F485647
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 917 | 374 | 1834 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300046530|Ga0495654_0029812|Ga0495654_0029812_87_1094 |
| Length | 330 |
| Sequence | MFLLLNGCASVSYYSQLASGQLQLLNARVPVSQVIADPASDAKLRAHLEQSQRARDFASQHLHLPDNQSYRLYADIGRSYVVWNVFVTPEFSLRPQNYCFPIAGCVAYRGYYQQGAARGEAALQRQQGMDVAIGGVEAYSTLGWFDDPIMNSMERLATLIFHELAHQRLYVKDDTEFNESFASFVEQEGTRQWRAARNLPALNDAQERQRDQFIQLLLDTRARLEKLYALPLASDEMRRRKAAEFTRLRADYQTLRDSQWAGSRRFDAWIDAPMNNARLLPFGLYDQWVPAFAELFRQAGGDWQKFYLAAERVGALAPAQRKRALMSLDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 27 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 28 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 29 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 30 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 31 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 32 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 48 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 50 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 53 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 87 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 88 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 89 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 90 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 91 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 92 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 93 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 94 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 95 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 96 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 97 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 98 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 99 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 100 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 101 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 102 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 103 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 104 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 105 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 106 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 107 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 108 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 109 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 110 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 111 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 112 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 113 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 114 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 115 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 116 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 117 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 118 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 119 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 120 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 121 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 122 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 123 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 124 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 125 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 126 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 127 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 128 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 129 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 130 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 131 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 132 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 133 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 134 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 135 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 136 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 137 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 226 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 227 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 228 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 229 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 230 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 231 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 232 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 233 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 234 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 235 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 236 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 239 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 240 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 241 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 242 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 244 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 245 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 246 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 247 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 248 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 249 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 250 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 251 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 252 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 253 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 254 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 255 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 256 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 257 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 258 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 259 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 260 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 261 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 262 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 263 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 264 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 265 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 266 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 267 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 268 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 269 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 270 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 271 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 272 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 273 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 274 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 275 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 276 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 277 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 278 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 279 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 280 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 281 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 282 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 283 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 284 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 285 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 286 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 287 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 288 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 289 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 290 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 291 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 292 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 293 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 294 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 295 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 296 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 297 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 298 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 299 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 300 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 301 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 302 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 303 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 304 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 305 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 306 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 307 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 308 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 309 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 310 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 311 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 312 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 313 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 314 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 315 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 316 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 317 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 318 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 319 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 320 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 321 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 322 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 323 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 324 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 325 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 326 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 327 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 328 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 329 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 330 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 331 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 332 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 333 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 334 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 335 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 336 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 337 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 338 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 339 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 340 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 341 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 342 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 343 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 344 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 345 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 346 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 347 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 348 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 349 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 350 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 351 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 352 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 353 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 354 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 355 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 356 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 357 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 358 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 359 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 360 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 361 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 362 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 363 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 364 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 365 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 366 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 367 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 368 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 369 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 370 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 371 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 372 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 373 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 374 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.71 |
| Metatranscriptomes | 0 |
| Isolates | 14.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.56 |
| Nodule | 1.96 |
| Rhizoplane | 3.82 |
| Rhizosphere | 78.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495654_0029812 | 3300046530 | Bacteria | 2781 |
| 2 | MRS2a_Contig_126 | 2124908027 | Bacteria | 13711 |
| 3 | JGI25162J39368_1000185 | 3300002737 | Bacteria | 66040 |
| 4 | JGI25162J39368_1000219 | 3300002737 | Bacteria | 59530 |
| 5 | JGI25163J39215_1000823 | 3300002771 | Bacteria | 7445 |
| 6 | JGI25163J39215_1000834 | 3300002771 | Bacteria | 7381 |
| 7 | JGI25164J39214_1000175 | 3300002772 | Bacteria | 59290 |
| 8 | JGI25165J46597_1000175 | 3300003214 | Bacteria | 100117 |
| 9 | JGI25165J46597_1000193 | 3300003214 | Bacteria | 91069 |
| 10 | Ga0055538_1000012 | 3300003751 | Bacteria | 353826 |
| 11 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 12 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 13 | Ga0055532_1000020 | 3300003758 | Bacteria | 270853 |
| 14 | Ga0055525_1000117 | 3300003759 | Bacteria | 120690 |
| 15 | Ga0055535_1002840 | 3300003761 | Bacteria | 5460 |
| 16 | Ga0055536_1000237 | 3300003781 | Bacteria | 44418 |
| 17 | Ga0055536_1000241 | 3300003781 | Bacteria | 43710 |
| 18 | Ga0055530_10000159 | 3300003791 | Bacteria | 61131 |
| 19 | Ga0055540_1000378 | 3300003792 | Bacteria | 37178 |
| 20 | Ga0055540_1000725 | 3300003792 | Bacteria | 22486 |
| 21 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 22 | Ga0065714_10000191 | 3300005288 | Bacteria | 7706 |
| 23 | Ga0065714_10005418 | 3300005288 | Bacteria | 4972 |
| 24 | Ga0065714_10066629 | 3300005288 | Bacteria | 6538 |
| 25 | Ga0065714_10082121 | 3300005288 | Bacteria | 2329 |
| 26 | Ga0065714_10127279 | 3300005288 | Bacteria | 1283 |
| 27 | Ga0065704_10167645 | 3300005289 | Bacteria | 1312 |
| 28 | Ga0070670_100000258 | 3300005331 | Bacteria | 47306 |
| 29 | Ga0070670_100001386 | 3300005331 | Bacteria | 19431 |
| 30 | Ga0070661_100000146 | 3300005344 | Bacteria | 58043 |
| 31 | Ga0070669_100000153 | 3300005353 | Bacteria | 62355 |
| 32 | Ga0070662_100005956 | 3300005457 | Bacteria | 7819 |
| 33 | Ga0070662_100064104 | 3300005457 | Bacteria | 2690 |
| 34 | Ga0068853_100000184 | 3300005539 | Bacteria | 43882 |
| 35 | Ga0070665_100037664 | 3300005548 | Bacteria | 4862 |
| 36 | Ga0070664_100000049 | 3300005564 | Bacteria | 71805 |
| 37 | Ga0070664_100060694 | 3300005564 | Bacteria | 3220 |
| 38 | Ga0068851_10000018 | 3300005834 | Bacteria | 137425 |
| 39 | Ga0075364_10087404 | 3300006051 | Bacteria | 2066 |
| 40 | Ga0075432_10012519 | 3300006058 | Bacteria | 2881 |
| 41 | Ga0075432_10062015 | 3300006058 | Bacteria | 1332 |
| 42 | Ga0075362_10098534 | 3300006177 | Bacteria | 1364 |
| 43 | Ga0075436_100042695 | 3300006914 | Bacteria | 3127 |
| 44 | Ga0079104_1000735 | 3300006946 | Bacteria | 28887 |
| 45 | Ga0105251_10001924 | 3300009011 | Bacteria | 17001 |
| 46 | Ga0105251_10006951 | 3300009011 | Bacteria | 7086 |
| 47 | Ga0105251_10014141 | 3300009011 | Bacteria | 4429 |
| 48 | Ga0105244_10000186 | 3300009036 | Bacteria | 63278 |
| 49 | Ga0105244_10001003 | 3300009036 | Bacteria | 23674 |
| 50 | Ga0105244_10007387 | 3300009036 | Bacteria | 6985 |
| 51 | Ga0105244_10009695 | 3300009036 | Bacteria | 5893 |
| 52 | Ga0105244_10128377 | 3300009036 | Bacteria | 1224 |
| 53 | Ga0105250_10015261 | 3300009092 | Bacteria | 3147 |
| 54 | Ga0105250_10018871 | 3300009092 | Bacteria | 2789 |
| 55 | Ga0105250_10031667 | 3300009092 | Bacteria | 2123 |
| 56 | Ga0105243_10000075 | 3300009148 | Bacteria | 112098 |
| 57 | Ga0105243_10000862 | 3300009148 | Bacteria | 28702 |
| 58 | Ga0105243_10008056 | 3300009148 | Bacteria | 8089 |
| 59 | Ga0105243_10020990 | 3300009148 | Bacteria | 4956 |
| 60 | Ga0105243_10144963 | 3300009148 | Bacteria | 2031 |
| 61 | Ga0105242_10001632 | 3300009176 | Bacteria | 17700 |
| 62 | Ga0105242_10005717 | 3300009176 | Bacteria | 9591 |
| 63 | Ga0105248_10002239 | 3300009177 | Bacteria | 21390 |
| 64 | Ga0105237_10002463 | 3300009545 | Bacteria | 22970 |
| 65 | Ga0105249_10010831 | 3300009553 | Bacteria | 8014 |
| 66 | Ga0105246_10000958 | 3300011119 | Bacteria | 16516 |
| 67 | Ga0105246_10003117 | 3300011119 | Bacteria | 10068 |
| 68 | Ga0105246_10009773 | 3300011119 | Bacteria | 5913 |
| 69 | Ga0157345_1000542 | 3300012498 | Bacteria | 3390 |
| 70 | Ga0157373_10008757 | 3300013100 | Bacteria | 7499 |
| 71 | Ga0157373_10013063 | 3300013100 | Bacteria | 6093 |
| 72 | Ga0157373_10018433 | 3300013100 | Bacteria | 5082 |
| 73 | Ga0157373_10028306 | 3300013100 | Bacteria | 4042 |
| 74 | Ga0157373_10029749 | 3300013100 | Bacteria | 3932 |
| 75 | Ga0157373_10031891 | 3300013100 | Bacteria | 3795 |
| 76 | Ga0157371_10001263 | 3300013102 | Bacteria | 26673 |
| 77 | Ga0157371_10012076 | 3300013102 | Bacteria | 6619 |
| 78 | Ga0157371_10061080 | 3300013102 | Bacteria | 2672 |
| 79 | Ga0157370_10019275 | 3300013104 | Bacteria | 6849 |
| 80 | Ga0157370_10111586 | 3300013104 | Bacteria | 2556 |
| 81 | Ga0157369_10018609 | 3300013105 | Bacteria | 7786 |
| 82 | Ga0157369_10059449 | 3300013105 | Bacteria | 4121 |
| 83 | Ga0157369_10134462 | 3300013105 | Bacteria | 2618 |
| 84 | Ga0157369_10137913 | 3300013105 | Bacteria | 2582 |
| 85 | Ga0157369_10380808 | 3300013105 | Bacteria | 1464 |
| 86 | Ga0157375_10013471 | 3300013308 | Bacteria | 7280 |
| 87 | Ga0157375_10019265 | 3300013308 | Bacteria | 6203 |
| 88 | Ga0182008_10000367 | 3300014497 | Bacteria | 35146 |
| 89 | Ga0182008_10004974 | 3300014497 | Bacteria | 7653 |
| 90 | Ga0182008_10008487 | 3300014497 | Bacteria | 5610 |
| 91 | Ga0182008_10019285 | 3300014497 | Bacteria | 3522 |
| 92 | Ga0182008_10025932 | 3300014497 | Bacteria | 2974 |
| 93 | Ga0182006_1000961 | 3300015261 | Bacteria | 19104 |
| 94 | Ga0182006_1005096 | 3300015261 | Bacteria | 6317 |
| 95 | Ga0182007_10000742 | 3300015262 | Bacteria | 18459 |
| 96 | Ga0182005_1000885 | 3300015265 | Bacteria | 13177 |
| 97 | Ga0163161_10007642 | 3300017792 | Bacteria | 7477 |
| 98 | Ga0163161_10019012 | 3300017792 | Bacteria | 4816 |
| 99 | Ga0163161_10020244 | 3300017792 | Bacteria | 4668 |
| 100 | Ga0163161_10037102 | 3300017792 | Bacteria | 3493 |
| 101 | Ga0163161_10039705 | 3300017792 | Bacteria | 3380 |
| 102 | Ga0163161_10047063 | 3300017792 | Bacteria | 3114 |
| 103 | Ga0163161_10274463 | 3300017792 | Bacteria | 1320 |
| 104 | Ga0209435_101384 | 3300025206 | Bacteria | 3107 |
| 105 | Ga0209760_100020 | 3300025207 | Bacteria | 169879 |
| 106 | Ga0209760_100082 | 3300025207 | Bacteria | 76168 |
| 107 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 108 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 109 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 110 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 111 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 112 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 113 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 114 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 115 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 116 | Ga0209258_100237 | 3300025242 | Bacteria | 102220 |
| 117 | Ga0209646_1000442 | 3300025246 | Bacteria | 22332 |
| 118 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 119 | Ga0209759_1006997 | 3300025256 | Bacteria | 3700 |
| 120 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 121 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 122 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 123 | Ga0209676_1000157 | 3300025292 | Bacteria | 163094 |
| 124 | Ga0209676_1000222 | 3300025292 | Bacteria | 124695 |
| 125 | Ga0209676_1003038 | 3300025292 | Bacteria | 10850 |
| 126 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 127 | Ga0209050_1000296 | 3300025298 | Bacteria | 104732 |
| 128 | Ga0209050_1001068 | 3300025298 | Bacteria | 33633 |
| 129 | Ga0209051_1000143 | 3300025303 | Bacteria | 135182 |
| 130 | Ga0209051_1000295 | 3300025303 | Bacteria | 79621 |
| 131 | Ga0209257_1000422 | 3300025304 | Bacteria | 81630 |
| 132 | Ga0207656_10000009 | 3300025321 | Bacteria | 245637 |
| 133 | Ga0207696_1000165 | 3300025711 | Bacteria | 104683 |
| 134 | Ga0207696_1003213 | 3300025711 | Bacteria | 7547 |
| 135 | Ga0207655_1000135 | 3300025728 | Bacteria | 143597 |
| 136 | Ga0207655_1000652 | 3300025728 | Bacteria | 41403 |
| 137 | Ga0207655_1000961 | 3300025728 | Bacteria | 29731 |
| 138 | Ga0207655_1006175 | 3300025728 | Bacteria | 7985 |
| 139 | Ga0207655_1006536 | 3300025728 | Bacteria | 7704 |
| 140 | Ga0207655_1011532 | 3300025728 | Bacteria | 5254 |
| 141 | Ga0207655_1023395 | 3300025728 | Bacteria | 3066 |
| 142 | Ga0207713_1000692 | 3300025735 | Bacteria | 31614 |
| 143 | Ga0207713_1001400 | 3300025735 | Bacteria | 19498 |
| 144 | Ga0207713_1001900 | 3300025735 | Bacteria | 15835 |
| 145 | Ga0207713_1002728 | 3300025735 | Bacteria | 12593 |
| 146 | Ga0207713_1003858 | 3300025735 | Bacteria | 10005 |
| 147 | Ga0207713_1004885 | 3300025735 | Bacteria | 8583 |
| 148 | Ga0207713_1007816 | 3300025735 | Bacteria | 6237 |
| 149 | Ga0207713_1014386 | 3300025735 | Bacteria | 4116 |
| 150 | Ga0207713_1021307 | 3300025735 | Bacteria | 3110 |
| 151 | Ga0207671_10000713 | 3300025914 | Bacteria | 42635 |
| 152 | Ga0207649_10000007 | 3300025920 | Bacteria | 334217 |
| 153 | Ga0207681_10000163 | 3300025923 | Bacteria | 55005 |
| 154 | Ga0207650_10000178 | 3300025925 | Bacteria | 74821 |
| 155 | Ga0207650_10000210 | 3300025925 | Bacteria | 66574 |
| 156 | Ga0207706_10000050 | 3300025933 | Bacteria | 116811 |
| 157 | Ga0207706_10002848 | 3300025933 | Bacteria | 16783 |
| 158 | Ga0207686_10028645 | 3300025934 | Bacteria | 3277 |
| 159 | Ga0207709_10000269 | 3300025935 | Bacteria | 61223 |
| 160 | Ga0207709_10004904 | 3300025935 | Bacteria | 7658 |
| 161 | Ga0207709_10024799 | 3300025935 | Bacteria | 3429 |
| 162 | Ga0207709_10045434 | 3300025935 | Bacteria | 2660 |
| 163 | Ga0207709_10097616 | 3300025935 | Bacteria | 1935 |
| 164 | Ga0207711_10006135 | 3300025941 | Bacteria | 10152 |
| 165 | Ga0207679_10000013 | 3300025945 | Bacteria | 334197 |
| 166 | Ga0207679_10015924 | 3300025945 | Bacteria | 4984 |
| 167 | Ga0207712_10056233 | 3300025961 | Bacteria | 2771 |
| 168 | Ga0207640_10040090 | 3300025981 | Bacteria | 2968 |
| 169 | Ga0207639_10000079 | 3300026041 | Bacteria | 83859 |
| 170 | Ga0209281_1000237 | 3300027111 | Bacteria | 112688 |
| 171 | Ga0207428_10021747 | 3300027907 | Bacteria | 5426 |
| 172 | Ga0207428_10056099 | 3300027907 | Bacteria | 3131 |
| 173 | Ga0207428_10058422 | 3300027907 | Bacteria | 3061 |
| 174 | Ga0207428_10062871 | 3300027907 | Bacteria | 2934 |
| 175 | Ga0207428_10192579 | 3300027907 | Bacteria | 1537 |
| 176 | Ga0207428_10268625 | 3300027907 | Bacteria | 1269 |
| 177 | Ga0207428_10283735 | 3300027907 | Bacteria | 1229 |
| 178 | Ga0307517_10057686 | 3300028786 | Bacteria | 3756 |
| 179 | Ga0307511_10019783 | 3300030521 | Bacteria | 6393 |
| 180 | Ga0307509_10021696 | 3300031507 | Bacteria | 7254 |
| 181 | Ga0307408_100005159 | 3300031548 | Bacteria | 8760 |
| 182 | Ga0307405_10000636 | 3300031731 | Bacteria | 13497 |
| 183 | Ga0307405_10003329 | 3300031731 | Bacteria | 7358 |
| 184 | Ga0307412_10017529 | 3300031911 | Bacteria | 4287 |
| 185 | Ga0307412_10033246 | 3300031911 | Bacteria | 3276 |
| 186 | Ga0307412_10057313 | 3300031911 | Bacteria | 2600 |
| 187 | Ga0307416_100137823 | 3300032002 | Bacteria | 2211 |
| 188 | Ga0307416_100169459 | 3300032002 | Bacteria | 2030 |
| 189 | Ga0307414_10185343 | 3300032004 | Bacteria | 1678 |
| 190 | Ga0307411_10117986 | 3300032005 | Bacteria | 1913 |
| 191 | Ga0439438_000219 | 3300041405 | Bacteria | 26300 |
| 192 | Ga0439438_000524 | 3300041405 | Bacteria | 17389 |
| 193 | Ga0439438_000670 | 3300041405 | Bacteria | 15363 |
| 194 | Ga0439438_001361 | 3300041405 | Bacteria | 10795 |
| 195 | Ga0439438_002846 | 3300041405 | Bacteria | 7208 |
| 196 | Ga0439438_002857 | 3300041405 | Bacteria | 7192 |
| 197 | Ga0439438_004228 | 3300041405 | Bacteria | 5578 |
| 198 | Ga0439438_005183 | 3300041405 | Bacteria | 4840 |
| 199 | Ga0439438_007380 | 3300041405 | Bacteria | 3761 |
| 200 | Ga0439438_012022 | 3300041405 | Bacteria | 2671 |
| 201 | Ga0439438_012781 | 3300041405 | Bacteria | 2559 |
| 202 | Ga0439447_000330 | 3300041407 | Bacteria | 17039 |
| 203 | Ga0439447_000528 | 3300041407 | Bacteria | 14164 |
| 204 | Ga0439447_000718 | 3300041407 | Bacteria | 12276 |
| 205 | Ga0439447_001703 | 3300041407 | Bacteria | 8071 |
| 206 | Ga0439447_005265 | 3300041407 | Bacteria | 4317 |
| 207 | Ga0439447_022180 | 3300041407 | Bacteria | 1665 |
| 208 | Ga0439461_0002057 | 3300041410 | Bacteria | 3185 |
| 209 | Ga0439466_0000612 | 3300041411 | Bacteria | 13423 |
| 210 | Ga0439466_0000697 | 3300041411 | Bacteria | 12686 |
| 211 | Ga0439466_0002918 | 3300041411 | Bacteria | 6684 |
| 212 | Ga0439466_0003428 | 3300041411 | Bacteria | 6152 |
| 213 | Ga0439466_0004041 | 3300041411 | Bacteria | 5663 |
| 214 | Ga0439466_0005067 | 3300041411 | Bacteria | 5051 |
| 215 | Ga0439466_0007280 | 3300041411 | Bacteria | 4189 |
| 216 | Ga0439466_0018241 | 3300041411 | Bacteria | 2519 |
| 217 | Ga0439466_0024071 | 3300041411 | Bacteria | 2138 |
| 218 | Ga0439465_0001504 | 3300041413 | Bacteria | 7562 |
| 219 | Ga0451841_0345081 | 3300041498 | Bacteria | 1411 |
| 220 | Ga0439445_0010898 | 3300042004 | Bacteria | 2159 |
| 221 | Ga0439445_0014340 | 3300042004 | Bacteria | 1928 |
| 222 | Ga0439432_000934 | 3300042006 | Bacteria | 10994 |
| 223 | Ga0439432_003995 | 3300042006 | Bacteria | 5420 |
| 224 | Ga0439432_006064 | 3300042006 | Bacteria | 4334 |
| 225 | Ga0439432_010655 | 3300042006 | Bacteria | 3180 |
| 226 | Ga0439432_011893 | 3300042006 | Bacteria | 2990 |
| 227 | Ga0439432_021636 | 3300042006 | Bacteria | 2129 |
| 228 | Ga0439432_036142 | 3300042006 | Bacteria | 1581 |
| 229 | Ga0439451_000629 | 3300042009 | Bacteria | 6690 |
| 230 | Ga0439451_000701 | 3300042009 | Bacteria | 6362 |
| 231 | Ga0439451_001253 | 3300042009 | Bacteria | 5022 |
| 232 | Ga0439451_005067 | 3300042009 | Bacteria | 2680 |
| 233 | Ga0439451_005297 | 3300042009 | Bacteria | 2627 |
| 234 | Ga0439451_006692 | 3300042009 | Bacteria | 2355 |
| 235 | Ga0439452_000352 | 3300042010 | Bacteria | 28208 |
| 236 | Ga0439452_000435 | 3300042010 | Bacteria | 24043 |
| 237 | Ga0439452_000563 | 3300042010 | Bacteria | 19511 |
| 238 | Ga0439452_001007 | 3300042010 | Bacteria | 12489 |
| 239 | Ga0439452_001505 | 3300042010 | Bacteria | 9437 |
| 240 | Ga0439452_001897 | 3300042010 | Bacteria | 8040 |
| 241 | Ga0439452_003511 | 3300042010 | Bacteria | 5478 |
| 242 | Ga0439452_013819 | 3300042010 | Bacteria | 2258 |
| 243 | Ga0439452_013883 | 3300042010 | Bacteria | 2251 |
| 244 | Ga0439452_018751 | 3300042010 | Bacteria | 1839 |
| 245 | Ga0439456_001509 | 3300042013 | Bacteria | 4688 |
| 246 | Ga0439456_002453 | 3300042013 | Bacteria | 3743 |
| 247 | Ga0439456_009492 | 3300042013 | Bacteria | 2009 |
| 248 | Ga0439456_014382 | 3300042013 | Bacteria | 1650 |
| 249 | Ga0439456_016318 | 3300042013 | Bacteria | 1553 |
| 250 | Ga0439456_026799 | 3300042013 | Bacteria | 1226 |
| 251 | Ga0439463_000640 | 3300042016 | Bacteria | 9679 |
| 252 | Ga0439463_003554 | 3300042016 | Bacteria | 3940 |
| 253 | Ga0439463_014202 | 3300042016 | Bacteria | 1962 |
| 254 | Ga0450911_000393 | 3300042115 | Bacteria | 14471 |
| 255 | Ga0450911_000919 | 3300042115 | Bacteria | 7806 |
| 256 | Ga0450911_001252 | 3300042115 | Bacteria | 6086 |
| 257 | Ga0450911_002598 | 3300042115 | Bacteria | 3485 |
| 258 | Ga0450911_004078 | 3300042115 | Bacteria | 2450 |
| 259 | Ga0450911_005338 | 3300042115 | Bacteria | 2007 |
| 260 | Ga0450919_000148 | 3300042121 | Bacteria | 7277 |
| 261 | Ga0450921_000776 | 3300042123 | Bacteria | 1684 |
| 262 | Ga0450922_000807 | 3300042124 | Bacteria | 3212 |
| 263 | Ga0450922_000819 | 3300042124 | Bacteria | 3187 |
| 264 | Ga0450922_001375 | 3300042124 | Bacteria | 2392 |
| 265 | Ga0450923_000577 | 3300042125 | Bacteria | 4169 |
| 266 | Ga0450890_000098 | 3300042127 | Bacteria | 14459 |
| 267 | Ga0450894_001932 | 3300042131 | Bacteria | 2863 |
| 268 | Ga0450896_011801 | 3300042133 | Bacteria | 1232 |
| 269 | Ga0450898_000863 | 3300042134 | Bacteria | 3782 |
| 270 | Ga0450899_001832 | 3300042135 | Bacteria | 2358 |
| 271 | Ga0450900_000564 | 3300042136 | Bacteria | 3031 |
| 272 | Ga0450900_008617 | 3300042136 | Bacteria | 1279 |
| 273 | Ga0450902_002154 | 3300042137 | Bacteria | 2771 |
| 274 | Ga0450902_004796 | 3300042137 | Bacteria | 2022 |
| 275 | Ga0450902_005659 | 3300042137 | Bacteria | 1898 |
| 276 | Ga0450903_000427 | 3300042138 | Bacteria | 9033 |
| 277 | Ga0450903_000585 | 3300042138 | Bacteria | 7468 |
| 278 | Ga0450903_001352 | 3300042138 | Bacteria | 4587 |
| 279 | Ga0450903_004383 | 3300042138 | Bacteria | 2412 |
| 280 | Ga0450903_008713 | 3300042138 | Bacteria | 1658 |
| 281 | Ga0450904_001450 | 3300042139 | Bacteria | 3332 |
| 282 | Ga0450904_001615 | 3300042139 | Bacteria | 3049 |
| 283 | Ga0450905_001236 | 3300042142 | Bacteria | 3237 |
| 284 | Ga0450905_012465 | 3300042142 | Bacteria | 1197 |
| 285 | Ga0450906_000615 | 3300042145 | Bacteria | 7600 |
| 286 | Ga0450906_000778 | 3300042145 | Bacteria | 6949 |
| 287 | Ga0450906_002850 | 3300042145 | Bacteria | 3768 |
| 288 | Ga0450906_004020 | 3300042145 | Bacteria | 3111 |
| 289 | Ga0450906_015212 | 3300042145 | Bacteria | 1400 |
| 290 | Ga0450907_000357 | 3300042146 | Bacteria | 14117 |
| 291 | Ga0450907_001563 | 3300042146 | Bacteria | 4875 |
| 292 | Ga0450907_003076 | 3300042146 | Bacteria | 3031 |
| 293 | Ga0450910_000138 | 3300042147 | Bacteria | 7848 |
| 294 | Ga0439446_0010265 | 3300042156 | Bacteria | 2520 |
| 295 | Ga0439446_0019297 | 3300042156 | Bacteria | 1915 |
| 296 | Ga0450908_000519 | 3300042184 | Bacteria | 7447 |
| 297 | Ga0450909_000324 | 3300042185 | Bacteria | 5948 |
| 298 | Ga0450909_000548 | 3300042185 | Bacteria | 4950 |
| 299 | Ga0450909_005786 | 3300042185 | Bacteria | 1780 |
| 300 | Ga0450909_007184 | 3300042185 | Bacteria | 1609 |
| 301 | Ga0450909_009958 | 3300042185 | Bacteria | 1389 |
| 302 | Ga0439434_0000177 | 3300042435 | Bacteria | 17489 |
| 303 | Ga0439434_0013925 | 3300042435 | Bacteria | 2390 |
| 304 | Ga0439464_0008473 | 3300042439 | Bacteria | 2693 |
| 305 | Ga0439460_0000220 | 3300042461 | Bacteria | 11406 |
| 306 | Ga0439460_0000423 | 3300042461 | Bacteria | 9016 |
| 307 | Ga0439460_0009759 | 3300042461 | Bacteria | 2444 |
| 308 | Ga0450918_000835 | 3300042531 | Bacteria | 6492 |
| 309 | Ga0450918_010120 | 3300042531 | Bacteria | 1647 |
| 310 | Ga0450893_0009252 | 3300042532 | Bacteria | 1608 |
| 311 | Ga0450893_0013584 | 3300042532 | Bacteria | 1359 |
| 312 | Ga0450901_000636 | 3300042533 | Bacteria | 4133 |
| 313 | Ga0439440_0000589 | 3300042993 | Bacteria | 6160 |
| 314 | Ga0439440_0000879 | 3300042993 | Bacteria | 5249 |
| 315 | Ga0439440_0004943 | 3300042993 | Bacteria | 2630 |
| 316 | Ga0495617_000380 | 3300046452 | Bacteria | 24621 |
| 317 | Ga0495617_004640 | 3300046452 | Bacteria | 4971 |
| 318 | Ga0495617_011245 | 3300046452 | Bacteria | 3054 |
| 319 | Ga0495617_020728 | 3300046452 | Bacteria | 2221 |
| 320 | Ga0495617_037361 | 3300046452 | Bacteria | 1627 |
| 321 | Ga0495627_009991 | 3300046453 | Bacteria | 3468 |
| 322 | Ga0495627_047213 | 3300046453 | Bacteria | 1306 |
| 323 | Ga0495592_0028435 | 3300046454 | Bacteria | 4234 |
| 324 | Ga0495603_0028467 | 3300046455 | Bacteria | 3370 |
| 325 | Ga0495590_0002177 | 3300046457 | Bacteria | 8203 |
| 326 | Ga0495590_0003420 | 3300046457 | Bacteria | 6483 |
| 327 | Ga0495590_0012662 | 3300046457 | Bacteria | 3125 |
| 328 | Ga0495590_0031926 | 3300046457 | Bacteria | 1842 |
| 329 | Ga0495591_001346 | 3300046458 | Bacteria | 15427 |
| 330 | Ga0495591_002535 | 3300046458 | Bacteria | 10074 |
| 331 | Ga0495591_002732 | 3300046458 | Bacteria | 9554 |
| 332 | Ga0495591_005229 | 3300046458 | Bacteria | 6070 |
| 333 | Ga0495591_005358 | 3300046458 | Bacteria | 5960 |
| 334 | Ga0495591_006966 | 3300046458 | Bacteria | 4886 |
| 335 | Ga0495591_011465 | 3300046458 | Bacteria | 3357 |
| 336 | Ga0495591_020295 | 3300046458 | Bacteria | 2198 |
| 337 | Ga0495591_026471 | 3300046458 | Bacteria | 1801 |
| 338 | Ga0495591_030469 | 3300046458 | Bacteria | 1628 |
| 339 | Ga0495629_0010277 | 3300046459 | Bacteria | 6817 |
| 340 | Ga0495638_0001277 | 3300046460 | Bacteria | 23481 |
| 341 | Ga0495638_0002273 | 3300046460 | Bacteria | 15882 |
| 342 | Ga0495638_0006882 | 3300046460 | Bacteria | 8209 |
| 343 | Ga0495638_0009395 | 3300046460 | Bacteria | 6874 |
| 344 | Ga0495638_0010042 | 3300046460 | Bacteria | 6599 |
| 345 | Ga0495638_0021715 | 3300046460 | Bacteria | 4222 |
| 346 | Ga0495638_0021951 | 3300046460 | Bacteria | 4195 |
| 347 | Ga0495638_0030603 | 3300046460 | Bacteria | 3463 |
| 348 | Ga0495638_0057394 | 3300046460 | Bacteria | 2414 |
| 349 | Ga0495638_0058965 | 3300046460 | Bacteria | 2378 |
| 350 | Ga0495638_0060638 | 3300046460 | Bacteria | 2339 |
| 351 | Ga0495638_0078147 | 3300046460 | Bacteria | 2014 |
| 352 | Ga0495653_0015864 | 3300046463 | Bacteria | 6139 |
| 353 | Ga0495653_0088963 | 3300046463 | Bacteria | 2264 |
| 354 | Ga0495650_0002307 | 3300046471 | Bacteria | 15821 |
| 355 | Ga0495650_0006133 | 3300046471 | Bacteria | 7565 |
| 356 | Ga0495650_0006144 | 3300046471 | Bacteria | 7554 |
| 357 | Ga0495650_0007734 | 3300046471 | Bacteria | 6400 |
| 358 | Ga0495650_0008201 | 3300046471 | Bacteria | 6136 |
| 359 | Ga0495650_0012706 | 3300046471 | Bacteria | 4511 |
| 360 | Ga0495582_0005461 | 3300046473 | Bacteria | 7085 |
| 361 | Ga0495605_0001019 | 3300046474 | Bacteria | 18902 |
| 362 | Ga0495605_0001927 | 3300046474 | Bacteria | 13197 |
| 363 | Ga0495605_0014437 | 3300046474 | Bacteria | 4327 |
| 364 | Ga0495605_0016429 | 3300046474 | Bacteria | 4006 |
| 365 | Ga0495605_0022127 | 3300046474 | Bacteria | 3361 |
| 366 | Ga0495605_0026693 | 3300046474 | Bacteria | 3000 |
| 367 | Ga0495605_0033316 | 3300046474 | Bacteria | 2615 |
| 368 | Ga0495639_0000239 | 3300046475 | Bacteria | 27346 |
| 369 | Ga0495639_0007862 | 3300046475 | Bacteria | 4583 |
| 370 | Ga0495584_0001101 | 3300046491 | Bacteria | 16778 |
| 371 | Ga0495584_0004243 | 3300046491 | Bacteria | 7733 |
| 372 | Ga0495584_0004614 | 3300046491 | Bacteria | 7388 |
| 373 | Ga0495584_0008756 | 3300046491 | Bacteria | 5233 |
| 374 | Ga0495584_0009005 | 3300046491 | Bacteria | 5156 |
| 375 | Ga0495584_0013224 | 3300046491 | Bacteria | 4212 |
| 376 | Ga0495584_0026328 | 3300046491 | Bacteria | 2946 |
| 377 | Ga0495584_0037943 | 3300046491 | Bacteria | 2435 |
| 378 | Ga0495584_0046743 | 3300046491 | Bacteria | 2183 |
| 379 | Ga0495585_0000800 | 3300046492 | Bacteria | 27448 |
| 380 | Ga0495585_0005089 | 3300046492 | Bacteria | 8372 |
| 381 | Ga0495585_0006078 | 3300046492 | Bacteria | 7551 |
| 382 | Ga0495585_0011791 | 3300046492 | Bacteria | 5164 |
| 383 | Ga0495585_0015035 | 3300046492 | Bacteria | 4499 |
| 384 | Ga0495585_0017059 | 3300046492 | Bacteria | 4201 |
| 385 | Ga0495594_0004919 | 3300046499 | Bacteria | 6873 |
| 386 | Ga0495594_0024156 | 3300046499 | Bacteria | 3262 |
| 387 | Ga0495596_0000482 | 3300046500 | Bacteria | 25244 |
| 388 | Ga0495607_0002401 | 3300046501 | Bacteria | 15280 |
| 389 | Ga0495607_0002489 | 3300046501 | Bacteria | 14921 |
| 390 | Ga0495607_0005282 | 3300046501 | Bacteria | 9291 |
| 391 | Ga0495607_0006775 | 3300046501 | Bacteria | 8003 |
| 392 | Ga0495607_0009819 | 3300046501 | Bacteria | 6460 |
| 393 | Ga0495607_0012460 | 3300046501 | Bacteria | 5613 |
| 394 | Ga0495607_0015455 | 3300046501 | Bacteria | 4948 |
| 395 | Ga0495607_0016962 | 3300046501 | Bacteria | 4688 |
| 396 | Ga0495607_0019527 | 3300046501 | Bacteria | 4303 |
| 397 | Ga0495607_0032397 | 3300046501 | Bacteria | 3190 |
| 398 | Ga0495607_0038022 | 3300046501 | Bacteria | 2886 |
| 399 | Ga0495607_0069210 | 3300046501 | Bacteria | 1976 |
| 400 | Ga0495607_0084703 | 3300046501 | Bacteria | 1733 |
| 401 | Ga0495607_0119569 | 3300046501 | Bacteria | 1385 |
| 402 | Ga0495583_0001586 | 3300046506 | Bacteria | 22403 |
| 403 | Ga0495583_0004250 | 3300046506 | Bacteria | 10386 |
| 404 | Ga0495583_0004393 | 3300046506 | Bacteria | 10118 |
| 405 | Ga0495583_0006442 | 3300046506 | Bacteria | 7675 |
| 406 | Ga0495583_0033253 | 3300046506 | Bacteria | 2480 |
| 407 | Ga0495583_0040636 | 3300046506 | Bacteria | 2183 |
| 408 | Ga0495583_0060815 | 3300046506 | Bacteria | 1687 |
| 409 | Ga0495606_0003551 | 3300046507 | Bacteria | 16460 |
| 410 | Ga0495606_0043025 | 3300046507 | Bacteria | 3016 |
| 411 | Ga0495606_0058740 | 3300046507 | Bacteria | 2470 |
| 412 | Ga0495610_0007502 | 3300046512 | Bacteria | 7246 |
| 413 | Ga0495610_0008055 | 3300046512 | Bacteria | 6894 |
| 414 | Ga0495610_0008473 | 3300046512 | Bacteria | 6653 |
| 415 | Ga0495610_0008706 | 3300046512 | Bacteria | 6529 |
| 416 | Ga0495610_0010757 | 3300046512 | Bacteria | 5659 |
| 417 | Ga0495610_0011663 | 3300046512 | Bacteria | 5349 |
| 418 | Ga0495610_0012437 | 3300046512 | Bacteria | 5124 |
| 419 | Ga0495610_0022945 | 3300046512 | Bacteria | 3400 |
| 420 | Ga0495610_0027408 | 3300046512 | Bacteria | 3028 |
| 421 | Ga0495610_0067786 | 3300046512 | Bacteria | 1675 |
| 422 | Ga0495610_0090013 | 3300046512 | Bacteria | 1392 |
| 423 | Ga0495616_0001775 | 3300046513 | Bacteria | 14672 |
| 424 | Ga0495616_0002772 | 3300046513 | Bacteria | 11443 |
| 425 | Ga0495616_0008776 | 3300046513 | Bacteria | 5955 |
| 426 | Ga0495616_0009840 | 3300046513 | Bacteria | 5567 |
| 427 | Ga0495616_0013579 | 3300046513 | Bacteria | 4588 |
| 428 | Ga0495620_0005558 | 3300046515 | Bacteria | 7026 |
| 429 | Ga0495620_0006144 | 3300046515 | Bacteria | 6627 |
| 430 | Ga0495620_0009264 | 3300046515 | Bacteria | 5243 |
| 431 | Ga0495620_0013538 | 3300046515 | Bacteria | 4173 |
| 432 | Ga0495620_0023108 | 3300046515 | Bacteria | 2980 |
| 433 | Ga0495620_0062000 | 3300046515 | Bacteria | 1554 |
| 434 | Ga0495628_0032258 | 3300046516 | Bacteria | 4230 |
| 435 | Ga0495630_0018688 | 3300046517 | Bacteria | 5091 |
| 436 | Ga0495630_0041876 | 3300046517 | Bacteria | 3420 |
| 437 | Ga0495631_0001056 | 3300046518 | Bacteria | 17098 |
| 438 | Ga0495631_0005870 | 3300046518 | Bacteria | 6398 |
| 439 | Ga0495631_0014280 | 3300046518 | Bacteria | 3837 |
| 440 | Ga0495631_0018963 | 3300046518 | Bacteria | 3232 |
| 441 | Ga0495631_0038078 | 3300046518 | Bacteria | 2139 |
| 442 | Ga0495631_0099249 | 3300046518 | Bacteria | 1253 |
| 443 | Ga0495632_0000952 | 3300046519 | Bacteria | 25300 |
| 444 | Ga0495632_0002331 | 3300046519 | Bacteria | 14584 |
| 445 | Ga0495632_0005690 | 3300046519 | Bacteria | 8183 |
| 446 | Ga0495632_0007116 | 3300046519 | Bacteria | 7079 |
| 447 | Ga0495632_0009059 | 3300046519 | Bacteria | 6030 |
| 448 | Ga0495632_0011397 | 3300046519 | Bacteria | 5188 |
| 449 | Ga0495632_0020593 | 3300046519 | Bacteria | 3568 |
| 450 | Ga0495632_0028343 | 3300046519 | Bacteria | 2923 |
| 451 | Ga0495632_0032030 | 3300046519 | Bacteria | 2712 |
| 452 | Ga0495637_0001352 | 3300046520 | Bacteria | 14721 |
| 453 | Ga0495637_0001869 | 3300046520 | Bacteria | 12034 |
| 454 | Ga0495637_0003492 | 3300046520 | Bacteria | 8342 |
| 455 | Ga0495637_0003821 | 3300046520 | Bacteria | 7916 |
| 456 | Ga0495637_0003957 | 3300046520 | Bacteria | 7748 |
| 457 | Ga0495637_0005807 | 3300046520 | Bacteria | 6250 |
| 458 | Ga0495637_0008564 | 3300046520 | Bacteria | 5019 |
| 459 | Ga0495637_0010076 | 3300046520 | Bacteria | 4586 |
| 460 | Ga0495637_0010768 | 3300046520 | Bacteria | 4410 |
| 461 | Ga0495637_0015538 | 3300046520 | Bacteria | 3570 |
| 462 | Ga0495637_0015950 | 3300046520 | Bacteria | 3517 |
| 463 | Ga0495637_0024646 | 3300046520 | Bacteria | 2721 |
| 464 | Ga0495637_0036009 | 3300046520 | Bacteria | 2159 |
| 465 | Ga0495637_0061921 | 3300046520 | Bacteria | 1532 |
| 466 | Ga0495637_0116538 | 3300046520 | Bacteria | 1031 |
| 467 | Ga0495643_0005972 | 3300046522 | Bacteria | 8126 |
| 468 | Ga0495643_0010329 | 3300046522 | Bacteria | 5748 |
| 469 | Ga0495643_0018189 | 3300046522 | Bacteria | 4090 |
| 470 | Ga0495643_0030872 | 3300046522 | Bacteria | 2987 |
| 471 | Ga0495643_0033926 | 3300046522 | Bacteria | 2819 |
| 472 | Ga0495644_0002846 | 3300046523 | Bacteria | 6854 |
| 473 | Ga0495644_0003449 | 3300046523 | Bacteria | 6256 |
| 474 | Ga0495644_0025640 | 3300046523 | Bacteria | 2237 |
| 475 | Ga0495644_0047487 | 3300046523 | Bacteria | 1612 |
| 476 | Ga0495644_0066360 | 3300046523 | Bacteria | 1355 |
| 477 | Ga0495648_0001218 | 3300046524 | Bacteria | 25789 |
| 478 | Ga0495648_0002655 | 3300046524 | Bacteria | 16198 |
| 479 | Ga0495648_0002978 | 3300046524 | Bacteria | 15198 |
| 480 | Ga0495648_0011516 | 3300046524 | Bacteria | 6652 |
| 481 | Ga0495648_0018746 | 3300046524 | Bacteria | 4885 |
| 482 | Ga0495648_0026763 | 3300046524 | Bacteria | 3876 |
| 483 | Ga0495648_0048081 | 3300046524 | Bacteria | 2629 |
| 484 | Ga0495648_0061142 | 3300046524 | Bacteria | 2238 |
| 485 | Ga0495648_0067227 | 3300046524 | Bacteria | 2097 |
| 486 | Ga0495648_0137751 | 3300046524 | Bacteria | 1288 |
| 487 | Ga0495666_0001740 | 3300046526 | Bacteria | 10729 |
| 488 | Ga0495666_0009683 | 3300046526 | Bacteria | 4815 |
| 489 | Ga0495666_0058101 | 3300046526 | Bacteria | 1851 |
| 490 | Ga0495642_0000291 | 3300046528 | Bacteria | 28351 |
| 491 | Ga0495642_0000368 | 3300046528 | Bacteria | 24366 |
| 492 | Ga0495642_0000824 | 3300046528 | Bacteria | 14888 |
| 493 | Ga0495654_0001864 | 3300046530 | Bacteria | 14039 |
| 494 | Ga0495654_0003754 | 3300046530 | Bacteria | 9195 |
| 495 | Ga0495654_0004474 | 3300046530 | Bacteria | 8282 |
| 496 | Ga0495654_0005730 | 3300046530 | Bacteria | 7158 |
| 497 | Ga0495654_0006406 | 3300046530 | Bacteria | 6692 |
| 498 | Ga0495654_0013249 | 3300046530 | Bacteria | 4415 |
| 499 | Ga0495654_0018219 | 3300046530 | Bacteria | 3683 |
| 500 | Ga0495654_0021050 | 3300046530 | Bacteria | 3395 |
| 501 | Ga0495654_0025082 | 3300046530 | Bacteria | 3074 |
| 502 | Ga0495654_0025483 | 3300046530 | Bacteria | 3045 |
| 503 | Ga0495654_0032823 | 3300046530 | Bacteria | 2630 |
| 504 | Ga0495654_0038894 | 3300046530 | Bacteria | 2376 |
| 505 | Ga0495654_0080741 | 3300046530 | Bacteria | 1525 |
| 506 | Ga0495654_0107427 | 3300046530 | Bacteria | 1276 |
| 507 | Ga0495586_0002791 | 3300046535 | Bacteria | 9438 |
| 508 | Ga0495587_0013048 | 3300046536 | Bacteria | 5226 |
| 509 | Ga0495609_0000100 | 3300046538 | Bacteria | 100831 |
| 510 | Ga0495609_0000756 | 3300046538 | Bacteria | 24390 |
| 511 | Ga0495609_0003116 | 3300046538 | Bacteria | 9693 |
| 512 | Ga0495609_0012155 | 3300046538 | Bacteria | 4085 |
| 513 | Ga0495609_0073713 | 3300046538 | Bacteria | 1497 |
| 514 | Ga0495597_0002530 | 3300046542 | Bacteria | 11469 |
| 515 | Ga0495597_0004102 | 3300046542 | Bacteria | 8117 |
| 516 | Ga0495597_0006520 | 3300046542 | Bacteria | 6023 |
| 517 | Ga0495597_0007772 | 3300046542 | Bacteria | 5416 |
| 518 | Ga0495597_0014685 | 3300046542 | Bacteria | 3725 |
| 519 | Ga0495597_0015333 | 3300046542 | Bacteria | 3630 |
| 520 | Ga0495597_0030984 | 3300046542 | Bacteria | 2435 |
| 521 | Ga0495597_0043551 | 3300046542 | Bacteria | 1998 |
| 522 | Ga0495597_0067048 | 3300046542 | Bacteria | 1553 |
| 523 | Ga0495597_0069570 | 3300046542 | Bacteria | 1518 |
| 524 | Ga0495622_0000466 | 3300046557 | Bacteria | 25861 |
| 525 | Ga0495622_0013943 | 3300046557 | Bacteria | 3730 |
| 526 | Ga0495622_0043015 | 3300046557 | Bacteria | 2100 |
| 527 | Ga0495633_0007867 | 3300046558 | Bacteria | 6083 |
| 528 | Ga0495633_0039511 | 3300046558 | Bacteria | 2252 |
| 529 | Ga0495633_0109900 | 3300046558 | Bacteria | 1278 |
| 530 | Ga0495656_0019846 | 3300046615 | Bacteria | 2599 |
| 531 | Ga0495656_0094468 | 3300046615 | Bacteria | 1373 |
| 532 | Ga0495668_0002000 | 3300046616 | Bacteria | 17820 |
| 533 | Ga0495668_0015266 | 3300046616 | Bacteria | 4488 |
| 534 | Ga0495668_0019541 | 3300046616 | Bacteria | 3903 |
| 535 | Ga0495668_0153447 | 3300046616 | Bacteria | 1261 |
| 536 | Ga0495634_0002187 | 3300046642 | Bacteria | 16425 |
| 537 | Ga0495634_0024645 | 3300046642 | Bacteria | 4218 |
| 538 | Ga0495611_0002835 | 3300046648 | Bacteria | 7745 |
| 539 | Ga0495611_0010434 | 3300046648 | Bacteria | 3931 |
| 540 | Ga0495611_0020505 | 3300046648 | Bacteria | 2846 |
| 541 | Ga0495611_0032433 | 3300046648 | Bacteria | 2301 |
| 542 | Ga0495611_0071639 | 3300046648 | Bacteria | 1585 |
| 543 | Ga0495625_0011945 | 3300046660 | Bacteria | 7049 |
| 544 | Ga0495625_0011959 | 3300046660 | Bacteria | 7045 |
| 545 | Ga0495625_0015042 | 3300046660 | Bacteria | 6145 |
| 546 | Ga0495625_0030255 | 3300046660 | Bacteria | 4041 |
| 547 | Ga0495625_0039694 | 3300046660 | Bacteria | 3436 |
| 548 | Ga0495625_0044214 | 3300046660 | Bacteria | 3225 |
| 549 | Ga0495635_0001369 | 3300046663 | Bacteria | 16227 |
| 550 | Ga0495635_0003679 | 3300046663 | Bacteria | 10623 |
| 551 | Ga0495659_0000386 | 3300046664 | Bacteria | 16969 |
| 552 | Ga0495659_0014280 | 3300046664 | Bacteria | 2598 |
| 553 | Ga0495661_0000315 | 3300046665 | Bacteria | 54229 |
| 554 | Ga0495661_0001817 | 3300046665 | Bacteria | 17115 |
| 555 | Ga0495661_0008570 | 3300046665 | Bacteria | 7068 |
| 556 | Ga0495661_0010510 | 3300046665 | Bacteria | 6314 |
| 557 | Ga0495661_0011035 | 3300046665 | Bacteria | 6138 |
| 558 | Ga0495661_0021815 | 3300046665 | Bacteria | 4169 |
| 559 | Ga0495661_0043871 | 3300046665 | Bacteria | 2745 |
| 560 | Ga0495661_0059351 | 3300046665 | Bacteria | 2277 |
| 561 | Ga0495661_0176952 | 3300046665 | Bacteria | 1133 |
| 562 | Ga0495588_0005649 | 3300046674 | Bacteria | 5577 |
| 563 | Ga0495588_0024833 | 3300046674 | Bacteria | 2980 |
| 564 | Ga0495588_0119280 | 3300046674 | Bacteria | 1390 |
| 565 | Ga0495657_0037624 | 3300046675 | Bacteria | 3334 |
| 566 | Ga0495599_0117289 | 3300046678 | Bacteria | 1656 |
| 567 | Ga0495623_0006299 | 3300046679 | Bacteria | 7714 |
| 568 | Ga0495646_0004999 | 3300046680 | Bacteria | 8369 |
| 569 | Ga0495646_0005503 | 3300046680 | Bacteria | 8010 |
| 570 | Ga0495646_0052624 | 3300046680 | Bacteria | 2458 |
| 571 | Ga0495669_0012931 | 3300046684 | Bacteria | 3554 |
| 572 | Ga0495613_0012685 | 3300046689 | Bacteria | 6266 |
| 573 | Ga0495613_0019037 | 3300046689 | Bacteria | 5116 |
| 574 | Ga0495613_0087878 | 3300046689 | Bacteria | 2253 |
| 575 | Ga0495624_0007321 | 3300046690 | Bacteria | 7749 |
| 576 | Ga0495670_0001360 | 3300046691 | Bacteria | 11935 |
| 577 | Ga0495670_0003504 | 3300046691 | Bacteria | 7703 |
| 578 | Ga0495670_0027151 | 3300046691 | Bacteria | 2834 |
| 579 | Ga0495670_0101608 | 3300046691 | Bacteria | 1481 |
| 580 | Ga0495671_0000561 | 3300046692 | Bacteria | 27871 |
| 581 | Ga0495671_0003513 | 3300046692 | Bacteria | 9603 |
| 582 | Ga0495671_0006513 | 3300046692 | Bacteria | 6741 |
| 583 | Ga0495671_0007357 | 3300046692 | Bacteria | 6283 |
| 584 | Ga0495671_0015217 | 3300046692 | Bacteria | 4128 |
| 585 | Ga0495671_0040873 | 3300046692 | Bacteria | 2337 |
| 586 | Ga0495671_0051653 | 3300046692 | Bacteria | 2044 |
| 587 | Ga0495671_0146508 | 3300046692 | Bacteria | 1150 |
| 588 | Ga0495649_0002380 | 3300046694 | Bacteria | 13304 |
| 589 | Ga0495649_0006593 | 3300046694 | Bacteria | 7217 |
| 590 | Ga0495649_0010762 | 3300046694 | Bacteria | 5389 |
| 591 | Ga0495649_0015943 | 3300046694 | Bacteria | 4266 |
| 592 | Ga0495649_0016014 | 3300046694 | Bacteria | 4256 |
| 593 | Ga0495649_0018731 | 3300046694 | Bacteria | 3890 |
| 594 | Ga0495649_0019782 | 3300046694 | Bacteria | 3781 |
| 595 | Ga0495649_0022741 | 3300046694 | Bacteria | 3506 |
| 596 | Ga0495649_0050279 | 3300046694 | Bacteria | 2262 |
| 597 | Ga0495649_0101892 | 3300046694 | Bacteria | 1525 |
| 598 | Ga0495649_0179611 | 3300046694 | Bacteria | 1104 |
| 599 | Ga0495589_0000245 | 3300046794 | Bacteria | 45172 |
| 600 | Ga0495589_0003887 | 3300046794 | Bacteria | 8026 |
| 601 | Ga0495589_0007773 | 3300046794 | Bacteria | 5612 |
| 602 | Ga0495589_0015693 | 3300046794 | Bacteria | 3893 |
| 603 | Ga0495589_0025523 | 3300046794 | Bacteria | 2998 |
| 604 | Ga0495600_0010835 | 3300046809 | Bacteria | 5669 |
| 605 | Ga0495600_0051884 | 3300046809 | Bacteria | 2677 |
| 606 | Ga0495600_0206549 | 3300046809 | Bacteria | 1260 |
| 607 | Ga0495660_0012913 | 3300046810 | Bacteria | 4843 |
| 608 | Ga0495660_0013059 | 3300046810 | Bacteria | 4814 |
| 609 | Ga0495660_0019022 | 3300046810 | Bacteria | 3943 |
| 610 | Ga0495660_0019900 | 3300046810 | Bacteria | 3850 |
| 611 | Ga0495660_0025267 | 3300046810 | Bacteria | 3374 |
| 612 | Ga0495660_0041150 | 3300046810 | Bacteria | 2560 |
| 613 | Ga0495660_0043776 | 3300046810 | Bacteria | 2466 |
| 614 | Ga0495660_0061363 | 3300046810 | Bacteria | 2017 |
| 615 | Ga0495660_0082025 | 3300046810 | Bacteria | 1689 |
| 616 | Ga0495660_0105594 | 3300046810 | Bacteria | 1443 |
| 617 | Ga0495581_0009340 | 3300047315 | Bacteria | 5676 |
| 618 | Ga0495581_0017302 | 3300047315 | Bacteria | 4187 |
| 619 | Ga0495604_0003119 | 3300047317 | Bacteria | 13242 |
| 620 | Ga0495604_0003340 | 3300047317 | Bacteria | 12790 |
| 621 | Ga0495604_0023935 | 3300047317 | Bacteria | 4875 |
| 622 | Ga0495636_0000767 | 3300047318 | Bacteria | 11818 |
| 623 | Ga0495674_0026804 | 3300047319 | Bacteria | 5270 |
| 624 | Ga0495672_0001274 | 3300047320 | Bacteria | 25229 |
| 625 | Ga0495672_0003072 | 3300047320 | Bacteria | 14614 |
| 626 | Ga0495672_0003235 | 3300047320 | Bacteria | 14138 |
| 627 | Ga0495672_0006568 | 3300047320 | Bacteria | 8959 |
| 628 | Ga0495672_0010052 | 3300047320 | Bacteria | 6776 |
| 629 | Ga0495672_0010264 | 3300047320 | Bacteria | 6689 |
| 630 | Ga0495672_0018080 | 3300047320 | Bacteria | 4693 |
| 631 | Ga0495672_0020197 | 3300047320 | Bacteria | 4372 |
| 632 | Ga0495672_0024320 | 3300047320 | Bacteria | 3904 |
| 633 | Ga0495672_0024661 | 3300047320 | Bacteria | 3870 |
| 634 | Ga0495672_0030403 | 3300047320 | Bacteria | 3389 |
| 635 | Ga0495672_0039762 | 3300047320 | Bacteria | 2858 |
| 636 | Ga0495672_0087541 | 3300047320 | Bacteria | 1719 |
| 637 | Ga0495672_0100304 | 3300047320 | Bacteria | 1571 |
| 638 | Ga0495676_0026135 | 3300047321 | Bacteria | 5029 |
| 639 | Ga0495680_0002200 | 3300047322 | Bacteria | 20182 |
| 640 | Ga0495680_0021720 | 3300047322 | Bacteria | 5367 |
| 641 | Ga0495680_0023204 | 3300047322 | Bacteria | 5160 |
| 642 | Ga0495680_0029728 | 3300047322 | Bacteria | 4471 |
| 643 | Ga0495683_0001158 | 3300047323 | Bacteria | 18111 |
| 644 | Ga0495683_0001356 | 3300047323 | Bacteria | 16315 |
| 645 | Ga0495683_0006437 | 3300047323 | Bacteria | 6419 |
| 646 | Ga0495683_0042390 | 3300047323 | Bacteria | 2294 |
| 647 | Ga0495683_0051557 | 3300047323 | Bacteria | 2056 |
| 648 | Ga0495683_0107968 | 3300047323 | Bacteria | 1331 |
| 649 | Ga0495687_001396 | 3300047443 | Bacteria | 22282 |
| 650 | Ga0495687_002321 | 3300047443 | Bacteria | 15500 |
| 651 | Ga0495675_0016178 | 3300047444 | Bacteria | 4717 |
| 652 | Ga0495675_0042006 | 3300047444 | Bacteria | 2912 |
| 653 | Ga0495677_0003583 | 3300047445 | Bacteria | 6024 |
| 654 | Ga0495677_0050606 | 3300047445 | Bacteria | 1529 |
| 655 | Ga0495679_003553 | 3300047446 | Bacteria | 7452 |
| 656 | Ga0495679_005105 | 3300047446 | Bacteria | 5890 |
| 657 | Ga0495679_005606 | 3300047446 | Bacteria | 5535 |
| 658 | Ga0495679_008438 | 3300047446 | Bacteria | 4188 |
| 659 | Ga0495679_011316 | 3300047446 | Bacteria | 3450 |
| 660 | Ga0495679_012815 | 3300047446 | Bacteria | 3173 |
| 661 | Ga0495679_029115 | 3300047446 | Bacteria | 1804 |
| 662 | Ga0495685_012043 | 3300047447 | Bacteria | 2925 |
| 663 | Ga0495685_014978 | 3300047447 | Bacteria | 2640 |
| 664 | Ga0495673_0001264 | 3300047469 | Bacteria | 20818 |
| 665 | Ga0495673_0002023 | 3300047469 | Bacteria | 14906 |
| 666 | Ga0495673_0002502 | 3300047469 | Bacteria | 12868 |
| 667 | Ga0495673_0002635 | 3300047469 | Bacteria | 12426 |
| 668 | Ga0495673_0003580 | 3300047469 | Bacteria | 10192 |
| 669 | Ga0495673_0005113 | 3300047469 | Bacteria | 8002 |
| 670 | Ga0495673_0005115 | 3300047469 | Bacteria | 8000 |
| 671 | Ga0495673_0006415 | 3300047469 | Bacteria | 6917 |
| 672 | Ga0495673_0006429 | 3300047469 | Bacteria | 6906 |
| 673 | Ga0495673_0009010 | 3300047469 | Bacteria | 5552 |
| 674 | Ga0495673_0011140 | 3300047469 | Bacteria | 4853 |
| 675 | Ga0495673_0013147 | 3300047469 | Bacteria | 4359 |
| 676 | Ga0495673_0087299 | 3300047469 | Bacteria | 1280 |
| 677 | Ga0495681_0000692 | 3300047470 | Bacteria | 25721 |
| 678 | Ga0495681_0004652 | 3300047470 | Bacteria | 9305 |
| 679 | Ga0495681_0004750 | 3300047470 | Bacteria | 9207 |
| 680 | Ga0495681_0005133 | 3300047470 | Bacteria | 8820 |
| 681 | Ga0495681_0008475 | 3300047470 | Bacteria | 6447 |
| 682 | Ga0495681_0009464 | 3300047470 | Bacteria | 5998 |
| 683 | Ga0495681_0012042 | 3300047470 | Bacteria | 5104 |
| 684 | Ga0495681_0018491 | 3300047470 | Bacteria | 3838 |
| 685 | Ga0495681_0020123 | 3300047470 | Bacteria | 3627 |
| 686 | Ga0495681_0021753 | 3300047470 | Bacteria | 3447 |
| 687 | Ga0495681_0029926 | 3300047470 | Bacteria | 2780 |
| 688 | Ga0495681_0084064 | 3300047470 | Bacteria | 1416 |
| 689 | Ga0495681_0144730 | 3300047470 | Bacteria | 1001 |
| 690 | Ga0495684_0014275 | 3300047471 | Bacteria | 6112 |
| 691 | Ga0495686_0008623 | 3300047472 | Bacteria | 7448 |
| 692 | Ga0495686_0063547 | 3300047472 | Bacteria | 2287 |
| 693 | Ga0495593_0003540 | 3300047673 | Bacteria | 9343 |
| 694 | Ga0495593_0015671 | 3300047673 | Bacteria | 4289 |
| 695 | Ga0495593_0035663 | 3300047673 | Bacteria | 2699 |
| 696 | Ga0495593_0039078 | 3300047673 | Bacteria | 2560 |
| 697 | Ga0495593_0130099 | 3300047673 | Bacteria | 1278 |
| 698 | Ga0495602_0021898 | 3300048088 | Bacteria | 6274 |
| 699 | Ga0495626_0000941 | 3300048091 | Bacteria | 25315 |
| 700 | Ga0495626_0000945 | 3300048091 | Bacteria | 25254 |
| 701 | Ga0495626_0001363 | 3300048091 | Bacteria | 19726 |
| 702 | Ga0495626_0001521 | 3300048091 | Bacteria | 18215 |
| 703 | Ga0495626_0005270 | 3300048091 | Bacteria | 7640 |
| 704 | Ga0495626_0006295 | 3300048091 | Bacteria | 6773 |
| 705 | Ga0495626_0013180 | 3300048091 | Bacteria | 4306 |
| 706 | Ga0495626_0027677 | 3300048091 | Bacteria | 2754 |
| 707 | Ga0495626_0030728 | 3300048091 | Bacteria | 2589 |
| 708 | Ga0496102_0002217 | 3300048905 | Bacteria | 16672 |
| 709 | Ga0496103_0005207 | 3300048906 | Bacteria | 7819 |
| 710 | Ga0496106_0101769 | 3300048909 | Bacteria | 2228 |
| 711 | Ga0496107_0042718 | 3300048910 | Bacteria | 3256 |
| 712 | Ga0496112_0040329 | 3300048915 | Bacteria | 4565 |
| 713 | Ga0496114_0279121 | 3300048917 | Bacteria | 1473 |
| 714 | Ga0496115_0016158 | 3300048918 | Bacteria | 5677 |
| 715 | Ga0496116_0000242 | 3300048919 | Bacteria | 99455 |
| 716 | Ga0496116_0001730 | 3300048919 | Bacteria | 23848 |
| 717 | Ga0496116_0005949 | 3300048919 | Bacteria | 11187 |
| 718 | Ga0496116_0134661 | 3300048919 | Bacteria | 1401 |
| 719 | Ga0496117_0000270 | 3300048920 | Bacteria | 97077 |
| 720 | Ga0496117_0002501 | 3300048920 | Bacteria | 23069 |
| 721 | Ga0496117_0011018 | 3300048920 | Bacteria | 8141 |
| 722 | Ga0496117_0021059 | 3300048920 | Bacteria | 5294 |
| 723 | Ga0496117_0042727 | 3300048920 | Bacteria | 3305 |
| 724 | Ga0496117_0049779 | 3300048920 | Bacteria | 2976 |
| 725 | Ga0496118_0004563 | 3300048921 | Bacteria | 16329 |
| 726 | Ga0496118_0023391 | 3300048921 | Bacteria | 5368 |
| 727 | Ga0496118_0031917 | 3300048921 | Bacteria | 4351 |
| 728 | Ga0496118_0038936 | 3300048921 | Bacteria | 3802 |
| 729 | Ga0496118_0055627 | 3300048921 | Bacteria | 2983 |
| 730 | Ga0496119_0196566 | 3300048922 | Bacteria | 1047 |
| 731 | Ga0496120_0027062 | 3300048923 | Bacteria | 3533 |
| 732 | Ga0496120_0035592 | 3300048923 | Bacteria | 2972 |
| 733 | Ga0496121_0000318 | 3300048924 | Bacteria | 100833 |
| 734 | Ga0496121_0021091 | 3300048924 | Bacteria | 6401 |
| 735 | Ga0496121_0036018 | 3300048924 | Bacteria | 4419 |
| 736 | Ga0496121_0094513 | 3300048924 | Bacteria | 2325 |
| 737 | Ga0496121_0101359 | 3300048924 | Bacteria | 2220 |
| 738 | Ga0496121_0110600 | 3300048924 | Bacteria | 2096 |
| 739 | Ga0496121_0155785 | 3300048924 | Bacteria | 1676 |
| 740 | Ga0496122_0004499 | 3300048925 | Bacteria | 17225 |
| 741 | Ga0496122_0018570 | 3300048925 | Bacteria | 6413 |
| 742 | Ga0496122_0036234 | 3300048925 | Bacteria | 3994 |
| 743 | Ga0496123_0005798 | 3300048926 | Bacteria | 12263 |
| 744 | Ga0496123_0012553 | 3300048926 | Bacteria | 7212 |
| 745 | Ga0496123_0027227 | 3300048926 | Bacteria | 4262 |
| 746 | Ga0496123_0049174 | 3300048926 | Bacteria | 2830 |
| 747 | Ga0496124_0004075 | 3300048927 | Bacteria | 17310 |
| 748 | Ga0496124_0035573 | 3300048927 | Bacteria | 4356 |
| 749 | Ga0496124_0047584 | 3300048927 | Bacteria | 3668 |
| 750 | Ga0496124_0068369 | 3300048927 | Bacteria | 2952 |
| 751 | Ga0496124_0082563 | 3300048927 | Bacteria | 2637 |
| 752 | Ga0496124_0150871 | 3300048927 | Bacteria | 1823 |
| 753 | Ga0496124_0152762 | 3300048927 | Bacteria | 1809 |
| 754 | Ga0496125_0004056 | 3300048928 | Bacteria | 17150 |
| 755 | Ga0496125_0007474 | 3300048928 | Bacteria | 11623 |
| 756 | Ga0496125_0014234 | 3300048928 | Bacteria | 7756 |
| 757 | Ga0496125_0017348 | 3300048928 | Bacteria | 6870 |
| 758 | Ga0496125_0033259 | 3300048928 | Bacteria | 4566 |
| 759 | Ga0496125_0042854 | 3300048928 | Bacteria | 3849 |
| 760 | Ga0496125_0049483 | 3300048928 | Bacteria | 3492 |
| 761 | Ga0496125_0068939 | 3300048928 | Bacteria | 2778 |
| 762 | Ga0496126_0058173 | 3300048929 | Bacteria | 3485 |
| 763 | Ga0496126_0074250 | 3300048929 | Bacteria | 3020 |
| 764 | Ga0496126_0105507 | 3300048929 | Bacteria | 2460 |
| 765 | Ga0495678_001921 | 3300049459 | Bacteria | 15083 |
| 766 | Ga0495678_002035 | 3300049459 | Bacteria | 14480 |
| 767 | Ga0495678_005412 | 3300049459 | Bacteria | 7052 |
| 768 | Ga0495678_007046 | 3300049459 | Bacteria | 5891 |
| 769 | Ga0495678_014926 | 3300049459 | Bacteria | 3595 |
| 770 | Ga0495678_016804 | 3300049459 | Bacteria | 3333 |
| 771 | Ga0495678_019682 | 3300049459 | Bacteria | 3005 |
| 772 | Ga0495678_019908 | 3300049459 | Bacteria | 2982 |
| 773 | Ga0495678_022620 | 3300049459 | Bacteria | 2745 |
| 774 | Ga0495682_0004188 | 3300049460 | Bacteria | 6247 |
| 775 | Ga0495682_0006113 | 3300049460 | Bacteria | 4909 |
| 776 | Ga0495682_0019640 | 3300049460 | Bacteria | 2540 |
| 777 | Ga0495682_0073603 | 3300049460 | Bacteria | 1229 |
| 778 | Ga0495682_0099947 | 3300049460 | Bacteria | 1040 |
| 779 | Ga0501241_000573 | 3300049758 | Bacteria | 7895 |
| 780 | Ga0501269_001400 | 3300049766 | Bacteria | 3149 |
| 781 | nmdc:mga03683_10946_c1 | 3300050489 | Bacteria | 3266 |
| 782 | nmdc:mga00v17_46459_c1 | 3300050491 | Bacteria | 2627 |
| 783 | nmdc:mga00v17_51036_c1 | 3300050491 | Bacteria | 2515 |
| 784 | nmdc:mga00v17_62635_c1 | 3300050491 | Bacteria | 2289 |
| 785 | nmdc:mga08x19_111018_c1 | 3300050514 | Bacteria | 1829 |
| 786 | Ga0500634_0012544 | 3300053161 | Bacteria | 4417 |
| 787 | 2511256229 | 2511231004 | Bacteria | 6669789 |
| 788 | 2511265750 | 2511231006 | Bacteria | 6794709 |
| 789 | 2511273703 | 2511231007 | Bacteria | 6306603 |
| 790 | 2511279666 | 2511231008 | Bacteria | 6624100 |
| 791 | 2511298864 | 2511231012 | Bacteria | 6738011 |
| 792 | 2511315294 | 2511231014 | Bacteria | 6462302 |
| 793 | 2511322180 | 2511231015 | Bacteria | 6598026 |
| 794 | 2511325309 | 2511231016 | Bacteria | 6704427 |
| 795 | 2511332291 | 2511231017 | Bacteria | 6503007 |
| 796 | 2511337730 | 2511231018 | Bacteria | 6436256 |
| 797 | 2511347373 | 2511231019 | Bacteria | 6520662 |
| 798 | 2511348066 | 2511231020 | Bacteria | 6115223 |
| 799 | 2511359210 | 2511231021 | Bacteria | 7302637 |
| 800 | 2511366068 | 2511231022 | Bacteria | 6719296 |
| 801 | 2511368877 | 2511231023 | Bacteria | 6808468 |
| 802 | 2512325271 | 2512047018 | Bacteria | 6663241 |
| 803 | 2555666987 | 2554235341 | Bacteria | 6867980 |
| 804 | 2583795370 | 2582580891 | Bacteria | 6800976 |
| 805 | 2597855237 | 2597489887 | Bacteria | 6666321 |
| 806 | 2597861239 | 2597489888 | Bacteria | 6179543 |
| 807 | 2597866986 | 2597489889 | Bacteria | 6297495 |
| 808 | 2599327784 | 2599185155 | Bacteria | 5827168 |
| 809 | 2599355607 | 2599185160 | Bacteria | 6844013 |
| 810 | 2599362990 | 2599185161 | Bacteria | 6960462 |
| 811 | 2599368704 | 2599185162 | Bacteria | 6957254 |
| 812 | 2599376099 | 2599185163 | Bacteria | 6995158 |
| 813 | 2599380713 | 2599185164 | Bacteria | 6841688 |
| 814 | 2599387771 | 2599185165 | Bacteria | 6843250 |
| 815 | 2599394957 | 2599185166 | Bacteria | 6959206 |
| 816 | 2599401126 | 2599185167 | Bacteria | 6353609 |
| 817 | 2599406722 | 2599185168 | Bacteria | 6997636 |
| 818 | 2599449541 | 2599185179 | Bacteria | 6611171 |
| 819 | 2599462441 | 2599185181 | Bacteria | 6844519 |
| 820 | 2599468136 | 2599185182 | Bacteria | 6883168 |
| 821 | 2599487363 | 2599185185 | Bacteria | 6652270 |
| 822 | 2599491458 | 2599185186 | Bacteria | 6831633 |
| 823 | 2599506066 | 2599185189 | Bacteria | 5862825 |
| 824 | 2599511613 | 2599185190 | Bacteria | 6285678 |
| 825 | 2599516587 | 2599185191 | Bacteria | 6297582 |
| 826 | 2599804281 | 2599185257 | Bacteria | 6492581 |
| 827 | 2599879360 | 2599185288 | Bacteria | 6666191 |
| 828 | 2599893116 | 2599185290 | Bacteria | 6289611 |
| 829 | 2599948694 | 2599185303 | Bacteria | 6512725 |
| 830 | 2600363153 | 2600254931 | Bacteria | 6734225 |
| 831 | 2601693313 | 2600255296 | Bacteria | 5784754 |
| 832 | 2601775229 | 2600255313 | Bacteria | 6842543 |
| 833 | 2621296506 | 2619619299 | Bacteria | 6649820 |
| 834 | 2624489443 | 2623620446 | Bacteria | 6500345 |
| 835 | 2643843432 | 2643221565 | Bacteria | 6216018 |
| 836 | 2643873529 | 2643221571 | Bacteria | 6228673 |
| 837 | 2643955977 | 2643221589 | Bacteria | 6250934 |
| 838 | 2644020099 | 2643221602 | Bacteria | 6249926 |
| 839 | 2644184107 | 2643221633 | Bacteria | 6733554 |
| 840 | 2644624454 | 2643221713 | Bacteria | 6554480 |
| 841 | 2671099631 | 2667528171 | Bacteria | 6900659 |
| 842 | 2671771290 | 2671180172 | Bacteria | 6495783 |
| 843 | 2677900430 | 2675903420 | Bacteria | 6247433 |
| 844 | 2715754446 | 2713897149 | Bacteria | 6506249 |
| 845 | 2723246143 | 2721755607 | Bacteria | 5841722 |
| 846 | 2738673452 | 2738541265 | Bacteria | 6594665 |
| 847 | 2738751845 | 2738541282 | Bacteria | 6593925 |
| 848 | 2738807584 | 2738541294 | Bacteria | 6925949 |
| 849 | 2738860886 | 2738541303 | Bacteria | 6591772 |
| 850 | 2738894944 | 2738541309 | Bacteria | 6926455 |
| 851 | 2739200895 | 2738543004 | Bacteria | 6381073 |
| 852 | 2739261721 | 2738543015 | Bacteria | 6750701 |
| 853 | 2743740808 | 2740892503 | Bacteria | 6855563 |
| 854 | 2774117971 | 2773857670 | Bacteria | 6407454 |
| 855 | 2774136596 | 2773857673 | Bacteria | 6513460 |
| 856 | 2784316458 | 2784132072 | Bacteria | 6596533 |
| 857 | 2808928052 | 2808606377 | Bacteria | 6646337 |
| 858 | 2808950766 | 2808606381 | Bacteria | 6646461 |
| 859 | 2808960731 | 2808606382 | Bacteria | 6841132 |
| 860 | 2808980105 | 2808606385 | Bacteria | 6711065 |
| 861 | 2808995825 | 2808606388 | Bacteria | 6706662 |
| 862 | 2809217625 | 2808606445 | Bacteria | 6057339 |
| 863 | 2817488015 | 2816332298 | Bacteria | 6852809 |
| 864 | 2819704778 | 2818991464 | Bacteria | 6907494 |
| 865 | 2834031272 | 2834028612 | Bacteria | 6354979 |
| 866 | 2842828433 | 2842826826 | Bacteria | 5974129 |
| 867 | 2842833846 | 2842832357 | Bacteria | 5959113 |
| 868 | 2842838246 | 2842837860 | Bacteria | 6066181 |
| 869 | 2842846074 | 2842843487 | Bacteria | 6004777 |
| 870 | 2844667472 | 2844665904 | Bacteria | 6817974 |
| 871 | 2852616671 | 2852612431 | Bacteria | 6885235 |
| 872 | 2852662672 | 2852657418 | Bacteria | 6472974 |
| 873 | 2852671639 | 2852667396 | Bacteria | 6885555 |
| 874 | 2860345310 | 2860339153 | Bacteria | 6846989 |
| 875 | 2860868039 | 2860867994 | Bacteria | 5645326 |
| 876 | 2880230764 | 2880230671 | Bacteria | 6140320 |
| 877 | 2904518547 | 2904518522 | Bacteria | 6068986 |
| 878 | 2904553496 | 2904550169 | Bacteria | 6221258 |
| 879 | 2908446617 | 2908446538 | Bacteria | 6829095 |
| 880 | 2917070721 | 2917070673 | Bacteria | 6868303 |
| 881 | 2919457962 | 2919456309 | Bacteria | 6586567 |
| 882 | 2919702352 | 2919697872 | Bacteria | 6553725 |
| 883 | 2923153640 | 2923153595 | Bacteria | 6870622 |
| 884 | 2929189922 | 2929189879 | Bacteria | 5930554 |
| 885 | 2931390983 | 2931390751 | Bacteria | 6273349 |
| 886 | 2931398509 | 2931396565 | Bacteria | 7251677 |
| 887 | 2935357944 | 2935353572 | Unclassified | 6955622 |
| 888 | 2939640467 | 2939636861 | Bacteria | 6297853 |
| 889 | 2945967192 | 2945961074 | Bacteria | 7342064 |
| 890 | 2946012909 | 2946006987 | Bacteria | 6705746 |
| 891 | 2946028227 | 2946027586 | Bacteria | 6049274 |
| 892 | 2947234749 | 2947233263 | Bacteria | 6439278 |
| 893 | 2974293673 | 2974289157 | Bacteria | 6080362 |
| 894 | 2984292475 | 2984286254 | Bacteria | 6702062 |
| 895 | 2998140136 | 2998139840 | Bacteria | 6073514 |
| 896 | 3007399036 | 3007395558 | Bacteria | 6755444 |
| 897 | 3007517548 | 3007511990 | Bacteria | 6481491 |
| 898 | 3007616983 | 3007614139 | Bacteria | 6053559 |
| 899 | 3007623872 | 3007619802 | Bacteria | 6411688 |
| 900 | 3007859588 | 3007855910 | Bacteria | 5637581 |
| 901 | 3007864684 | 3007861166 | Bacteria | 6045338 |
| 902 | 637317390 | 637000220 | Bacteria | 7074893 |
| 903 | 8015687900 | 8015687852 | Bacteria | 6613826 |
| 904 | 8019769434 | 8019769354 | Bacteria | 6924660 |
| 905 | 8019779575 | 8019775933 | Bacteria | 6858656 |
| 906 | 8029995116 | 8029995093 | Bacteria | 5990776 |
| 907 | 8054287247 | 8054285046 | Bacteria | 6919322 |
| 908 | 8054349268 | 8054347763 | Bacteria | 5901107 |
| 909 | 8055771000 | 8055770955 | Bacteria | 6827675 |
| 910 | 8055817953 | 8055817908 | Bacteria | 6609162 |
| 911 | 8056126148 | 8056125926 | Bacteria | 6228218 |
| 912 | 8056131922 | 8056131705 | Bacteria | 6107031 |
| 913 | 8056151179 | 8056148874 | Bacteria | 6479865 |
| 914 | 8056160126 | 8056155041 | Bacteria | 6486948 |
| 915 | 8056177046 | 8056172158 | Bacteria | 6133900 |
| 916 | 8056182351 | 8056177738 | Bacteria | 6748268 |
| 917 | 8056570863 | 8056569372 | Bacteria | 5997322 |
| 918 | Ga0495654_0029812 | |||
| 919 | MRS2a_Contig_126 | |||
| 920 | JGI25162J39368_1000185 | |||
| 921 | JGI25162J39368_1000219 | |||
| 922 | JGI25163J39215_1000823 | |||
| 923 | JGI25163J39215_1000834 | |||
| 924 | JGI25164J39214_1000175 | |||
| 925 | JGI25165J46597_1000175 | |||
| 926 | JGI25165J46597_1000193 | |||
| 927 | Ga0055538_1000012 | |||
| 928 | Ga0055539_1000017 | |||
| 929 | Ga0055533_1000021 | |||
| 930 | Ga0055532_1000020 | |||
| 931 | Ga0055525_1000117 | |||
| 932 | Ga0055535_1002840 | |||
| 933 | Ga0055536_1000237 | |||
| 934 | Ga0055536_1000241 | |||
| 935 | Ga0055530_10000159 | |||
| 936 | Ga0055540_1000378 | |||
| 937 | Ga0055540_1000725 | |||
| 938 | Ga0055541_1000012 | |||
| 939 | Ga0065714_10000191 | |||
| 940 | Ga0065714_10005418 | |||
| 941 | Ga0065714_10066629 | |||
| 942 | Ga0065714_10082121 | |||
| 943 | Ga0065714_10127279 | |||
| 944 | Ga0065704_10167645 | |||
| 945 | Ga0070670_100000258 | |||
| 946 | Ga0070670_100001386 | |||
| 947 | Ga0070661_100000146 | |||
| 948 | Ga0070669_100000153 | |||
| 949 | Ga0070662_100005956 | |||
| 950 | Ga0070662_100064104 | |||
| 951 | Ga0068853_100000184 | |||
| 952 | Ga0070665_100037664 | |||
| 953 | Ga0070664_100000049 | |||
| 954 | Ga0070664_100060694 | |||
| 955 | Ga0068851_10000018 | |||
| 956 | Ga0075364_10087404 | |||
| 957 | Ga0075432_10012519 | |||
| 958 | Ga0075432_10062015 | |||
| 959 | Ga0075362_10098534 | |||
| 960 | Ga0075436_100042695 | |||
| 961 | Ga0079104_1000735 | |||
| 962 | Ga0105251_10001924 | |||
| 963 | Ga0105251_10006951 | |||
| 964 | Ga0105251_10014141 | |||
| 965 | Ga0105244_10000186 | |||
| 966 | Ga0105244_10001003 | |||
| 967 | Ga0105244_10007387 | |||
| 968 | Ga0105244_10009695 | |||
| 969 | Ga0105244_10128377 | |||
| 970 | Ga0105250_10015261 | |||
| 971 | Ga0105250_10018871 | |||
| 972 | Ga0105250_10031667 | |||
| 973 | Ga0105243_10000075 | |||
| 974 | Ga0105243_10000862 | |||
| 975 | Ga0105243_10008056 | |||
| 976 | Ga0105243_10020990 | |||
| 977 | Ga0105243_10144963 | |||
| 978 | Ga0105242_10001632 | |||
| 979 | Ga0105242_10005717 | |||
| 980 | Ga0105248_10002239 | |||
| 981 | Ga0105237_10002463 | |||
| 982 | Ga0105249_10010831 | |||
| 983 | Ga0105246_10000958 | |||
| 984 | Ga0105246_10003117 | |||
| 985 | Ga0105246_10009773 | |||
| 986 | Ga0157345_1000542 | |||
| 987 | Ga0157373_10008757 | |||
| 988 | Ga0157373_10013063 | |||
| 989 | Ga0157373_10018433 | |||
| 990 | Ga0157373_10028306 | |||
| 991 | Ga0157373_10029749 | |||
| 992 | Ga0157373_10031891 | |||
| 993 | Ga0157371_10001263 | |||
| 994 | Ga0157371_10012076 | |||
| 995 | Ga0157371_10061080 | |||
| 996 | Ga0157370_10019275 | |||
| 997 | Ga0157370_10111586 | |||
| 998 | Ga0157369_10018609 | |||
| 999 | Ga0157369_10059449 | |||
| 1000 | Ga0157369_10134462 | |||
| 1001 | Ga0157369_10137913 | |||
| 1002 | Ga0157369_10380808 | |||
| 1003 | Ga0157375_10013471 | |||
| 1004 | Ga0157375_10019265 | |||
| 1005 | Ga0182008_10000367 | |||
| 1006 | Ga0182008_10004974 | |||
| 1007 | Ga0182008_10008487 | |||
| 1008 | Ga0182008_10019285 | |||
| 1009 | Ga0182008_10025932 | |||
| 1010 | Ga0182006_1000961 | |||
| 1011 | Ga0182006_1005096 | |||
| 1012 | Ga0182007_10000742 | |||
| 1013 | Ga0182005_1000885 | |||
| 1014 | Ga0163161_10007642 | |||
| 1015 | Ga0163161_10019012 | |||
| 1016 | Ga0163161_10020244 | |||
| 1017 | Ga0163161_10037102 | |||
| 1018 | Ga0163161_10039705 | |||
| 1019 | Ga0163161_10047063 | |||
| 1020 | Ga0163161_10274463 | |||
| 1021 | Ga0209435_101384 | |||
| 1022 | Ga0209760_100020 | |||
| 1023 | Ga0209760_100082 | |||
| 1024 | Ga0209784_100007 | |||
| 1025 | Ga0209566_100009 | |||
| 1026 | Ga0209674_100021 | |||
| 1027 | Ga0209147_100009 | |||
| 1028 | Ga0209563_100018 | |||
| 1029 | Ga0207427_100005 | |||
| 1030 | Ga0207427_100006 | |||
| 1031 | Ga0209437_100013 | |||
| 1032 | Ga0209437_100018 | |||
| 1033 | Ga0209258_100237 | |||
| 1034 | Ga0209646_1000442 | |||
| 1035 | Ga0209677_100012 | |||
| 1036 | Ga0209759_1006997 | |||
| 1037 | Ga0209233_1000021 | |||
| 1038 | Ga0209233_1000022 | |||
| 1039 | Ga0209676_1000015 | |||
| 1040 | Ga0209676_1000157 | |||
| 1041 | Ga0209676_1000222 | |||
| 1042 | Ga0209676_1003038 | |||
| 1043 | Ga0209050_1000030 | |||
| 1044 | Ga0209050_1000296 | |||
| 1045 | Ga0209050_1001068 | |||
| 1046 | Ga0209051_1000143 | |||
| 1047 | Ga0209051_1000295 | |||
| 1048 | Ga0209257_1000422 | |||
| 1049 | Ga0207656_10000009 | |||
| 1050 | Ga0207696_1000165 | |||
| 1051 | Ga0207696_1003213 | |||
| 1052 | Ga0207655_1000135 | |||
| 1053 | Ga0207655_1000652 | |||
| 1054 | Ga0207655_1000961 | |||
| 1055 | Ga0207655_1006175 | |||
| 1056 | Ga0207655_1006536 | |||
| 1057 | Ga0207655_1011532 | |||
| 1058 | Ga0207655_1023395 | |||
| 1059 | Ga0207713_1000692 | |||
| 1060 | Ga0207713_1001400 | |||
| 1061 | Ga0207713_1001900 | |||
| 1062 | Ga0207713_1002728 | |||
| 1063 | Ga0207713_1003858 | |||
| 1064 | Ga0207713_1004885 | |||
| 1065 | Ga0207713_1007816 | |||
| 1066 | Ga0207713_1014386 | |||
| 1067 | Ga0207713_1021307 | |||
| 1068 | Ga0207671_10000713 | |||
| 1069 | Ga0207649_10000007 | |||
| 1070 | Ga0207681_10000163 | |||
| 1071 | Ga0207650_10000178 | |||
| 1072 | Ga0207650_10000210 | |||
| 1073 | Ga0207706_10000050 | |||
| 1074 | Ga0207706_10002848 | |||
| 1075 | Ga0207686_10028645 | |||
| 1076 | Ga0207709_10000269 | |||
| 1077 | Ga0207709_10004904 | |||
| 1078 | Ga0207709_10024799 | |||
| 1079 | Ga0207709_10045434 | |||
| 1080 | Ga0207709_10097616 | |||
| 1081 | Ga0207711_10006135 | |||
| 1082 | Ga0207679_10000013 | |||
| 1083 | Ga0207679_10015924 | |||
| 1084 | Ga0207712_10056233 | |||
| 1085 | Ga0207640_10040090 | |||
| 1086 | Ga0207639_10000079 | |||
| 1087 | Ga0209281_1000237 | |||
| 1088 | Ga0207428_10021747 | |||
| 1089 | Ga0207428_10056099 | |||
| 1090 | Ga0207428_10058422 | |||
| 1091 | Ga0207428_10062871 | |||
| 1092 | Ga0207428_10192579 | |||
| 1093 | Ga0207428_10268625 | |||
| 1094 | Ga0207428_10283735 | |||
| 1095 | Ga0307517_10057686 | |||
| 1096 | Ga0307511_10019783 | |||
| 1097 | Ga0307509_10021696 | |||
| 1098 | Ga0307408_100005159 | |||
| 1099 | Ga0307405_10000636 | |||
| 1100 | Ga0307405_10003329 | |||
| 1101 | Ga0307412_10017529 | |||
| 1102 | Ga0307412_10033246 | |||
| 1103 | Ga0307412_10057313 | |||
| 1104 | Ga0307416_100137823 | |||
| 1105 | Ga0307416_100169459 | |||
| 1106 | Ga0307414_10185343 | |||
| 1107 | Ga0307411_10117986 | |||
| 1108 | Ga0439438_000219 | |||
| 1109 | Ga0439438_000524 | |||
| 1110 | Ga0439438_000670 | |||
| 1111 | Ga0439438_001361 | |||
| 1112 | Ga0439438_002846 | |||
| 1113 | Ga0439438_002857 | |||
| 1114 | Ga0439438_004228 | |||
| 1115 | Ga0439438_005183 | |||
| 1116 | Ga0439438_007380 | |||
| 1117 | Ga0439438_012022 | |||
| 1118 | Ga0439438_012781 | |||
| 1119 | Ga0439447_000330 | |||
| 1120 | Ga0439447_000528 | |||
| 1121 | Ga0439447_000718 | |||
| 1122 | Ga0439447_001703 | |||
| 1123 | Ga0439447_005265 | |||
| 1124 | Ga0439447_022180 | |||
| 1125 | Ga0439461_0002057 | |||
| 1126 | Ga0439466_0000612 | |||
| 1127 | Ga0439466_0000697 | |||
| 1128 | Ga0439466_0002918 | |||
| 1129 | Ga0439466_0003428 | |||
| 1130 | Ga0439466_0004041 | |||
| 1131 | Ga0439466_0005067 | |||
| 1132 | Ga0439466_0007280 | |||
| 1133 | Ga0439466_0018241 | |||
| 1134 | Ga0439466_0024071 | |||
| 1135 | Ga0439465_0001504 | |||
| 1136 | Ga0451841_0345081 | |||
| 1137 | Ga0439445_0010898 | |||
| 1138 | Ga0439445_0014340 | |||
| 1139 | Ga0439432_000934 | |||
| 1140 | Ga0439432_003995 | |||
| 1141 | Ga0439432_006064 | |||
| 1142 | Ga0439432_010655 | |||
| 1143 | Ga0439432_011893 | |||
| 1144 | Ga0439432_021636 | |||
| 1145 | Ga0439432_036142 | |||
| 1146 | Ga0439451_000629 | |||
| 1147 | Ga0439451_000701 | |||
| 1148 | Ga0439451_001253 | |||
| 1149 | Ga0439451_005067 | |||
| 1150 | Ga0439451_005297 | |||
| 1151 | Ga0439451_006692 | |||
| 1152 | Ga0439452_000352 | |||
| 1153 | Ga0439452_000435 | |||
| 1154 | Ga0439452_000563 | |||
| 1155 | Ga0439452_001007 | |||
| 1156 | Ga0439452_001505 | |||
| 1157 | Ga0439452_001897 | |||
| 1158 | Ga0439452_003511 | |||
| 1159 | Ga0439452_013819 | |||
| 1160 | Ga0439452_013883 | |||
| 1161 | Ga0439452_018751 | |||
| 1162 | Ga0439456_001509 | |||
| 1163 | Ga0439456_002453 | |||
| 1164 | Ga0439456_009492 | |||
| 1165 | Ga0439456_014382 | |||
| 1166 | Ga0439456_016318 | |||
| 1167 | Ga0439456_026799 | |||
| 1168 | Ga0439463_000640 | |||
| 1169 | Ga0439463_003554 | |||
| 1170 | Ga0439463_014202 | |||
| 1171 | Ga0450911_000393 | |||
| 1172 | Ga0450911_000919 | |||
| 1173 | Ga0450911_001252 | |||
| 1174 | Ga0450911_002598 | |||
| 1175 | Ga0450911_004078 | |||
| 1176 | Ga0450911_005338 | |||
| 1177 | Ga0450919_000148 | |||
| 1178 | Ga0450921_000776 | |||
| 1179 | Ga0450922_000807 | |||
| 1180 | Ga0450922_000819 | |||
| 1181 | Ga0450922_001375 | |||
| 1182 | Ga0450923_000577 | |||
| 1183 | Ga0450890_000098 | |||
| 1184 | Ga0450894_001932 | |||
| 1185 | Ga0450896_011801 | |||
| 1186 | Ga0450898_000863 | |||
| 1187 | Ga0450899_001832 | |||
| 1188 | Ga0450900_000564 | |||
| 1189 | Ga0450900_008617 | |||
| 1190 | Ga0450902_002154 | |||
| 1191 | Ga0450902_004796 | |||
| 1192 | Ga0450902_005659 | |||
| 1193 | Ga0450903_000427 | |||
| 1194 | Ga0450903_000585 | |||
| 1195 | Ga0450903_001352 | |||
| 1196 | Ga0450903_004383 | |||
| 1197 | Ga0450903_008713 | |||
| 1198 | Ga0450904_001450 | |||
| 1199 | Ga0450904_001615 | |||
| 1200 | Ga0450905_001236 | |||
| 1201 | Ga0450905_012465 | |||
| 1202 | Ga0450906_000615 | |||
| 1203 | Ga0450906_000778 | |||
| 1204 | Ga0450906_002850 | |||
| 1205 | Ga0450906_004020 | |||
| 1206 | Ga0450906_015212 | |||
| 1207 | Ga0450907_000357 | |||
| 1208 | Ga0450907_001563 | |||
| 1209 | Ga0450907_003076 | |||
| 1210 | Ga0450910_000138 | |||
| 1211 | Ga0439446_0010265 | |||
| 1212 | Ga0439446_0019297 | |||
| 1213 | Ga0450908_000519 | |||
| 1214 | Ga0450909_000324 | |||
| 1215 | Ga0450909_000548 | |||
| 1216 | Ga0450909_005786 | |||
| 1217 | Ga0450909_007184 | |||
| 1218 | Ga0450909_009958 | |||
| 1219 | Ga0439434_0000177 | |||
| 1220 | Ga0439434_0013925 | |||
| 1221 | Ga0439464_0008473 | |||
| 1222 | Ga0439460_0000220 | |||
| 1223 | Ga0439460_0000423 | |||
| 1224 | Ga0439460_0009759 | |||
| 1225 | Ga0450918_000835 | |||
| 1226 | Ga0450918_010120 | |||
| 1227 | Ga0450893_0009252 | |||
| 1228 | Ga0450893_0013584 | |||
| 1229 | Ga0450901_000636 | |||
| 1230 | Ga0439440_0000589 | |||
| 1231 | Ga0439440_0000879 | |||
| 1232 | Ga0439440_0004943 | |||
| 1233 | Ga0495617_000380 | |||
| 1234 | Ga0495617_004640 | |||
| 1235 | Ga0495617_011245 | |||
| 1236 | Ga0495617_020728 | |||
| 1237 | Ga0495617_037361 | |||
| 1238 | Ga0495627_009991 | |||
| 1239 | Ga0495627_047213 | |||
| 1240 | Ga0495592_0028435 | |||
| 1241 | Ga0495603_0028467 | |||
| 1242 | Ga0495590_0002177 | |||
| 1243 | Ga0495590_0003420 | |||
| 1244 | Ga0495590_0012662 | |||
| 1245 | Ga0495590_0031926 | |||
| 1246 | Ga0495591_001346 | |||
| 1247 | Ga0495591_002535 | |||
| 1248 | Ga0495591_002732 | |||
| 1249 | Ga0495591_005229 | |||
| 1250 | Ga0495591_005358 | |||
| 1251 | Ga0495591_006966 | |||
| 1252 | Ga0495591_011465 | |||
| 1253 | Ga0495591_020295 | |||
| 1254 | Ga0495591_026471 | |||
| 1255 | Ga0495591_030469 | |||
| 1256 | Ga0495629_0010277 | |||
| 1257 | Ga0495638_0001277 | |||
| 1258 | Ga0495638_0002273 | |||
| 1259 | Ga0495638_0006882 | |||
| 1260 | Ga0495638_0009395 | |||
| 1261 | Ga0495638_0010042 | |||
| 1262 | Ga0495638_0021715 | |||
| 1263 | Ga0495638_0021951 | |||
| 1264 | Ga0495638_0030603 | |||
| 1265 | Ga0495638_0057394 | |||
| 1266 | Ga0495638_0058965 | |||
| 1267 | Ga0495638_0060638 | |||
| 1268 | Ga0495638_0078147 | |||
| 1269 | Ga0495653_0015864 | |||
| 1270 | Ga0495653_0088963 | |||
| 1271 | Ga0495650_0002307 | |||
| 1272 | Ga0495650_0006133 | |||
| 1273 | Ga0495650_0006144 | |||
| 1274 | Ga0495650_0007734 | |||
| 1275 | Ga0495650_0008201 | |||
| 1276 | Ga0495650_0012706 | |||
| 1277 | Ga0495582_0005461 | |||
| 1278 | Ga0495605_0001019 | |||
| 1279 | Ga0495605_0001927 | |||
| 1280 | Ga0495605_0014437 | |||
| 1281 | Ga0495605_0016429 | |||
| 1282 | Ga0495605_0022127 | |||
| 1283 | Ga0495605_0026693 | |||
| 1284 | Ga0495605_0033316 | |||
| 1285 | Ga0495639_0000239 | |||
| 1286 | Ga0495639_0007862 | |||
| 1287 | Ga0495584_0001101 | |||
| 1288 | Ga0495584_0004243 | |||
| 1289 | Ga0495584_0004614 | |||
| 1290 | Ga0495584_0008756 | |||
| 1291 | Ga0495584_0009005 | |||
| 1292 | Ga0495584_0013224 | |||
| 1293 | Ga0495584_0026328 | |||
| 1294 | Ga0495584_0037943 | |||
| 1295 | Ga0495584_0046743 | |||
| 1296 | Ga0495585_0000800 | |||
| 1297 | Ga0495585_0005089 | |||
| 1298 | Ga0495585_0006078 | |||
| 1299 | Ga0495585_0011791 | |||
| 1300 | Ga0495585_0015035 | |||
| 1301 | Ga0495585_0017059 | |||
| 1302 | Ga0495594_0004919 | |||
| 1303 | Ga0495594_0024156 | |||
| 1304 | Ga0495596_0000482 | |||
| 1305 | Ga0495607_0002401 | |||
| 1306 | Ga0495607_0002489 | |||
| 1307 | Ga0495607_0005282 | |||
| 1308 | Ga0495607_0006775 | |||
| 1309 | Ga0495607_0009819 | |||
| 1310 | Ga0495607_0012460 | |||
| 1311 | Ga0495607_0015455 | |||
| 1312 | Ga0495607_0016962 | |||
| 1313 | Ga0495607_0019527 | |||
| 1314 | Ga0495607_0032397 | |||
| 1315 | Ga0495607_0038022 | |||
| 1316 | Ga0495607_0069210 | |||
| 1317 | Ga0495607_0084703 | |||
| 1318 | Ga0495607_0119569 | |||
| 1319 | Ga0495583_0001586 | |||
| 1320 | Ga0495583_0004250 | |||
| 1321 | Ga0495583_0004393 | |||
| 1322 | Ga0495583_0006442 | |||
| 1323 | Ga0495583_0033253 | |||
| 1324 | Ga0495583_0040636 | |||
| 1325 | Ga0495583_0060815 | |||
| 1326 | Ga0495606_0003551 | |||
| 1327 | Ga0495606_0043025 | |||
| 1328 | Ga0495606_0058740 | |||
| 1329 | Ga0495610_0007502 | |||
| 1330 | Ga0495610_0008055 | |||
| 1331 | Ga0495610_0008473 | |||
| 1332 | Ga0495610_0008706 | |||
| 1333 | Ga0495610_0010757 | |||
| 1334 | Ga0495610_0011663 | |||
| 1335 | Ga0495610_0012437 | |||
| 1336 | Ga0495610_0022945 | |||
| 1337 | Ga0495610_0027408 | |||
| 1338 | Ga0495610_0067786 | |||
| 1339 | Ga0495610_0090013 | |||
| 1340 | Ga0495616_0001775 | |||
| 1341 | Ga0495616_0002772 | |||
| 1342 | Ga0495616_0008776 | |||
| 1343 | Ga0495616_0009840 | |||
| 1344 | Ga0495616_0013579 | |||
| 1345 | Ga0495620_0005558 | |||
| 1346 | Ga0495620_0006144 | |||
| 1347 | Ga0495620_0009264 | |||
| 1348 | Ga0495620_0013538 | |||
| 1349 | Ga0495620_0023108 | |||
| 1350 | Ga0495620_0062000 | |||
| 1351 | Ga0495628_0032258 | |||
| 1352 | Ga0495630_0018688 | |||
| 1353 | Ga0495630_0041876 | |||
| 1354 | Ga0495631_0001056 | |||
| 1355 | Ga0495631_0005870 | |||
| 1356 | Ga0495631_0014280 | |||
| 1357 | Ga0495631_0018963 | |||
| 1358 | Ga0495631_0038078 | |||
| 1359 | Ga0495631_0099249 | |||
| 1360 | Ga0495632_0000952 | |||
| 1361 | Ga0495632_0002331 | |||
| 1362 | Ga0495632_0005690 | |||
| 1363 | Ga0495632_0007116 | |||
| 1364 | Ga0495632_0009059 | |||
| 1365 | Ga0495632_0011397 | |||
| 1366 | Ga0495632_0020593 | |||
| 1367 | Ga0495632_0028343 | |||
| 1368 | Ga0495632_0032030 | |||
| 1369 | Ga0495637_0001352 | |||
| 1370 | Ga0495637_0001869 | |||
| 1371 | Ga0495637_0003492 | |||
| 1372 | Ga0495637_0003821 | |||
| 1373 | Ga0495637_0003957 | |||
| 1374 | Ga0495637_0005807 | |||
| 1375 | Ga0495637_0008564 | |||
| 1376 | Ga0495637_0010076 | |||
| 1377 | Ga0495637_0010768 | |||
| 1378 | Ga0495637_0015538 | |||
| 1379 | Ga0495637_0015950 | |||
| 1380 | Ga0495637_0024646 | |||
| 1381 | Ga0495637_0036009 | |||
| 1382 | Ga0495637_0061921 | |||
| 1383 | Ga0495637_0116538 | |||
| 1384 | Ga0495643_0005972 | |||
| 1385 | Ga0495643_0010329 | |||
| 1386 | Ga0495643_0018189 | |||
| 1387 | Ga0495643_0030872 | |||
| 1388 | Ga0495643_0033926 | |||
| 1389 | Ga0495644_0002846 | |||
| 1390 | Ga0495644_0003449 | |||
| 1391 | Ga0495644_0025640 | |||
| 1392 | Ga0495644_0047487 | |||
| 1393 | Ga0495644_0066360 | |||
| 1394 | Ga0495648_0001218 | |||
| 1395 | Ga0495648_0002655 | |||
| 1396 | Ga0495648_0002978 | |||
| 1397 | Ga0495648_0011516 | |||
| 1398 | Ga0495648_0018746 | |||
| 1399 | Ga0495648_0026763 | |||
| 1400 | Ga0495648_0048081 | |||
| 1401 | Ga0495648_0061142 | |||
| 1402 | Ga0495648_0067227 | |||
| 1403 | Ga0495648_0137751 | |||
| 1404 | Ga0495666_0001740 | |||
| 1405 | Ga0495666_0009683 | |||
| 1406 | Ga0495666_0058101 | |||
| 1407 | Ga0495642_0000291 | |||
| 1408 | Ga0495642_0000368 | |||
| 1409 | Ga0495642_0000824 | |||
| 1410 | Ga0495654_0001864 | |||
| 1411 | Ga0495654_0003754 | |||
| 1412 | Ga0495654_0004474 | |||
| 1413 | Ga0495654_0005730 | |||
| 1414 | Ga0495654_0006406 | |||
| 1415 | Ga0495654_0013249 | |||
| 1416 | Ga0495654_0018219 | |||
| 1417 | Ga0495654_0021050 | |||
| 1418 | Ga0495654_0025082 | |||
| 1419 | Ga0495654_0025483 | |||
| 1420 | Ga0495654_0032823 | |||
| 1421 | Ga0495654_0038894 | |||
| 1422 | Ga0495654_0080741 | |||
| 1423 | Ga0495654_0107427 | |||
| 1424 | Ga0495586_0002791 | |||
| 1425 | Ga0495587_0013048 | |||
| 1426 | Ga0495609_0000100 | |||
| 1427 | Ga0495609_0000756 | |||
| 1428 | Ga0495609_0003116 | |||
| 1429 | Ga0495609_0012155 | |||
| 1430 | Ga0495609_0073713 | |||
| 1431 | Ga0495597_0002530 | |||
| 1432 | Ga0495597_0004102 | |||
| 1433 | Ga0495597_0006520 | |||
| 1434 | Ga0495597_0007772 | |||
| 1435 | Ga0495597_0014685 | |||
| 1436 | Ga0495597_0015333 | |||
| 1437 | Ga0495597_0030984 | |||
| 1438 | Ga0495597_0043551 | |||
| 1439 | Ga0495597_0067048 | |||
| 1440 | Ga0495597_0069570 | |||
| 1441 | Ga0495622_0000466 | |||
| 1442 | Ga0495622_0013943 | |||
| 1443 | Ga0495622_0043015 | |||
| 1444 | Ga0495633_0007867 | |||
| 1445 | Ga0495633_0039511 | |||
| 1446 | Ga0495633_0109900 | |||
| 1447 | Ga0495656_0019846 | |||
| 1448 | Ga0495656_0094468 | |||
| 1449 | Ga0495668_0002000 | |||
| 1450 | Ga0495668_0015266 | |||
| 1451 | Ga0495668_0019541 | |||
| 1452 | Ga0495668_0153447 | |||
| 1453 | Ga0495634_0002187 | |||
| 1454 | Ga0495634_0024645 | |||
| 1455 | Ga0495611_0002835 | |||
| 1456 | Ga0495611_0010434 | |||
| 1457 | Ga0495611_0020505 | |||
| 1458 | Ga0495611_0032433 | |||
| 1459 | Ga0495611_0071639 | |||
| 1460 | Ga0495625_0011945 | |||
| 1461 | Ga0495625_0011959 | |||
| 1462 | Ga0495625_0015042 | |||
| 1463 | Ga0495625_0030255 | |||
| 1464 | Ga0495625_0039694 | |||
| 1465 | Ga0495625_0044214 | |||
| 1466 | Ga0495635_0001369 | |||
| 1467 | Ga0495635_0003679 | |||
| 1468 | Ga0495659_0000386 | |||
| 1469 | Ga0495659_0014280 | |||
| 1470 | Ga0495661_0000315 | |||
| 1471 | Ga0495661_0001817 | |||
| 1472 | Ga0495661_0008570 | |||
| 1473 | Ga0495661_0010510 | |||
| 1474 | Ga0495661_0011035 | |||
| 1475 | Ga0495661_0021815 | |||
| 1476 | Ga0495661_0043871 | |||
| 1477 | Ga0495661_0059351 | |||
| 1478 | Ga0495661_0176952 | |||
| 1479 | Ga0495588_0005649 | |||
| 1480 | Ga0495588_0024833 | |||
| 1481 | Ga0495588_0119280 | |||
| 1482 | Ga0495657_0037624 | |||
| 1483 | Ga0495599_0117289 | |||
| 1484 | Ga0495623_0006299 | |||
| 1485 | Ga0495646_0004999 | |||
| 1486 | Ga0495646_0005503 | |||
| 1487 | Ga0495646_0052624 | |||
| 1488 | Ga0495669_0012931 | |||
| 1489 | Ga0495613_0012685 | |||
| 1490 | Ga0495613_0019037 | |||
| 1491 | Ga0495613_0087878 | |||
| 1492 | Ga0495624_0007321 | |||
| 1493 | Ga0495670_0001360 | |||
| 1494 | Ga0495670_0003504 | |||
| 1495 | Ga0495670_0027151 | |||
| 1496 | Ga0495670_0101608 | |||
| 1497 | Ga0495671_0000561 | |||
| 1498 | Ga0495671_0003513 | |||
| 1499 | Ga0495671_0006513 | |||
| 1500 | Ga0495671_0007357 | |||
| 1501 | Ga0495671_0015217 | |||
| 1502 | Ga0495671_0040873 | |||
| 1503 | Ga0495671_0051653 | |||
| 1504 | Ga0495671_0146508 | |||
| 1505 | Ga0495649_0002380 | |||
| 1506 | Ga0495649_0006593 | |||
| 1507 | Ga0495649_0010762 | |||
| 1508 | Ga0495649_0015943 | |||
| 1509 | Ga0495649_0016014 | |||
| 1510 | Ga0495649_0018731 | |||
| 1511 | Ga0495649_0019782 | |||
| 1512 | Ga0495649_0022741 | |||
| 1513 | Ga0495649_0050279 | |||
| 1514 | Ga0495649_0101892 | |||
| 1515 | Ga0495649_0179611 | |||
| 1516 | Ga0495589_0000245 | |||
| 1517 | Ga0495589_0003887 | |||
| 1518 | Ga0495589_0007773 | |||
| 1519 | Ga0495589_0015693 | |||
| 1520 | Ga0495589_0025523 | |||
| 1521 | Ga0495600_0010835 | |||
| 1522 | Ga0495600_0051884 | |||
| 1523 | Ga0495600_0206549 | |||
| 1524 | Ga0495660_0012913 | |||
| 1525 | Ga0495660_0013059 | |||
| 1526 | Ga0495660_0019022 | |||
| 1527 | Ga0495660_0019900 | |||
| 1528 | Ga0495660_0025267 | |||
| 1529 | Ga0495660_0041150 | |||
| 1530 | Ga0495660_0043776 | |||
| 1531 | Ga0495660_0061363 | |||
| 1532 | Ga0495660_0082025 | |||
| 1533 | Ga0495660_0105594 | |||
| 1534 | Ga0495581_0009340 | |||
| 1535 | Ga0495581_0017302 | |||
| 1536 | Ga0495604_0003119 | |||
| 1537 | Ga0495604_0003340 | |||
| 1538 | Ga0495604_0023935 | |||
| 1539 | Ga0495636_0000767 | |||
| 1540 | Ga0495674_0026804 | |||
| 1541 | Ga0495672_0001274 | |||
| 1542 | Ga0495672_0003072 | |||
| 1543 | Ga0495672_0003235 | |||
| 1544 | Ga0495672_0006568 | |||
| 1545 | Ga0495672_0010052 | |||
| 1546 | Ga0495672_0010264 | |||
| 1547 | Ga0495672_0018080 | |||
| 1548 | Ga0495672_0020197 | |||
| 1549 | Ga0495672_0024320 | |||
| 1550 | Ga0495672_0024661 | |||
| 1551 | Ga0495672_0030403 | |||
| 1552 | Ga0495672_0039762 | |||
| 1553 | Ga0495672_0087541 | |||
| 1554 | Ga0495672_0100304 | |||
| 1555 | Ga0495676_0026135 | |||
| 1556 | Ga0495680_0002200 | |||
| 1557 | Ga0495680_0021720 | |||
| 1558 | Ga0495680_0023204 | |||
| 1559 | Ga0495680_0029728 | |||
| 1560 | Ga0495683_0001158 | |||
| 1561 | Ga0495683_0001356 | |||
| 1562 | Ga0495683_0006437 | |||
| 1563 | Ga0495683_0042390 | |||
| 1564 | Ga0495683_0051557 | |||
| 1565 | Ga0495683_0107968 | |||
| 1566 | Ga0495687_001396 | |||
| 1567 | Ga0495687_002321 | |||
| 1568 | Ga0495675_0016178 | |||
| 1569 | Ga0495675_0042006 | |||
| 1570 | Ga0495677_0003583 | |||
| 1571 | Ga0495677_0050606 | |||
| 1572 | Ga0495679_003553 | |||
| 1573 | Ga0495679_005105 | |||
| 1574 | Ga0495679_005606 | |||
| 1575 | Ga0495679_008438 | |||
| 1576 | Ga0495679_011316 | |||
| 1577 | Ga0495679_012815 | |||
| 1578 | Ga0495679_029115 | |||
| 1579 | Ga0495685_012043 | |||
| 1580 | Ga0495685_014978 | |||
| 1581 | Ga0495673_0001264 | |||
| 1582 | Ga0495673_0002023 | |||
| 1583 | Ga0495673_0002502 | |||
| 1584 | Ga0495673_0002635 | |||
| 1585 | Ga0495673_0003580 | |||
| 1586 | Ga0495673_0005113 | |||
| 1587 | Ga0495673_0005115 | |||
| 1588 | Ga0495673_0006415 | |||
| 1589 | Ga0495673_0006429 | |||
| 1590 | Ga0495673_0009010 | |||
| 1591 | Ga0495673_0011140 | |||
| 1592 | Ga0495673_0013147 | |||
| 1593 | Ga0495673_0087299 | |||
| 1594 | Ga0495681_0000692 | |||
| 1595 | Ga0495681_0004652 | |||
| 1596 | Ga0495681_0004750 | |||
| 1597 | Ga0495681_0005133 | |||
| 1598 | Ga0495681_0008475 | |||
| 1599 | Ga0495681_0009464 | |||
| 1600 | Ga0495681_0012042 | |||
| 1601 | Ga0495681_0018491 | |||
| 1602 | Ga0495681_0020123 | |||
| 1603 | Ga0495681_0021753 | |||
| 1604 | Ga0495681_0029926 | |||
| 1605 | Ga0495681_0084064 | |||
| 1606 | Ga0495681_0144730 | |||
| 1607 | Ga0495684_0014275 | |||
| 1608 | Ga0495686_0008623 | |||
| 1609 | Ga0495686_0063547 | |||
| 1610 | Ga0495593_0003540 | |||
| 1611 | Ga0495593_0015671 | |||
| 1612 | Ga0495593_0035663 | |||
| 1613 | Ga0495593_0039078 | |||
| 1614 | Ga0495593_0130099 | |||
| 1615 | Ga0495602_0021898 | |||
| 1616 | Ga0495626_0000941 | |||
| 1617 | Ga0495626_0000945 | |||
| 1618 | Ga0495626_0001363 | |||
| 1619 | Ga0495626_0001521 | |||
| 1620 | Ga0495626_0005270 | |||
| 1621 | Ga0495626_0006295 | |||
| 1622 | Ga0495626_0013180 | |||
| 1623 | Ga0495626_0027677 | |||
| 1624 | Ga0495626_0030728 | |||
| 1625 | Ga0496102_0002217 | |||
| 1626 | Ga0496103_0005207 | |||
| 1627 | Ga0496106_0101769 | |||
| 1628 | Ga0496107_0042718 | |||
| 1629 | Ga0496112_0040329 | |||
| 1630 | Ga0496114_0279121 | |||
| 1631 | Ga0496115_0016158 | |||
| 1632 | Ga0496116_0000242 | |||
| 1633 | Ga0496116_0001730 | |||
| 1634 | Ga0496116_0005949 | |||
| 1635 | Ga0496116_0134661 | |||
| 1636 | Ga0496117_0000270 | |||
| 1637 | Ga0496117_0002501 | |||
| 1638 | Ga0496117_0011018 | |||
| 1639 | Ga0496117_0021059 | |||
| 1640 | Ga0496117_0042727 | |||
| 1641 | Ga0496117_0049779 | |||
| 1642 | Ga0496118_0004563 | |||
| 1643 | Ga0496118_0023391 | |||
| 1644 | Ga0496118_0031917 | |||
| 1645 | Ga0496118_0038936 | |||
| 1646 | Ga0496118_0055627 | |||
| 1647 | Ga0496119_0196566 | |||
| 1648 | Ga0496120_0027062 | |||
| 1649 | Ga0496120_0035592 | |||
| 1650 | Ga0496121_0000318 | |||
| 1651 | Ga0496121_0021091 | |||
| 1652 | Ga0496121_0036018 | |||
| 1653 | Ga0496121_0094513 | |||
| 1654 | Ga0496121_0101359 | |||
| 1655 | Ga0496121_0110600 | |||
| 1656 | Ga0496121_0155785 | |||
| 1657 | Ga0496122_0004499 | |||
| 1658 | Ga0496122_0018570 | |||
| 1659 | Ga0496122_0036234 | |||
| 1660 | Ga0496123_0005798 | |||
| 1661 | Ga0496123_0012553 | |||
| 1662 | Ga0496123_0027227 | |||
| 1663 | Ga0496123_0049174 | |||
| 1664 | Ga0496124_0004075 | |||
| 1665 | Ga0496124_0035573 | |||
| 1666 | Ga0496124_0047584 | |||
| 1667 | Ga0496124_0068369 | |||
| 1668 | Ga0496124_0082563 | |||
| 1669 | Ga0496124_0150871 | |||
| 1670 | Ga0496124_0152762 | |||
| 1671 | Ga0496125_0004056 | |||
| 1672 | Ga0496125_0007474 | |||
| 1673 | Ga0496125_0014234 | |||
| 1674 | Ga0496125_0017348 | |||
| 1675 | Ga0496125_0033259 | |||
| 1676 | Ga0496125_0042854 | |||
| 1677 | Ga0496125_0049483 | |||
| 1678 | Ga0496125_0068939 | |||
| 1679 | Ga0496126_0058173 | |||
| 1680 | Ga0496126_0074250 | |||
| 1681 | Ga0496126_0105507 | |||
| 1682 | Ga0495678_001921 | |||
| 1683 | Ga0495678_002035 | |||
| 1684 | Ga0495678_005412 | |||
| 1685 | Ga0495678_007046 | |||
| 1686 | Ga0495678_014926 | |||
| 1687 | Ga0495678_016804 | |||
| 1688 | Ga0495678_019682 | |||
| 1689 | Ga0495678_019908 | |||
| 1690 | Ga0495678_022620 | |||
| 1691 | Ga0495682_0004188 | |||
| 1692 | Ga0495682_0006113 | |||
| 1693 | Ga0495682_0019640 | |||
| 1694 | Ga0495682_0073603 | |||
| 1695 | Ga0495682_0099947 | |||
| 1696 | Ga0501241_000573 | |||
| 1697 | Ga0501269_001400 | |||
| 1698 | nmdc:mga03683_10946_c1 | |||
| 1699 | nmdc:mga00v17_46459_c1 | |||
| 1700 | nmdc:mga00v17_51036_c1 | |||
| 1701 | nmdc:mga00v17_62635_c1 | |||
| 1702 | nmdc:mga08x19_111018_c1 | |||
| 1703 | Ga0500634_0012544 | |||
| 1704 | 2511256229 | |||
| 1705 | 2511265750 | |||
| 1706 | 2511273703 | |||
| 1707 | 2511279666 | |||
| 1708 | 2511298864 | |||
| 1709 | 2511315294 | |||
| 1710 | 2511322180 | |||
| 1711 | 2511325309 | |||
| 1712 | 2511332291 | |||
| 1713 | 2511337730 | |||
| 1714 | 2511347373 | |||
| 1715 | 2511348066 | |||
| 1716 | 2511359210 | |||
| 1717 | 2511366068 | |||
| 1718 | 2511368877 | |||
| 1719 | 2512325271 | |||
| 1720 | 2555666987 | |||
| 1721 | 2583795370 | |||
| 1722 | 2597855237 | |||
| 1723 | 2597861239 | |||
| 1724 | 2597866986 | |||
| 1725 | 2599327784 | |||
| 1726 | 2599355607 | |||
| 1727 | 2599362990 | |||
| 1728 | 2599368704 | |||
| 1729 | 2599376099 | |||
| 1730 | 2599380713 | |||
| 1731 | 2599387771 | |||
| 1732 | 2599394957 | |||
| 1733 | 2599401126 | |||
| 1734 | 2599406722 | |||
| 1735 | 2599449541 | |||
| 1736 | 2599462441 | |||
| 1737 | 2599468136 | |||
| 1738 | 2599487363 | |||
| 1739 | 2599491458 | |||
| 1740 | 2599506066 | |||
| 1741 | 2599511613 | |||
| 1742 | 2599516587 | |||
| 1743 | 2599804281 | |||
| 1744 | 2599879360 | |||
| 1745 | 2599893116 | |||
| 1746 | 2599948694 | |||
| 1747 | 2600363153 | |||
| 1748 | 2601693313 | |||
| 1749 | 2601775229 | |||
| 1750 | 2621296506 | |||
| 1751 | 2624489443 | |||
| 1752 | 2643843432 | |||
| 1753 | 2643873529 | |||
| 1754 | 2643955977 | |||
| 1755 | 2644020099 | |||
| 1756 | 2644184107 | |||
| 1757 | 2644624454 | |||
| 1758 | 2671099631 | |||
| 1759 | 2671771290 | |||
| 1760 | 2677900430 | |||
| 1761 | 2715754446 | |||
| 1762 | 2723246143 | |||
| 1763 | 2738673452 | |||
| 1764 | 2738751845 | |||
| 1765 | 2738807584 | |||
| 1766 | 2738860886 | |||
| 1767 | 2738894944 | |||
| 1768 | 2739200895 | |||
| 1769 | 2739261721 | |||
| 1770 | 2743740808 | |||
| 1771 | 2774117971 | |||
| 1772 | 2774136596 | |||
| 1773 | 2784316458 | |||
| 1774 | 2808928052 | |||
| 1775 | 2808950766 | |||
| 1776 | 2808960731 | |||
| 1777 | 2808980105 | |||
| 1778 | 2808995825 | |||
| 1779 | 2809217625 | |||
| 1780 | 2817488015 | |||
| 1781 | 2819704778 | |||
| 1782 | 2834031272 | |||
| 1783 | 2842828433 | |||
| 1784 | 2842833846 | |||
| 1785 | 2842838246 | |||
| 1786 | 2842846074 | |||
| 1787 | 2844667472 | |||
| 1788 | 2852616671 | |||
| 1789 | 2852662672 | |||
| 1790 | 2852671639 | |||
| 1791 | 2860345310 | |||
| 1792 | 2860868039 | |||
| 1793 | 2880230764 | |||
| 1794 | 2904518547 | |||
| 1795 | 2904553496 | |||
| 1796 | 2908446617 | |||
| 1797 | 2917070721 | |||
| 1798 | 2919457962 | |||
| 1799 | 2919702352 | |||
| 1800 | 2923153640 | |||
| 1801 | 2929189922 | |||
| 1802 | 2931390983 | |||
| 1803 | 2931398509 | |||
| 1804 | 2935357944 | |||
| 1805 | 2939640467 | |||
| 1806 | 2945967192 | |||
| 1807 | 2946012909 | |||
| 1808 | 2946028227 | |||
| 1809 | 2947234749 | |||
| 1810 | 2974293673 | |||
| 1811 | 2984292475 | |||
| 1812 | 2998140136 | |||
| 1813 | 3007399036 | |||
| 1814 | 3007517548 | |||
| 1815 | 3007616983 | |||
| 1816 | 3007623872 | |||
| 1817 | 3007859588 | |||
| 1818 | 3007864684 | |||
| 1819 | 637317390 | |||
| 1820 | 8015687900 | |||
| 1821 | 8019769434 | |||
| 1822 | 8019779575 | |||
| 1823 | 8029995116 | |||
| 1824 | 8054287247 | |||
| 1825 | 8054349268 | |||
| 1826 | 8055771000 | |||
| 1827 | 8055817953 | |||
| 1828 | 8056126148 | |||
| 1829 | 8056131922 | |||
| 1830 | 8056151179 | |||
| 1831 | 8056160126 | |||
| 1832 | 8056177046 | |||
| 1833 | 8056182351 | |||
| 1834 | 8056570863 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ev1-assembly1.cif.gz_A | anabaena tic22 (protein transport) | 0.446 | 79 | 137 |
| 5xxu-assembly1.cif.gz_N | small subunit of toxoplasma gondii ribosome | 0.4151 | 194 | 287 |
| 5xxu-assembly1.cif.gz_N | small subunit of toxoplasma gondii ribosome | 0.2501 | 194 | 287 |
| 7mdz-assembly1.cif.gz_NN | 80s rabbit ribosome stalled with benzamide-chx | 0.2489 | 159 | 286 |
| 8qu8-assembly1.cif.gz_D | protac-mediated complex of kras with vhl/elongin-b/elongin-c/cullin-2/rbx1 | 0.2428 | 156 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHM9_121_187_3.30.1490.20 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain | 0.653 | 82 | 134 | 3.30.1490.20 |
| af_Q2FVN0_86_212_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.5518 | 147 | 206 | 3.40.390.10 |
| 5flxN02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.5119 | 216 | 286 | 1.10.287.10 |
| af_C6KSM4_604_682_3.30.70.870 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 | 0.4829 | 84 | 134 | 3.30.70.870 |
| 5flxN02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.458 | 216 | 286 | 1.10.287.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F3JXF2-F1-model_v4 | Aminopeptidase | 0.9489 | 16 | 287 |
GO:0004177
|
| AF-A0A836NV60-F1-model_v4 | deleted | 0.9432 | 37 | 321 |
|
| AF-A0A436RLW1-F1-model_v4 | Aminopeptidase | 0.9258 | 16 | 285 |
GO:0004177
|
| AF-A0A2N2FY86-F1-model_v4 | Aminopeptidase | 0.9244 | 16 | 319 |
GO:0004177
|
| AF-A0A1G0K5J9-F1-model_v4 | Aminopeptidase | 0.9213 | 16 | 321 |
|