | 3300035171 | Unclassified | 585 |
| 770 | Ga0373955_0014927 | 3300035172 | Bacteria | 3792 |
| 771 | Ga0373955_0027920 | 3300035172 | Bacteria | 2922 |
| 772 | Ga0373955_0419396 | 3300035172 | Bacteria | 814 |
| 773 | Ga0373955_0520502 | 3300035172 | Bacteria | 727 |
| 774 | Ga0373955_0848833 | 3300035172 | Unclassified | 562 |
| 775 | Ga0373924_0066045 | 3300035410 | Bacteria | 1520 |
| 776 | Ga0373931_1030058 | 3300035691 | Unclassified | 558 |
| 777 | Ga0373935_0005931 | 3300035692 | Bacteria | 7242 |
| 778 | Ga0373935_0085104 | 3300035692 | Bacteria | 2061 |
| 779 | Ga0373935_0286698 | 3300035692 | Bacteria | 1160 |
| 780 | Ga0373935_0488477 | 3300035692 | Bacteria | 893 |
| 781 | Ga0373927_0002869 | 3300035695 | Bacteria | 12548 |
| 782 | Ga0373927_0110629 | 3300035695 | Bacteria | 1790 |
| 783 | Ga0373927_0133532 | 3300035695 | Bacteria | 1622 |
| 784 | Ga0373927_0190741 | 3300035695 | Unclassified | 1345 |
| 785 | Ga0373927_0401938 | 3300035695 | Bacteria | 904 |
| 786 | Ga0373933_0097460 | 3300035724 | Bacteria | 1821 |
| 787 | Ga0373933_0219684 | 3300035724 | Bacteria | 1219 |
| 788 | Ga0373933_0386010 | 3300035724 | Bacteria | 912 |
| 789 | Ga0373933_0820898 | 3300035724 | Bacteria | 612 |
| 790 | Ga0373933_0864756 | 3300035724 | Unclassified | 595 |
| 791 | Ga0373947_0005144 | 3300035725 | Bacteria | 7661 |
| 792 | Ga0373947_0097692 | 3300035725 | Bacteria | 1841 |
| 793 | Ga0373947_0961541 | 3300035725 | Unclassified | 583 |
| 794 | Ga0373947_0988185 | 3300035725 | Archaea | 574 |
| 795 | Ga0373937_0003452 | 3300036401 | Bacteria | 13274 |
| 796 | Ga0373937_0007081 | 3300036401 | Bacteria | 9687 |
| 797 | Ga0373937_0083043 | 3300036401 | Bacteria | 2964 |
| 798 | Ga0373937_0091494 | 3300036401 | Bacteria | 2819 |
| 799 | Ga0373937_0137588 | 3300036401 | Bacteria | 2284 |
| 800 | Ga0373937_0227707 | 3300036401 | Bacteria | 1755 |
| 801 | Ga0373937_0263554 | 3300036401 | Bacteria | 1625 |
| 802 | Ga0373937_0559774 | 3300036401 | Bacteria | 1086 |
| 803 | Ga0373937_0725387 | 3300036401 | Bacteria | 941 |
| 804 | Ga0373937_0867289 | 3300036401 | Unclassified | 851 |
| 805 | Ga0373937_1374531 | 3300036401 | Bacteria | 654 |
| 806 | Ga0373925_0008278 | 3300037068 | Bacteria | 7568 |
| 807 | Ga0373925_0258163 | 3300037068 | Bacteria | 1399 |
| 808 | Ga0373925_0405939 | 3300037068 | Bacteria | 1112 |
| 809 | Ga0373925_0506571 | 3300037068 | Unclassified | 991 |
| 810 | Ga0373925_1307825 | 3300037068 | Unclassified | 595 |
| 811 | Ga0395900_0036412 | 3300037418 | Bacteria | 5074 |
| 812 | Ga0395900_0446244 | 3300037418 | Bacteria | 1251 |
| 813 | Ga0395898_0588926 | 3300037466 | Bacteria | 1055 |
| 814 | Ga0395898_0753667 | 3300037466 | Bacteria | 915 |
| 815 | Ga0395905_0473414 | 3300037471 | Bacteria | 1152 |
| 816 | Ga0436364_0310100 | 3300037853 | Bacteria | 2577 |
| 817 | Ga0436364_0413027 | 3300037853 | Unclassified | 824 |
| 818 | Ga0436364_1401413 | 3300037853 | Bacteria | 759 |
| 819 | Ga0395901_0978418 | 3300038443 | Bacteria | 823 |
| 820 | Ga0436365_0660380 | 3300039437 | Bacteria | 565 |
| 821 | Ga0436362_1079586 | 3300039453 | Bacteria | 537 |
| 822 | Ga0439448_0053415 | 3300042005 | Unclassified | 1326 |
| 823 | Ga0451577_0356577 | 3300042876 | Bacteria | 1327 |
| 824 | Ga0451577_0448452 | 3300042876 | Unclassified | 1172 |
| 825 | Ga0451577_0504041 | 3300042876 | Bacteria | 1099 |
| 826 | Ga0451577_0899110 | 3300042876 | Bacteria | 797 |
| 827 | Ga0451577_1062343 | 3300042876 | Bacteria | 726 |
| 828 | Ga0451577_1073866 | 3300042876 | Bacteria | 721 |
| 829 | Ga0453683_0931478 | 3300044673 | Unclassified | 575 |
| 830 | Ga0451576_0153840 | 3300045051 | Bacteria | 2399 |
| 831 | Ga0451576_0461342 | 3300045051 | Bacteria | 1334 |
| 832 | Ga0451576_0493739 | 3300045051 | Bacteria | 1286 |
| 833 | Ga0451576_0708320 | 3300045051 | Bacteria | 1058 |
| 834 | Ga0451576_2488695 | 3300045051 | Bacteria | 529 |
| 835 | Ga0495592_0108247 | 3300046454 | Bacteria | 1970 |
| 836 | Ga0495651_0666620 | 3300046462 | Unclassified | 651 |
| 837 | Ga0495580_0001305 | 3300046472 | Bacteria | 22019 |
| 838 | Ga0495580_0071830 | 3300046472 | Unclassified | 2418 |
| 839 | Ga0495580_0297936 | 3300046472 | Bacteria | 1098 |
| 840 | Ga0495580_0431620 | 3300046472 | Bacteria | 885 |
| 841 | Ga0495580_0750249 | 3300046472 | Unclassified | 636 |
| 842 | Ga0495582_0016592 | 3300046473 | Bacteria | 4032 |
| 843 | Ga0495582_0598759 | 3300046473 | Bacteria | 638 |
| 844 | Ga0495639_0038222 | 3300046475 | Bacteria | 2155 |
| 845 | Ga0495664_0153463 | 3300046477 | Bacteria | 1397 |
| 846 | Ga0495664_0249314 | 3300046477 | Bacteria | 1074 |
| 847 | Ga0495664_0292577 | 3300046477 | Bacteria | 984 |
| 848 | Ga0495594_0157174 | 3300046499 | Bacteria | 1292 |
| 849 | Ga0495594_0448876 | 3300046499 | Bacteria | 733 |
| 850 | Ga0495608_0487468 | 3300046511 | Bacteria | 747 |
| 851 | Ga0495628_1118916 | 3300046516 | Unclassified | 537 |
| 852 | Ga0495630_0455903 | 3300046517 | Bacteria | 980 |
| 853 | Ga0495666_0094782 | 3300046526 | Bacteria | 1408 |
| 854 | Ga0495666_0125338 | 3300046526 | Unclassified | 1201 |
| 855 | Ga0495652_0196665 | 3300046529 | Bacteria | 1534 |
| 856 | Ga0495652_0292768 | 3300046529 | Unclassified | 1187 |
| 857 | Ga0495652_0416694 | 3300046529 | Archaea | 947 |
| 858 | Ga0495652_0794918 | 3300046529 | Unclassified | 630 |
| 859 | Ga0495665_0012672 | 3300046531 | Bacteria | 4564 |
| 860 | Ga0495665_0051842 | 3300046531 | Bacteria | 2173 |
| 861 | Ga0495665_0119415 | 3300046531 | Bacteria | 1381 |
| 862 | Ga0495665_0281190 | 3300046531 | Bacteria | 854 |
| 863 | Ga0495586_0070417 | 3300046535 | Bacteria | 1910 |
| 864 | Ga0495586_0812777 | 3300046535 | Unclassified | 539 |
| 865 | Ga0495587_0000764 | 3300046536 | Bacteria | 21422 |
| 866 | Ga0495645_0590756 | 3300046543 | Unclassified | 684 |
| 867 | Ga0495645_0710319 | 3300046543 | Bacteria | 609 |
| 868 | Ga0495645_0714980 | 3300046543 | Unclassified | 607 |
| 869 | Ga0495667_0242472 | 3300046559 | Bacteria | 1148 |
| 870 | Ga0495667_0272823 | 3300046559 | Unclassified | 1074 |
| 871 | Ga0495635_0129595 | 3300046663 | Bacteria | 1720 |
| 872 | Ga0495635_0422612 | 3300046663 | Bacteria | 883 |
| 873 | Ga0495635_0459842 | 3300046663 | Archaea | 841 |
| 874 | Ga0495635_0560902 | 3300046663 | Unclassified | 748 |
| 875 | Ga0495599_0296564 | 3300046678 | Archaea | 977 |
| 876 | Ga0495599_0430791 | 3300046678 | Bacteria | 783 |
| 877 | Ga0495623_0376090 | 3300046679 | Unclassified | 769 |
| 878 | Ga0495658_0040510 | 3300046683 | Bacteria | 2590 |
| 879 | Ga0495658_0050566 | 3300046683 | Bacteria | 2352 |
| 880 | Ga0495613_0793617 | 3300046689 | Bacteria | 618 |
| 881 | Ga0495600_0142625 | 3300046809 | Unclassified | 1554 |
| 882 | Ga0495581_0358057 | 3300047315 | Unclassified | 852 |
| 883 | Ga0495636_0035782 | 3300047318 | Bacteria | 2046 |
| 884 | Ga0495674_0032221 | 3300047319 | Bacteria | 4756 |
| 885 | Ga0495674_0164665 | 3300047319 | Bacteria | 1854 |
| 886 | Ga0495674_0308587 | 3300047319 | Unclassified | 1291 |
| 887 | Ga0495674_0979795 | 3300047319 | Unclassified | 649 |
| 888 | Ga0495674_1350833 | 3300047319 | Bacteria | 533 |
| 889 | Ga0495680_0389932 | 3300047322 | Unclassified | 963 |
| 890 | Ga0495680_0438351 | 3300047322 | Archaea | 896 |
| 891 | Ga0495680_0771755 | 3300047322 | Bacteria | 630 |
| 892 | Ga0495675_0107191 | 3300047444 | Bacteria | 1746 |
| 893 | Ga0495675_0229124 | 3300047444 | Bacteria | 1122 |
| 894 | Ga0495684_0014155 | 3300047471 | Bacteria | 6137 |
| 895 | Ga0495684_0127277 | 3300047471 | Archaea | 1916 |
| 896 | Ga0495684_0202188 | 3300047471 | Bacteria | 1464 |
| 897 | Ga0495684_0280936 | 3300047471 | Bacteria | 1201 |
| 898 | Ga0495684_0290139 | 3300047471 | Bacteria | 1178 |
| 899 | Ga0495684_0656412 | 3300047471 | Bacteria | 701 |
| 900 | Ga0495602_0000355 | 3300048088 | Bacteria | 42648 |
| 901 | Ga0495602_0528351 | 3300048088 | Bacteria | 821 |
| 902 | Ga0495602_0789916 | 3300048088 | Unclassified | 638 |
| 903 | Ga0496101_1478250 | 3300048904 | Unclassified | 529 |
| 904 | Ga0496102_0352634 | 3300048905 | Bacteria | 1385 |
| 905 | Ga0496102_0962131 | 3300048905 | Bacteria | 775 |
| 906 | Ga0496104_0553036 | 3300048907 | Bacteria | 1062 |
| 907 | Ga0496104_1066009 | 3300048907 | Unclassified | 712 |
| 908 | Ga0496104_1268018 | 3300048907 | Unclassified | 640 |
| 909 | Ga0496105_0556075 | 3300048908 | Bacteria | 895 |
| 910 | Ga0496106_0399734 | 3300048909 | Bacteria | 1104 |
| 911 | Ga0496110_0276950 | 3300048913 | Bacteria | 1528 |
| 912 | Ga0496112_1621103 | 3300048915 | Unclassified | 560 |
| 913 | Ga0496115_0298998 | 3300048918 | Bacteria | 1319 |
| 914 | Ga0496115_0364873 | 3300048918 | Unclassified | 1176 |
| 915 | Ga0501037_0151259 | 3300049573 | Bacteria | 1659 |
| 916 | Ga0501038_0764720 | 3300049574 | Unclassified | 720 |
| 917 | Ga0501043_1300640 | 3300049579 | Unclassified | 507 |
| 918 | Ga0501047_0054636 | 3300049581 | Unclassified | 3863 |
| 919 | Ga0501070_0042363 | 3300049586 | Bacteria | 3792 |
| 920 | Ga0501035_0069227 | 3300049822 | Bacteria | 3129 |
| 921 | Ga0501044_0034903 | 3300049823 | Bacteria | 5269 |
| 922 | Ga0501044_0442462 | 3300049823 | Unclassified | 1207 |
| 923 | nmdc:mga05p37_373991_c1 | 3300050507 | Bacteria | 1671 |
| 924 | nmdc:mga06r32_1077259_c1 | 3300050510 | Unclassified | 753 |
| 925 | nmdc:mga0n895_275818_c1 | 3300050512 | Bacteria | 1705 |
| 926 | nmdc:mga0rr50_655170_c1 | 3300050513 | Bacteria | 896 |
| 927 | nmdc:mga08x19_2973_c1 | 3300050514 | Bacteria | 10179 |
| 928 | Ga0495601_0209827 | 3300053077 | Bacteria | 1272 |
| 929 | Ga0495612_0256681 | 3300053078 | Bacteria | 778 |
| 930 | Ga0495595_0463770 | 3300053084 | Bacteria | 644 |
| 931 | Ga0495619_0175567 | 3300053085 | Unclassified | 1482 |
| 932 | Ga0495619_0256470 | 3300053085 | Bacteria | 1212 |
| 933 | Ga0501082_0000151 | 3300060353 | Bacteria | 58286 |
| 934 | Ga0207686_10875536 | |||
| 935 | Ga0070658_10013746 | |||
| 936 | Ga0070658_10169684 | |||
| 937 | Ga0070658_10518154 | |||
| 938 | Ga0070683_100000014 | |||
| 939 | Ga0070683_100013387 | |||
| 940 | Ga0070683_100063160 | |||
| 941 | Ga0070683_100597462 | |||
| 942 | Ga0070683_101151829 | |||
| 943 | Ga0070690_100332214 | |||
| 944 | Ga0070690_100459870 | |||
| 945 | Ga0070670_100560167 | |||
| 946 | Ga0070677_10275502 | |||
| 947 | Ga0068869_100134205 | |||
| 948 | Ga0068869_100669496 | |||
| 949 | Ga0068869_100733719 | |||
| 950 | Ga0068869_100926823 | |||
| 951 | Ga0068869_101676166 | |||
| 952 | Ga0070666_10215784 | |||
| 953 | Ga0070666_10414495 | |||
| 954 | Ga0070680_100012925 | |||
| 955 | Ga0070680_100136492 | |||
| 956 | Ga0070680_100544963 | |||
| 957 | Ga0070682_101140950 | |||
| 958 | Ga0068868_100040065 | |||
| 959 | Ga0068868_100334953 | |||
| 960 | Ga0068868_100538481 | |||
| 961 | Ga0068868_100857179 | |||
| 962 | Ga0068868_101337175 | |||
| 963 | Ga0068868_101826086 | |||
| 964 | Ga0070660_100012404 | |||
| 965 | Ga0070660_100015079 | |||
| 966 | Ga0070660_100146388 | |||
| 967 | Ga0070660_100979997 | |||
| 968 | Ga0070660_100992054 | |||
| 969 | Ga0070689_100301358 | |||
| 970 | Ga0070689_100712878 | |||
| 971 | Ga0070661_100192209 | |||
| 972 | Ga0070661_100194112 | |||
| 973 | Ga0070661_101377743 | |||
| 974 | Ga0070692_10111049 | |||
| 975 | Ga0070692_10452879 | |||
| 976 | Ga0070668_100985391 | |||
| 977 | Ga0070669_101022984 | |||
| 978 | Ga0070675_100333010 | |||
| 979 | Ga0070675_100658216 | |||
| 980 | Ga0070671_100064253 | |||
| 981 | Ga0070673_100589453 | |||
| 982 | Ga0070673_100706139 | |||
| 983 | Ga0070688_100982058 | |||
| 984 | Ga0070659_100023643 | |||
| 985 | Ga0070659_100509779 | |||
| 986 | Ga0070667_100279820 | |||
| 987 | Ga0070667_100547121 | |||
| 988 | Ga0070667_100666401 | |||
| 989 | Ga0070667_100820531 | |||
| 990 | Ga0070667_101089331 | |||
| 991 | Ga0070703_10079443 | |||
| 992 | Ga0070709_10259953 | |||
| 993 | Ga0070709_10272952 | |||
| 994 | Ga0070709_10377165 | |||
| 995 | Ga0070709_11661435 | |||
| 996 | Ga0070714_100001627 | |||
| 997 | Ga0070714_100060059 | |||
| 998 | Ga0070714_100611602 | |||
| 999 | Ga0070713_100006450 | |||
| 1000 | Ga0070713_100045240 | |||
| 1001 | Ga0070713_100095623 | |||
| 1002 | Ga0070713_100151526 | |||
| 1003 | Ga0070713_100655728 | |||
| 1004 | Ga0070713_101305934 | |||
| 1005 | Ga0070713_101316820 | |||
| 1006 | Ga0070713_101707203 | |||
| 1007 | Ga0070713_101730703 | |||
| 1008 | Ga0070710_10234072 | |||
| 1009 | Ga0070710_10360278 | |||
| 1010 | Ga0070701_10610616 | |||
| 1011 | Ga0070711_100125904 | |||
| 1012 | Ga0070711_100216503 | |||
| 1013 | Ga0070711_100224825 | |||
| 1014 | Ga0070711_100267744 | |||
| 1015 | Ga0070711_100494753 | |||
| 1016 | Ga0070711_101025342 | |||
| 1017 | Ga0070711_102036924 | |||
| 1018 | Ga0070700_101029170 | |||
| 1019 | Ga0070694_100550700 | |||
| 1020 | Ga0070694_101396612 | |||
| 1021 | Ga0070663_100034849 | |||
| 1022 | Ga0070663_100520890 | |||
| 1023 | Ga0070663_101561169 | |||
| 1024 | Ga0070678_100304218 | |||
| 1025 | Ga0070662_100071033 | |||
| 1026 | Ga0070662_101011681 | |||
| 1027 | Ga0070681_10003876 | |||
| 1028 | Ga0070681_10109146 | |||
| 1029 | Ga0070681_10122152 | |||
| 1030 | Ga0070681_10128307 | |||
| 1031 | Ga0070681_10175144 | |||
| 1032 | Ga0070681_10440425 | |||
| 1033 | Ga0070681_10445815 | |||
| 1034 | Ga0070681_11329617 | |||
| 1035 | Ga0070681_11851029 | |||
| 1036 | Ga0068867_100047067 | |||
| 1037 | Ga0068867_100076038 | |||
| 1038 | Ga0070706_100270815 | |||
| 1039 | Ga0070698_101766646 | |||
| 1040 | Ga0070679_100000672 | |||
| 1041 | Ga0070679_100134246 | |||
| 1042 | Ga0070679_100217552 | |||
| 1043 | Ga0070679_100336428 | |||
| 1044 | Ga0070679_100451018 | |||
| 1045 | Ga0070679_100471249 | |||
| 1046 | Ga0070679_101895252 | |||
| 1047 | Ga0070679_102012335 | |||
| 1048 | Ga0070679_102076142 | |||
| 1049 | Ga0070684_100000004 | |||
| 1050 | Ga0070684_100002053 | |||
| 1051 | Ga0070684_100032924 | |||
| 1052 | Ga0070684_100161089 | |||
| 1053 | Ga0070684_101220716 | |||
| 1054 | Ga0070684_101899337 | |||
| 1055 | Ga0070697_100701481 | |||
| 1056 | Ga0070697_101348001 | |||
| 1057 | Ga0068853_100052122 | |||
| 1058 | Ga0068853_100069398 | |||
| 1059 | Ga0068853_100226141 | |||
| 1060 | Ga0068853_100319631 | |||
| 1061 | Ga0068853_100324356 | |||
| 1062 | Ga0070672_100793579 | |||
| 1063 | Ga0070672_101614835 | |||
| 1064 | Ga0070686_100161288 | |||
| 1065 | Ga0070695_100480919 | |||
| 1066 | Ga0070695_100747717 | |||
| 1067 | Ga0070695_101185953 | |||
| 1068 | Ga0070695_101658132 | |||
| 1069 | Ga0070696_100001668 | |||
| 1070 | Ga0070693_100021041 | |||
| 1071 | Ga0070693_100287802 | |||
| 1072 | Ga0070693_100678173 | |||
| 1073 | Ga0070693_101335872 | |||
| 1074 | Ga0070665_100066694 | |||
| 1075 | Ga0070665_100971276 | |||
| 1076 | Ga0070665_101400474 | |||
| 1077 | Ga0070665_101820767 | |||
| 1078 | Ga0070704_100153184 | |||
| 1079 | Ga0070704_100614351 | |||
| 1080 | Ga0068855_100000743 | |||
| 1081 | Ga0068855_100007504 | |||
| 1082 | Ga0068855_100008839 | |||
| 1083 | Ga0068855_100010547 | |||
| 1084 | Ga0068855_100013771 | |||
| 1085 | Ga0068855_100017351 | |||
| 1086 | Ga0068855_100050508 | |||
| 1087 | Ga0068855_100133837 | |||
| 1088 | Ga0068855_100189049 | |||
| 1089 | Ga0068855_100221012 | |||
| 1090 | Ga0068855_100496264 | |||
| 1091 | Ga0068855_101476967 | |||
| 1092 | Ga0070664_100032705 | |||
| 1093 | Ga0070664_100260087 | |||
| 1094 | Ga0070664_100716055 | |||
| 1095 | Ga0068857_100003455 | |||
| 1096 | Ga0068857_100012474 | |||
| 1097 | Ga0068857_100018394 | |||
| 1098 | Ga0068857_100070481 | |||
| 1099 | Ga0068857_101774171 | |||
| 1100 | Ga0068857_102198384 | |||
| 1101 | Ga0068854_100313272 | |||
| 1102 | Ga0068854_100383682 | |||
| 1103 | Ga0068854_100413126 | |||
| 1104 | Ga0068856_100000435 | |||
| 1105 | Ga0068856_100003656 | |||
| 1106 | Ga0068856_100005743 | |||
| 1107 | Ga0068856_100150378 | |||
| 1108 | Ga0068856_100213383 | |||
| 1109 | Ga0068856_100335234 | |||
| 1110 | Ga0068856_101650104 | |||
| 1111 | Ga0068852_100004004 | |||
| 1112 | Ga0068852_100009031 | |||
| 1113 | Ga0068852_100019346 | |||
| 1114 | Ga0068852_100063441 | |||
| 1115 | Ga0068852_100289389 | |||
| 1116 | Ga0068852_100435832 | |||
| 1117 | Ga0068852_100593882 | |||
| 1118 | Ga0068852_101189863 | |||
| 1119 | Ga0068852_101622047 | |||
| 1120 | Ga0068859_100061999 | |||
| 1121 | Ga0068859_100142353 | |||
| 1122 | Ga0068859_100238826 | |||
| 1123 | Ga0068859_100484798 | |||
| 1124 | Ga0068859_102075141 | |||
| 1125 | Ga0068864_100015131 | |||
| 1126 | Ga0068864_100366788 | |||
| 1127 | Ga0068864_100417920 | |||
| 1128 | Ga0068864_100835903 | |||
| 1129 | Ga0068866_10264470 | |||
| 1130 | Ga0068861_100491415 | |||
| 1131 | Ga0068851_10063170 | |||
| 1132 | Ga0068851_10253901 | |||
| 1133 | Ga0068851_10481207 | |||
| 1134 | Ga0068863_100057677 | |||
| 1135 | Ga0068863_100368259 | |||
| 1136 | Ga0068863_100410188 | |||
| 1137 | Ga0068863_100515644 | |||
| 1138 | Ga0068858_100009648 | |||
| 1139 | Ga0068858_100026586 | |||
| 1140 | Ga0068858_100039451 | |||
| 1141 | Ga0068858_100433216 | |||
| 1142 | Ga0068858_100854866 | |||
| 1143 | Ga0068860_100008567 | |||
| 1144 | Ga0068860_100027240 | |||
| 1145 | Ga0068860_101792516 | |||
| 1146 | Ga0068860_101866752 | |||
| 1147 | Ga0070717_10014186 | |||
| 1148 | Ga0070717_10021313 | |||
| 1149 | Ga0070717_10946923 | |||
| 1150 | Ga0070715_10105354 | |||
| 1151 | Ga0070712_100340008 | |||
| 1152 | Ga0097621_100053240 | |||
| 1153 | Ga0097621_100055287 | |||
| 1154 | Ga0097621_100056467 | |||
| 1155 | Ga0097621_100077082 | |||
| 1156 | Ga0097621_100080057 | |||
| 1157 | Ga0097621_100091483 | |||
| 1158 | Ga0097621_100264932 | |||
| 1159 | Ga0097621_100510808 | |||
| 1160 | Ga0097621_100652236 | |||
| 1161 | Ga0097621_101030069 | |||
| 1162 | Ga0068871_100068595 | |||
| 1163 | Ga0068871_100079800 | |||
| 1164 | Ga0068871_100080324 | |||
| 1165 | Ga0068871_100089038 | |||
| 1166 | Ga0068871_100116910 | |||
| 1167 | Ga0068871_100120264 | |||
| 1168 | Ga0068871_100215228 | |||
| 1169 | Ga0068871_100318600 | |||
| 1170 | Ga0068871_100941440 | |||
| 1171 | Ga0068871_101495958 | |||
| 1172 | Ga0068871_101551958 | |||
| 1173 | Ga0075433_11725045 | |||
| 1174 | Ga0075434_100406794 | |||
| 1175 | Ga0068865_100006046 | |||
| 1176 | Ga0068865_101246398 | |||
| 1177 | Ga0075436_100024722 | |||
| 1178 | Ga0075436_100606390 | |||
| 1179 | Ga0097620_100062000 | |||
| 1180 | Ga0097620_100142355 | |||
| 1181 | Ga0097620_100238829 | |||
| 1182 | Ga0097620_100484789 | |||
| 1183 | Ga0097620_102075127 | |||
| 1184 | Ga0075435_101228331 | |||
| 1185 | Ga0105240_10002045 | |||
| 1186 | Ga0105240_10004457 | |||
| 1187 | Ga0105240_10009269 | |||
| 1188 | Ga0105240_10113264 | |||
| 1189 | Ga0105240_10147077 | |||
| 1190 | Ga0105240_10158950 | |||
| 1191 | Ga0105240_10203841 | |||
| 1192 | Ga0105240_10216793 | |||
| 1193 | Ga0105240_10262022 | |||
| 1194 | Ga0105240_10294504 | |||
| 1195 | Ga0105240_10414782 | |||
| 1196 | Ga0105240_10450459 | |||
| 1197 | Ga0105240_11601207 | |||
| 1198 | Ga0105245_10000473 | |||
| 1199 | Ga0105245_10011946 | |||
| 1200 | Ga0105245_10027132 | |||
| 1201 | Ga0105245_10065967 | |||
| 1202 | Ga0105245_10086231 | |||
| 1203 | Ga0105245_10115022 | |||
| 1204 | Ga0105245_10125723 | |||
| 1205 | Ga0105245_10166006 | |||
| 1206 | Ga0105245_10191889 | |||
| 1207 | Ga0105245_10361040 | |||
| 1208 | Ga0105245_11871093 | |||
| 1209 | Ga0105245_12112836 | |||
| 1210 | Ga0105245_13077058 | |||
| 1211 | Ga0105247_10022691 | |||
| 1212 | Ga0105247_10132345 | |||
| 1213 | Ga0105247_10347403 | |||
| 1214 | Ga0105247_10787826 | |||
| 1215 | Ga0105247_11042471 | |||
| 1216 | Ga0114129_10086606 | |||
| 1217 | Ga0105243_10003924 | |||
| 1218 | Ga0105243_10042868 | |||
| 1219 | Ga0105243_10112364 | |||
| 1220 | Ga0105243_10133516 | |||
| 1221 | Ga0105243_10457419 | |||
| 1222 | Ga0105243_10784512 | |||
| 1223 | Ga0105243_10821261 | |||
| 1224 | Ga0105243_10864528 | |||
| 1225 | Ga0105241_10001262 | |||
| 1226 | Ga0105241_10055702 | |||
| 1227 | Ga0105241_10112825 | |||
| 1228 | Ga0105241_10153333 | |||
| 1229 | Ga0105241_10215599 | |||
| 1230 | Ga0105241_11260318 | |||
| 1231 | Ga0105241_12283251 | |||
| 1232 | Ga0105242_10010341 | |||
| 1233 | Ga0105242_10040739 | |||
| 1234 | Ga0105242_10142029 | |||
| 1235 | Ga0105242_10387450 | |||
| 1236 | Ga0105242_10397465 | |||
| 1237 | Ga0105242_10628902 | |||
| 1238 | Ga0105242_10647843 | |||
| 1239 | Ga0105242_11510222 | |||
| 1240 | Ga0105242_11585411 | |||
| 1241 | Ga0105242_12281277 | |||
| 1242 | Ga0105242_12284067 | |||
| 1243 | Ga0105242_13160956 | |||
| 1244 | Ga0105248_10060966 | |||
| 1245 | Ga0105248_10093654 | |||
| 1246 | Ga0105248_10193567 | |||
| 1247 | Ga0105248_10299609 | |||
| 1248 | Ga0105248_10311810 | |||
| 1249 | Ga0105248_10443809 | |||
| 1250 | Ga0105248_10781264 | |||
| 1251 | Ga0105248_11833224 | |||
| 1252 | Ga0105248_12319062 | |||
| 1253 | Ga0105248_12471922 | |||
| 1254 | Ga0105237_10019590 | |||
| 1255 | Ga0105237_10022025 | |||
| 1256 | Ga0105237_10045921 | |||
| 1257 | Ga0105237_10049444 | |||
| 1258 | Ga0105237_10081573 | |||
| 1259 | Ga0105237_10138840 | |||
| 1260 | Ga0105237_10255558 | |||
| 1261 | Ga0105237_10301962 | |||
| 1262 | Ga0105237_10375385 | |||
| 1263 | Ga0105237_10903901 | |||
| 1264 | Ga0105237_11007045 | |||
| 1265 | Ga0105237_11228418 | |||
| 1266 | Ga0105237_11830863 | |||
| 1267 | Ga0105237_11880130 | |||
| 1268 | Ga0105238_10004238 | |||
| 1269 | Ga0105238_10008726 | |||
| 1270 | Ga0105238_10037209 | |||
| 1271 | Ga0105238_10061383 | |||
| 1272 | Ga0105238_10061723 | |||
| 1273 | Ga0105238_10086694 | |||
| 1274 | Ga0105238_10091689 | |||
| 1275 | Ga0105238_10159543 | |||
| 1276 | Ga0105238_10194597 | |||
| 1277 | Ga0105238_10198447 | |||
| 1278 | Ga0105238_10459014 | |||
| 1279 | Ga0105238_11786722 | |||
| 1280 | Ga0105238_11909810 | |||
| 1281 | Ga0105238_12195368 | |||
| 1282 | Ga0105249_10005911 | |||
| 1283 | Ga0105249_10625523 | |||
| 1284 | Ga0105239_10005444 | |||
| 1285 | Ga0105239_10007139 | |||
| 1286 | Ga0105239_10014670 | |||
| 1287 | Ga0105239_10015885 | |||
| 1288 | Ga0105239_10037677 | |||
| 1289 | Ga0105239_10064209 | |||
| 1290 | Ga0105239_10251335 | |||
| 1291 | Ga0105239_10352663 | |||
| 1292 | Ga0105239_10396508 | |||
| 1293 | Ga0105239_10603818 | |||
| 1294 | Ga0105239_11085708 | |||
| 1295 | Ga0105239_13101157 | |||
| 1296 | Ga0105246_10009575 | |||
| 1297 | Ga0105246_10028368 | |||
| 1298 | Ga0105246_10219805 | |||
| 1299 | Ga0105246_10297659 | |||
| 1300 | Ga0105246_12558123 | |||
| 1301 | Ga0157370_10003623 | |||
| 1302 | Ga0157370_10003855 | |||
| 1303 | Ga0157370_10031553 | |||
| 1304 | Ga0157370_10045469 | |||
| 1305 | Ga0157370_10080310 | |||
| 1306 | Ga0157370_10151895 | |||
| 1307 | Ga0157370_10153438 | |||
| 1308 | Ga0157369_10002505 | |||
| 1309 | Ga0157369_10004511 | |||
| 1310 | Ga0157369_10011678 | |||
| 1311 | Ga0157369_10051355 | |||
| 1312 | Ga0157369_10185201 | |||
| 1313 | Ga0157369_10206126 | |||
| 1314 | Ga0157369_10408276 | |||
| 1315 | Ga0157369_10553178 | |||
| 1316 | Ga0157369_10625956 | |||
| 1317 | Ga0157369_11024465 | |||
| 1318 | Ga0157369_11829796 | |||
| 1319 | Ga0157369_12068855 | |||
| 1320 | Ga0157374_10014270 | |||
| 1321 | Ga0157374_10056589 | |||
| 1322 | Ga0157374_10450090 | |||
| 1323 | Ga0157374_10514339 | |||
| 1324 | Ga0157374_10550737 | |||
| 1325 | Ga0157374_10559057 | |||
| 1326 | Ga0157374_10712432 | |||
| 1327 | Ga0157374_10804924 | |||
| 1328 | Ga0157374_10810098 | |||
| 1329 | Ga0157374_10832716 | |||
| 1330 | Ga0157374_11975479 | |||
| 1331 | Ga0157374_12159510 | |||
| 1332 | Ga0157378_10001093 | |||
| 1333 | Ga0157378_10241069 | |||
| 1334 | Ga0157378_10290511 | |||
| 1335 | Ga0157378_10371912 | |||
| 1336 | Ga0157378_10393930 | |||
| 1337 | Ga0157378_10483477 | |||
| 1338 | Ga0157378_10691014 | |||
| 1339 | Ga0157378_10855013 | |||
| 1340 | Ga0157378_10997818 | |||
| 1341 | Ga0157378_11030667 | |||
| 1342 | Ga0157378_11053761 | |||
| 1343 | Ga0163162_10008263 | |||
| 1344 | Ga0163162_10383608 | |||
| 1345 | Ga0163162_10496623 | |||
| 1346 | Ga0163162_11526492 | |||
| 1347 | Ga0163162_12090925 | |||
| 1348 | Ga0163162_12540278 | |||
| 1349 | Ga0163162_12770312 | |||
| 1350 | Ga0157372_10029710 | |||
| 1351 | Ga0157372_10030108 | |||
| 1352 | Ga0157372_10106871 | |||
| 1353 | Ga0157372_10208587 | |||
| 1354 | Ga0157372_10623603 | |||
| 1355 | Ga0157372_10644845 | |||
| 1356 | Ga0157372_11076531 | |||
| 1357 | Ga0157372_11134385 | |||
| 1358 | Ga0157372_11401257 | |||
| 1359 | Ga0157372_11880433 | |||
| 1360 | Ga0157372_11935945 | |||
| 1361 | Ga0157375_10003392 | |||
| 1362 | Ga0157375_10074026 | |||
| 1363 | Ga0157375_10140289 | |||
| 1364 | Ga0157375_10215893 | |||
| 1365 | Ga0157375_10342439 | |||
| 1366 | Ga0157375_10432326 | |||
| 1367 | Ga0157375_10820588 | |||
| 1368 | Ga0157375_11076288 | |||
| 1369 | Ga0157375_11376758 | |||
| 1370 | Ga0157375_12822568 | |||
| 1371 | Ga0157375_13783914 | |||
| 1372 | Ga0163163_10003045 | |||
| 1373 | Ga0163163_10109905 | |||
| 1374 | Ga0163163_10111840 | |||
| 1375 | Ga0163163_10135045 | |||
| 1376 | Ga0163163_10197774 | |||
| 1377 | Ga0163163_10240569 | |||
| 1378 | Ga0163163_10464194 | |||
| 1379 | Ga0163163_11602628 | |||
| 1380 | Ga0163163_12307833 | |||
| 1381 | Ga0163163_12745241 | |||
| 1382 | Ga0157379_10077140 | |||
| 1383 | Ga0157379_10176471 | |||
| 1384 | Ga0157379_10197427 | |||
| 1385 | Ga0157379_10199337 | |||
| 1386 | Ga0157379_10777423 | |||
| 1387 | Ga0157379_10897924 | |||
| 1388 | Ga0157379_11197653 | |||
| 1389 | Ga0157376_10054248 | |||
| 1390 | Ga0157376_10061634 | |||
| 1391 | Ga0157376_10069476 | |||
| 1392 | Ga0157376_10135915 | |||
| 1393 | Ga0157376_10488713 | |||
| 1394 | Ga0157376_10573715 | |||
| 1395 | Ga0157376_10822586 | |||
| 1396 | Ga0157376_11505976 | |||
| 1397 | Ga0157376_11867848 | |||
| 1398 | Ga0157376_13122756 | |||
| 1399 | Ga0163161_11291966 | |||
| 1400 | Ga0163161_11645213 | |||
| 1401 | Ga0206356_11032977 | |||
| 1402 | Ga0206349_1804240 | |||
| 1403 | Ga0206350_10234319 | |||
| 1404 | Ga0154015_1100450 | |||
| 1405 | Ga0224712_10156283 | |||
| 1406 | Ga0207656_10044812 | |||
| 1407 | Ga0207682_10324360 | |||
| 1408 | Ga0207692_10293299 | |||
| 1409 | Ga0207692_10706094 | |||
| 1410 | Ga0207692_10939265 | |||
| 1411 | Ga0207642_10278645 | |||
| 1412 | Ga0207642_11070350 | |||
| 1413 | Ga0207680_10826561 | |||
| 1414 | Ga0207647_10334083 | |||
| 1415 | Ga0207685_10223323 | |||
| 1416 | Ga0207699_10796653 | |||
| 1417 | Ga0207699_10858336 | |||
| 1418 | Ga0207645_10196382 | |||
| 1419 | Ga0207705_10049187 | |||
| 1420 | Ga0207705_10238140 | |||
| 1421 | Ga0207705_10354300 | |||
| 1422 | Ga0207654_10002640 | |||
| 1423 | Ga0207654_10024898 | |||
| 1424 | Ga0207654_10029661 | |||
| 1425 | Ga0207654_10103418 | |||
| 1426 | Ga0207654_10257471 | |||
| 1427 | Ga0207654_10554752 | |||
| 1428 | Ga0207654_10644594 | |||
| 1429 | Ga0207707_10001511 | |||
| 1430 | Ga0207707_10082370 | |||
| 1431 | Ga0207707_10094671 | |||
| 1432 | Ga0207707_10124742 | |||
| 1433 | Ga0207707_10148442 | |||
| 1434 | Ga0207707_10179975 | |||
| 1435 | Ga0207707_10264087 | |||
| 1436 | Ga0207707_10302070 | |||
| 1437 | Ga0207707_10443607 | |||
| 1438 | Ga0207695_10002528 | |||
| 1439 | Ga0207695_10014793 | |||
| 1440 | Ga0207695_10016736 | |||
| 1441 | Ga0207695_10043302 | |||
| 1442 | Ga0207695_10050274 | |||
| 1443 | Ga0207695_10064070 | |||
| 1444 | Ga0207695_10143336 | |||
| 1445 | Ga0207695_10144910 | |||
| 1446 | Ga0207695_10151597 | |||
| 1447 | Ga0207695_10155416 | |||
| 1448 | Ga0207695_10361298 | |||
| 1449 | Ga0207695_10814155 | |||
| 1450 | Ga0207671_10013307 | |||
| 1451 | Ga0207671_10058791 | |||
| 1452 | Ga0207671_10066491 | |||
| 1453 | Ga0207671_10100774 | |||
| 1454 | Ga0207671_10139886 | |||
| 1455 | Ga0207671_10169708 | |||
| 1456 | Ga0207671_10183559 | |||
| 1457 | Ga0207671_10208334 | |||
| 1458 | Ga0207671_10326786 | |||
| 1459 | Ga0207693_10198393 | |||
| 1460 | Ga0207663_10184463 | |||
| 1461 | Ga0207663_10208080 | |||
| 1462 | Ga0207663_10788178 | |||
| 1463 | Ga0207663_11265743 | |||
| 1464 | Ga0207663_11390141 | |||
| 1465 | Ga0207663_11444654 | |||
| 1466 | Ga0207663_11543054 | |||
| 1467 | Ga0207660_10018676 | |||
| 1468 | Ga0207660_10202807 | |||
| 1469 | Ga0207660_10381622 | |||
| 1470 | Ga0207662_11307045 | |||
| 1471 | Ga0207657_10003464 | |||
| 1472 | Ga0207657_10050108 | |||
| 1473 | Ga0207657_10774792 | |||
| 1474 | Ga0207649_10073612 | |||
| 1475 | Ga0207649_10247349 | |||
| 1476 | Ga0207652_10000983 | |||
| 1477 | Ga0207652_10108601 | |||
| 1478 | Ga0207652_10110809 | |||
| 1479 | Ga0207652_10362213 | |||
| 1480 | Ga0207652_10407308 | |||
| 1481 | Ga0207652_10710656 | |||
| 1482 | Ga0207652_11217165 | |||
| 1483 | Ga0207681_10153810 | |||
| 1484 | Ga0207681_10714008 | |||
| 1485 | Ga0207681_11605889 | |||
| 1486 | Ga0207694_10002685 | |||
| 1487 | Ga0207694_10005168 | |||
| 1488 | Ga0207694_10019172 | |||
| 1489 | Ga0207694_10072845 | |||
| 1490 | Ga0207694_10073556 | |||
| 1491 | Ga0207694_10083636 | |||
| 1492 | Ga0207694_10149439 | |||
| 1493 | Ga0207694_10195426 | |||
| 1494 | Ga0207694_10341351 | |||
| 1495 | Ga0207694_10372660 | |||
| 1496 | Ga0207694_10670737 | |||
| 1497 | Ga0207694_11063335 | |||
| 1498 | Ga0207659_10503371 | |||
| 1499 | Ga0207687_10004646 | |||
| 1500 | Ga0207687_10015748 | |||
| 1501 | Ga0207687_10032503 | |||
| 1502 | Ga0207687_10038980 | |||
| 1503 | Ga0207687_10171213 | |||
| 1504 | Ga0207687_10713625 | |||
| 1505 | Ga0207687_11439199 | |||
| 1506 | Ga0207687_11451760 | |||
| 1507 | Ga0207700_10007324 | |||
| 1508 | Ga0207700_10027830 | |||
| 1509 | Ga0207700_10084363 | |||
| 1510 | Ga0207700_10138906 | |||
| 1511 | Ga0207700_10148670 | |||
| 1512 | Ga0207700_11291435 | |||
| 1513 | Ga0207664_10005134 | |||
| 1514 | Ga0207664_10167013 | |||
| 1515 | Ga0207664_10795893 | |||
| 1516 | Ga0207644_10008746 | |||
| 1517 | Ga0207644_10044730 | |||
| 1518 | Ga0207644_11856811 | |||
| 1519 | Ga0207690_10054855 | |||
| 1520 | Ga0207690_10352735 | |||
| 1521 | Ga0207706_10045045 | |||
| 1522 | Ga0207686_10005864 | |||
| 1523 | Ga0207686_10022513 | |||
| 1524 | Ga0207686_10117536 | |||
| 1525 | Ga0207686_10440736 | |||
| 1526 | Ga0207686_10698986 | |||
| 1527 | Ga0207686_11532620 | |||
| 1528 | Ga0207709_10017010 | |||
| 1529 | Ga0207709_10053564 | |||
| 1530 | Ga0207709_10312969 | |||
| 1531 | Ga0207709_10476490 | |||
| 1532 | Ga0207709_10498048 | |||
| 1533 | Ga0207709_10735208 | |||
| 1534 | Ga0207709_11466558 | |||
| 1535 | Ga0207670_10079246 | |||
| 1536 | Ga0207670_10318720 | |||
| 1537 | Ga0207670_10481885 | |||
| 1538 | Ga0207670_11563298 | |||
| 1539 | Ga0207704_10028450 | |||
| 1540 | Ga0207704_10109305 | |||
| 1541 | Ga0207691_10766845 | |||
| 1542 | Ga0207691_10847278 | |||
| 1543 | Ga0207691_10989517 | |||
| 1544 | Ga0207711_10002782 | |||
| 1545 | Ga0207711_10038016 | |||
| 1546 | Ga0207711_10123006 | |||
| 1547 | Ga0207711_10226705 | |||
| 1548 | Ga0207711_10322054 | |||
| 1549 | Ga0207711_10332991 | |||
| 1550 | Ga0207711_10716513 | |||
| 1551 | Ga0207711_10796029 | |||
| 1552 | Ga0207689_10023190 | |||
| 1553 | Ga0207689_10062184 | |||
| 1554 | Ga0207689_10140566 | |||
| 1555 | Ga0207689_11082131 | |||
| 1556 | Ga0207661_10000055 | |||
| 1557 | Ga0207661_10002740 | |||
| 1558 | Ga0207661_10004091 | |||
| 1559 | Ga0207661_10036594 | |||
| 1560 | Ga0207661_10094248 | |||
| 1561 | Ga0207661_10377628 | |||
| 1562 | Ga0207661_10971156 | |||
| 1563 | Ga0207679_10030945 | |||
| 1564 | Ga0207679_10081631 | |||
| 1565 | Ga0207667_10006134 | |||
| 1566 | Ga0207667_10017139 | |||
| 1567 | Ga0207667_10021796 | |||
| 1568 | Ga0207667_10029192 | |||
| 1569 | Ga0207667_10036620 | |||
| 1570 | Ga0207667_10056911 | |||
| 1571 | Ga0207667_10084552 | |||
| 1572 | Ga0207667_10108938 | |||
| 1573 | Ga0207667_10147698 | |||
| 1574 | Ga0207667_10151066 | |||
| 1575 | Ga0207667_10243357 | |||
| 1576 | Ga0207667_10923555 | |||
| 1577 | Ga0207667_11068127 | |||
| 1578 | Ga0207667_11121936 | |||
| 1579 | Ga0207651_10621462 | |||
| 1580 | Ga0207651_11590169 | |||
| 1581 | Ga0207712_10024559 | |||
| 1582 | Ga0207712_10855375 | |||
| 1583 | Ga0207668_10894344 | |||
| 1584 | Ga0207640_10231556 | |||
| 1585 | Ga0207640_10484641 | |||
| 1586 | Ga0207640_11050723 | |||
| 1587 | Ga0207640_11324456 | |||
| 1588 | Ga0207658_10025037 | |||
| 1589 | Ga0207658_10605257 | |||
| 1590 | Ga0207658_10752892 | |||
| 1591 | Ga0207658_11021505 | |||
| 1592 | Ga0207677_10018256 | |||
| 1593 | Ga0207677_10268547 | |||
| 1594 | Ga0207677_10432169 | |||
| 1595 | Ga0207677_10467293 | |||
| 1596 | Ga0207677_11724244 | |||
| 1597 | Ga0207703_10021152 | |||
| 1598 | Ga0207703_10023856 | |||
| 1599 | Ga0207703_10074746 | |||
| 1600 | Ga0207703_10279538 | |||
| 1601 | Ga0207703_10351358 | |||
| 1602 | Ga0207703_11624350 | |||
| 1603 | Ga0207639_10061766 | |||
| 1604 | Ga0207639_10065842 | |||
| 1605 | Ga0207639_10233690 | |||
| 1606 | Ga0207639_10303531 | |||
| 1607 | Ga0207639_11590777 | |||
| 1608 | Ga0207678_10040724 | |||
| 1609 | Ga0207678_10180473 | |||
| 1610 | Ga0207708_11233737 | |||
| 1611 | Ga0207702_10014293 | |||
| 1612 | Ga0207702_10024228 | |||
| 1613 | Ga0207702_10028834 | |||
| 1614 | Ga0207702_10114664 | |||
| 1615 | Ga0207702_10151013 | |||
| 1616 | Ga0207702_10159140 | |||
| 1617 | Ga0207702_11105201 | |||
| 1618 | Ga0207702_11537413 | |||
| 1619 | Ga0207702_11599206 | |||
| 1620 | Ga0207641_10046718 | |||
| 1621 | Ga0207641_10566758 | |||
| 1622 | Ga0207641_11185271 | |||
| 1623 | Ga0207641_11563325 | |||
| 1624 | Ga0207641_11739057 | |||
| 1625 | Ga0207648_10023517 | |||
| 1626 | Ga0207648_10035880 | |||
| 1627 | Ga0207648_10081606 | |||
| 1628 | Ga0207648_10950384 | |||
| 1629 | Ga0207676_10098448 | |||
| 1630 | Ga0207676_10159296 | |||
| 1631 | Ga0207676_10296344 | |||
| 1632 | Ga0207676_11360607 | |||
| 1633 | Ga0207676_11847345 | |||
| 1634 | Ga0207674_10000085 | |||
| 1635 | Ga0207674_10000823 | |||
| 1636 | Ga0207674_10002265 | |||
| 1637 | Ga0207674_10017334 | |||
| 1638 | Ga0207674_10028755 | |||
| 1639 | Ga0207674_10692529 | |||
| 1640 | Ga0207674_10813509 | |||
| 1641 | Ga0207675_101062531 | |||
| 1642 | Ga0207675_102616727 | |||
| 1643 | Ga0207683_10201595 | |||
| 1644 | Ga0207683_10912273 | |||
| 1645 | Ga0207698_10008916 | |||
| 1646 | Ga0207698_10014959 | |||
| 1647 | Ga0207698_10057037 | |||
| 1648 | Ga0207698_10061943 | |||
| 1649 | Ga0207698_10128525 | |||
| 1650 | Ga0207698_10743267 | |||
| 1651 | Ga0207698_10900964 | |||
| 1652 | Ga0207698_11042800 | |||
| 1653 | Ga0268266_10322329 | |||
| 1654 | Ga0268266_10588028 | |||
| 1655 | Ga0268266_11442092 | |||
| 1656 | Ga0268264_10403333 | |||
| 1657 | Ga0265338_10125255 | |||
| 1658 | Ga0265338_10271020 | |||
| 1659 | Ga0265338_10433275 | |||
| 1660 | Ga0265332_10094999 | |||
| 1661 | Ga0265325_10445676 | |||
| 1662 | Ga0265340_10037237 | |||
| 1663 | Ga0265316_10954647 | |||
| 1664 | Ga0265313_10001123 | |||
| 1665 | Ga0265314_10010658 | |||
| 1666 | Ga0265314_10717267 | |||
| 1667 | Ga0265342_10290768 | |||
| 1668 | Ga0265342_10316259 | |||
| 1669 | Ga0307510_10019662 | |||
| 1670 | Ga0373926_0104695 | |||
| 1671 | Ga0373934_0001519 | |||
| 1672 | Ga0373934_0046314 | |||
| 1673 | Ga0373934_0151424 | |||
| 1674 | Ga0373940_0232819 | |||
| 1675 | Ga0373944_0296790 | |||
| 1676 | Ga0373923_0065100 | |||
| 1677 | Ga0373936_0017924 | |||
| 1678 | Ga0373936_0041205 | |||
| 1679 | Ga0373936_0075212 | |||
| 1680 | Ga0373936_0623547 | |||
| 1681 | Ga0373945_0170327 | |||
| 1682 | Ga0373953_0053170 | |||
| 1683 | Ga0373953_0065731 | |||
| 1684 | Ga0373953_0265421 | |||
| 1685 | Ga0373954_0008113 | |||
| 1686 | Ga0373954_0011247 | |||
| 1687 | Ga0373954_0029120 | |||
| 1688 | Ga0373954_0137519 | |||
| 1689 | Ga0373954_0349709 | |||
| 1690 | Ga0373954_0407536 | |||
| 1691 | Ga0373956_0063359 | |||
| 1692 | Ga0373956_0099793 | |||
| 1693 | Ga0373956_0173784 | |||
| 1694 | Ga0373956_0255998 | |||
| 1695 | Ga0373957_0087349 | |||
| 1696 | Ga0373957_0253023 | |||
| 1697 | Ga0373943_0045750 | |||
| 1698 | Ga0373943_0234110 | |||
| 1699 | Ga0373943_0520727 | |||
| 1700 | Ga0373943_0642672 | |||
| 1701 | Ga0373943_0948597 | |||
| 1702 | Ga0373946_0570464 | |||
| 1703 | Ga0373955_0014927 | |||
| 1704 | Ga0373955_0027920 | |||
| 1705 | Ga0373955_0419396 | |||
| 1706 | Ga0373955_0520502 | |||
| 1707 | Ga0373955_0848833 | |||
| 1708 | Ga0373924_0066045 | |||
| 1709 | Ga0373931_1030058 | |||
| 1710 | Ga0373935_0005931 | |||
| 1711 | Ga0373935_0085104 | |||
| 1712 | Ga0373935_0286698 | |||
| 1713 | Ga0373935_0488477 | |||
| 1714 | Ga0373927_0002869 | |||
| 1715 | Ga0373927_0110629 | |||
| 1716 | Ga0373927_0133532 | |||
| 1717 | Ga0373927_0190741 | |||
| 1718 | Ga0373927_0401938 | |||
| 1719 | Ga0373933_0097460 | |||
| 1720 | Ga0373933_0219684 | |||
| 1721 | Ga0373933_0386010 | |||
| 1722 | Ga0373933_0820898 | |||
| 1723 | Ga0373933_0864756 | |||
| 1724 | Ga0373947_0005144 | |||
| 1725 | Ga0373947_0097692 | |||
| 1726 | Ga0373947_0961541 | |||
| 1727 | Ga0373947_0988185 | |||
| 1728 | Ga0373937_0003452 | |||
| 1729 | Ga0373937_0007081 | |||
| 1730 | Ga0373937_0083043 | |||
| 1731 | Ga0373937_0091494 | |||
| 1732 | Ga0373937_0137588 | |||
| 1733 | Ga0373937_0227707 | |||
| 1734 | Ga0373937_0263554 | |||
| 1735 | Ga0373937_0559774 | |||
| 1736 | Ga0373937_0725387 | |||
| 1737 | Ga0373937_0867289 | |||
| 1738 | Ga0373937_1374531 | |||
| 1739 | Ga0373925_0008278 | |||
| 1740 | Ga0373925_0258163 | |||
| 1741 | Ga0373925_0405939 | |||
| 1742 | Ga0373925_0506571 | |||
| 1743 | Ga0373925_1307825 | |||
| 1744 | Ga0395900_0036412 | |||
| 1745 | Ga0395900_0446244 | |||
| 1746 | Ga0395898_0588926 | |||
| 1747 | Ga0395898_0753667 | |||
| 1748 | Ga0395905_0473414 | |||
| 1749 | Ga0436364_0310100 | |||
| 1750 | Ga0436364_0413027 | |||
| 1751 | Ga0436364_1401413 | |||
| 1752 | Ga0395901_0978418 | |||
| 1753 | Ga0436365_0660380 | |||
| 1754 | Ga0436362_1079586 | |||
| 1755 | Ga0439448_0053415 | |||
| 1756 | Ga0451577_0356577 | |||
| 1757 | Ga0451577_0448452 | |||
| 1758 | Ga0451577_0504041 | |||
| 1759 | Ga0451577_0899110 | |||
| 1760 | Ga0451577_1062343 | |||
| 1761 | Ga0451577_1073866 | |||
| 1762 | Ga0453683_0931478 | |||
| 1763 | Ga0451576_0153840 | |||
| 1764 | Ga0451576_0461342 | |||
| 1765 | Ga0451576_0493739 | |||
| 1766 | Ga0451576_0708320 | |||
| 1767 | Ga0451576_2488695 | |||
| 1768 | Ga0495592_0108247 | |||
| 1769 | Ga0495651_0666620 | |||
| 1770 | Ga0495580_0001305 | |||
| 1771 | Ga0495580_0071830 | |||
| 1772 | Ga0495580_0297936 | |||
| 1773 | Ga0495580_0431620 | |||
| 1774 | Ga0495580_0750249 | |||
| 1775 | Ga0495582_0016592 | |||
| 1776 | Ga0495582_0598759 | |||
| 1777 | Ga0495639_0038222 | |||
| 1778 | Ga0495664_0153463 | |||
| 1779 | Ga0495664_0249314 | |||
| 1780 | Ga0495664_0292577 | |||
| 1781 | Ga0495594_0157174 | |||
| 1782 | Ga0495594_0448876 | |||
| 1783 | Ga0495608_0487468 | |||
| 1784 | Ga0495628_1118916 | |||
| 1785 | Ga0495630_0455903 | |||
| 1786 | Ga0495666_0094782 | |||
| 1787 | Ga0495666_0125338 | |||
| 1788 | Ga0495652_0196665 | |||
| 1789 | Ga0495652_0292768 | |||
| 1790 | Ga0495652_0416694 | |||
| 1791 | Ga0495652_0794918 | |||
| 1792 | Ga0495665_0012672 | |||
| 1793 | Ga0495665_0051842 | |||
| 1794 | Ga0495665_0119415 | |||
| 1795 | Ga0495665_0281190 | |||
| 1796 | Ga0495586_0070417 | |||
| 1797 | Ga0495586_0812777 | |||
| 1798 | Ga0495587_0000764 | |||
| 1799 | Ga0495645_0590756 | |||
| 1800 | Ga0495645_0710319 | |||
| 1801 | Ga0495645_0714980 | |||
| 1802 | Ga0495667_0242472 | |||
| 1803 | Ga0495667_0272823 | |||
| 1804 | Ga0495635_0129595 | |||
| 1805 | Ga0495635_0422612 | |||
| 1806 | Ga0495635_0459842 | |||
| 1807 | Ga0495635_0560902 | |||
| 1808 | Ga0495599_0296564 | |||
| 1809 | Ga0495599_0430791 | |||
| 1810 | Ga0495623_0376090 | |||
| 1811 | Ga0495658_0040510 | |||
| 1812 | Ga0495658_0050566 | |||
| 1813 | Ga0495613_0793617 | |||
| 1814 | Ga0495600_0142625 | |||
| 1815 | Ga0495581_0358057 | |||
| 1816 | Ga0495636_0035782 | |||
| 1817 | Ga0495674_0032221 | |||
| 1818 | Ga0495674_0164665 | |||
| 1819 | Ga0495674_0308587 | |||
| 1820 | Ga0495674_0979795 | |||
| 1821 | Ga0495674_1350833 | |||
| 1822 | Ga0495680_0389932 | |||
| 1823 | Ga0495680_0438351 | |||
| 1824 | Ga0495680_0771755 | |||
| 1825 | Ga0495675_0107191 | |||
| 1826 | Ga0495675_0229124 | |||
| 1827 | Ga0495684_0014155 | |||
| 1828 | Ga0495684_0127277 | |||
| 1829 | Ga0495684_0202188 | |||
| 1830 | Ga0495684_0280936 | |||
| 1831 | Ga0495684_0290139 | |||
| 1832 | Ga0495684_0656412 | |||
| 1833 | Ga0495602_0000355 | |||
| 1834 | Ga0495602_0528351 | |||
| 1835 | Ga0495602_0789916 | |||
| 1836 | Ga0496101_1478250 | |||
| 1837 | Ga0496102_0352634 | |||
| 1838 | Ga0496102_0962131 | |||
| 1839 | Ga0496104_0553036 | |||
| 1840 | Ga0496104_1066009 | |||
| 1841 | Ga0496104_1268018 | |||
| 1842 | Ga0496105_0556075 | |||
| 1843 | Ga0496106_0399734 | |||
| 1844 | Ga0496110_0276950 | |||
| 1845 | Ga0496112_1621103 | |||
| 1846 | Ga0496115_0298998 | |||
| 1847 | Ga0496115_0364873 | |||
| 1848 | Ga0501037_0151259 | |||
| 1849 | Ga0501038_0764720 | |||
| 1850 | Ga0501043_1300640 | |||
| 1851 | Ga0501047_0054636 | |||
| 1852 | Ga0501070_0042363 | |||
| 1853 | Ga0501035_0069227 | |||
| 1854 | Ga0501044_0034903 | |||
| 1855 | Ga0501044_0442462 | |||
| 1856 | nmdc:mga05p37_373991_c1 | |||
| 1857 | nmdc:mga06r32_1077259_c1 | |||
| 1858 | nmdc:mga0n895_275818_c1 | |||
| 1859 | nmdc:mga0rr50_655170_c1 | |||
| 1860 | nmdc:mga08x19_2973_c1 | |||
| 1861 | Ga0495601_0209827 | |||
| 1862 | Ga0495612_0256681 | |||
| 1863 | Ga0495595_0463770 | |||
| 1864 | Ga0495619_0175567 | |||
| 1865 | Ga0495619_0256470 | |||
| 1866 | Ga0501082_0000151 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5msg-assembly1.cif.gz_B | influenza b polymerase bound to vrna promoter and capped rna primer | 0.6322 | 7 | 39 |
| 7dbi-assembly1.cif.gz_A | crystal structure of the peroxisomal acyl-coa hydrolase mpah | 0.5896 | 5 | 43 |
| 7dbl-assembly2.cif.gz_C | acyl-coa hydrolase mpah' mutant s139a in complex with mpa | 0.5573 | 5 | 47 |
| 8fuv-assembly1.cif.gz_F | pseudomonas phage e217 extended sheath and tail tube | 0.5404 | 9 | 47 |
| 7dbl-assembly2.cif.gz_D | acyl-coa hydrolase mpah' mutant s139a in complex with mpa | 0.5395 | 7 | 46 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MV31_210_358_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.7262 | 5 | 39 | 2.120.10.80 |
| af_P75867_326_566_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.6515 | 7 | 35 | 3.30.230.10 |
| 3n2zB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.6361 | 8 | 38 | 3.40.50.1820 |
| af_P47912_40_551_3.40.50.12780 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.6357 | 9 | 39 | 3.40.50.12780 |
| 6d04A01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.6076 | 3 | 36 | 3.40.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2VEJ9-F1-model_v4 | Uncharacterized protein | 0.9718 | 1 | 90 |
|
| AF-A0A7W7ZTC8-F1-model_v4 | Uncharacterized protein | 0.9675 | 1 | 90 |
|
| AF-A0A1F2VEJ9-F1-model_v4 | Uncharacterized protein | 0.9614 | 1 | 90 |
|
| AF-A0A1Q7K0I8-F1-model_v4 | Uncharacterized protein | 0.9604 | 1 | 90 |
|
| AF-A0A7W7ZTC8-F1-model_v4 | Uncharacterized protein | 0.9571 | 1 | 90 |
|