F485647

General Info

Members Datasets Scaffolds Average Seq Length
917 374 1834 347

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0029812|Ga0495654_0029812_87_1094
Length 330
Sequence MFLLLNGCASVSYYSQLASGQLQLLNARVPVSQVIADPASDAKLRAHLEQSQRARDFASQHLHLPDNQSYRLYADIGRSYVVWNVFVTPEFSLRPQNYCFPIAGCVAYRGYYQQGAARGEAALQRQQGMDVAIGGVEAYSTLGWFDDPIMNSMERLATLIFHELAHQRLYVKDDTEFNESFASFVEQEGTRQWRAARNLPALNDAQERQRDQFIQLLLDTRARLEKLYALPLASDEMRRRKAAEFTRLRADYQTLRDSQWAGSRRFDAWIDAPMNNARLLPFGLYDQWVPAFAELFRQAGGDWQKFYLAAERVGALAPAQRKRALMSLDD

Samples

Sample ID Description Type Environment
1 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
53 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
98 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
99 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
100 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
103 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
104 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
105 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
106 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
107 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
108 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
109 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
110 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
111 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
112 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
113 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
114 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
115 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
116 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
117 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
118 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
119 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
120 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
121 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
122 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
123 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
124 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
125 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
126 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
129 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
132 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
133 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
134 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
135 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
136 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
137 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
142 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
239 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
244 2511231004 Pseudomonas sp. GM102 Isolate Nodule
245 2511231006 Pseudomonas sp. GM17 Isolate Nodule
246 2511231007 Pseudomonas sp. GM18 Isolate Nodule
247 2511231008 Pseudomonas sp. GM21 Isolate Nodule
248 2511231012 Pseudomonas sp. GM33 Isolate Nodule
249 2511231014 Pseudomonas sp. GM48 Isolate Nodule
250 2511231015 Pseudomonas sp. GM49 Isolate Nodule
251 2511231016 Pseudomonas sp. GM50 Isolate Nodule
252 2511231017 Pseudomonas sp. GM55 Isolate Nodule
253 2511231018 Pseudomonas sp. GM60 Isolate Nodule
254 2511231019 Pseudomonas sp. GM67 Isolate Nodule
255 2511231020 Pseudomonas sp. GM74 Isolate Nodule
256 2511231021 Pseudomonas sp. GM78 Isolate Nodule
257 2511231022 Pseudomonas sp. GM79 Isolate Nodule
258 2511231023 Pseudomonas sp. GM80 Isolate Nodule
259 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
260 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
261 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
262 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
263 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
264 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
265 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
266 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
267 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
268 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
269 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
270 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
271 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
272 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
273 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
274 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
275 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
276 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
277 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
278 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
279 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
280 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
281 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
282 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
283 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
284 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
285 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
286 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
287 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
288 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
289 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
290 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
291 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
292 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
293 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
294 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
295 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
296 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
297 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
298 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
299 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
300 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
301 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
302 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
303 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
304 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
305 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
306 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
307 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
308 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
309 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
310 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
311 2773857670 Pseudomonas sp. 478 Isolate Unclassified
312 2773857673 Pseudomonas sp. 443 Isolate Unclassified
313 2784132072 Pseudomonas sp. 460 Isolate Unclassified
314 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
315 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
316 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
317 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
318 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
319 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
320 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
321 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
322 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
323 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
324 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
325 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
326 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
327 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
328 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
329 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
330 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
331 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
332 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
333 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
334 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
335 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
336 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
337 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
338 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
339 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
340 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
341 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
342 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
343 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
344 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
345 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
346 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
347 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
348 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
349 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
350 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
351 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
352 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
353 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
354 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
355 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
356 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
357 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
358 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
359 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
360 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
361 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
362 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
363 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
364 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
365 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
366 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
367 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
368 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
369 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
370 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
371 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
372 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
373 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
374 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.71
Metatranscriptomes 0
Isolates 14.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 1.96
Rhizoplane 3.82
Rhizosphere 78.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495654_0029812 3300046530 Bacteria 2781
2 MRS2a_Contig_126 2124908027 Bacteria 13711
3 JGI25162J39368_1000185 3300002737 Bacteria 66040
4 JGI25162J39368_1000219 3300002737 Bacteria 59530
5 JGI25163J39215_1000823 3300002771 Bacteria 7445
6 JGI25163J39215_1000834 3300002771 Bacteria 7381
7 JGI25164J39214_1000175 3300002772 Bacteria 59290
8 JGI25165J46597_1000175 3300003214 Bacteria 100117
9 JGI25165J46597_1000193 3300003214 Bacteria 91069
10 Ga0055538_1000012 3300003751 Bacteria 353826
11 Ga0055539_1000017 3300003752 Bacteria 353873
12 Ga0055533_1000021 3300003756 Bacteria 353826
13 Ga0055532_1000020 3300003758 Bacteria 270853
14 Ga0055525_1000117 3300003759 Bacteria 120690
15 Ga0055535_1002840 3300003761 Bacteria 5460
16 Ga0055536_1000237 3300003781 Bacteria 44418
17 Ga0055536_1000241 3300003781 Bacteria 43710
18 Ga0055530_10000159 3300003791 Bacteria 61131
19 Ga0055540_1000378 3300003792 Bacteria 37178
20 Ga0055540_1000725 3300003792 Bacteria 22486
21 Ga0055541_1000012 3300003841 Bacteria 353826
22 Ga0065714_10000191 3300005288 Bacteria 7706
23 Ga0065714_10005418 3300005288 Bacteria 4972
24 Ga0065714_10066629 3300005288 Bacteria 6538
25 Ga0065714_10082121 3300005288 Bacteria 2329
26 Ga0065714_10127279 3300005288 Bacteria 1283
27 Ga0065704_10167645 3300005289 Bacteria 1312
28 Ga0070670_100000258 3300005331 Bacteria 47306
29 Ga0070670_100001386 3300005331 Bacteria 19431
30 Ga0070661_100000146 3300005344 Bacteria 58043
31 Ga0070669_100000153 3300005353 Bacteria 62355
32 Ga0070662_100005956 3300005457 Bacteria 7819
33 Ga0070662_100064104 3300005457 Bacteria 2690
34 Ga0068853_100000184 3300005539 Bacteria 43882
35 Ga0070665_100037664 3300005548 Bacteria 4862
36 Ga0070664_100000049 3300005564 Bacteria 71805
37 Ga0070664_100060694 3300005564 Bacteria 3220
38 Ga0068851_10000018 3300005834 Bacteria 137425
39 Ga0075364_10087404 3300006051 Bacteria 2066
40 Ga0075432_10012519 3300006058 Bacteria 2881
41 Ga0075432_10062015 3300006058 Bacteria 1332
42 Ga0075362_10098534 3300006177 Bacteria 1364
43 Ga0075436_100042695 3300006914 Bacteria 3127
44 Ga0079104_1000735 3300006946 Bacteria 28887
45 Ga0105251_10001924 3300009011 Bacteria 17001
46 Ga0105251_10006951 3300009011 Bacteria 7086
47 Ga0105251_10014141 3300009011 Bacteria 4429
48 Ga0105244_10000186 3300009036 Bacteria 63278
49 Ga0105244_10001003 3300009036 Bacteria 23674
50 Ga0105244_10007387 3300009036 Bacteria 6985
51 Ga0105244_10009695 3300009036 Bacteria 5893
52 Ga0105244_10128377 3300009036 Bacteria 1224
53 Ga0105250_10015261 3300009092 Bacteria 3147
54 Ga0105250_10018871 3300009092 Bacteria 2789
55 Ga0105250_10031667 3300009092 Bacteria 2123
56 Ga0105243_10000075 3300009148 Bacteria 112098
57 Ga0105243_10000862 3300009148 Bacteria 28702
58 Ga0105243_10008056 3300009148 Bacteria 8089
59 Ga0105243_10020990 3300009148 Bacteria 4956
60 Ga0105243_10144963 3300009148 Bacteria 2031
61 Ga0105242_10001632 3300009176 Bacteria 17700
62 Ga0105242_10005717 3300009176 Bacteria 9591
63 Ga0105248_10002239 3300009177 Bacteria 21390
64 Ga0105237_10002463 3300009545 Bacteria 22970
65 Ga0105249_10010831 3300009553 Bacteria 8014
66 Ga0105246_10000958 3300011119 Bacteria 16516
67 Ga0105246_10003117 3300011119 Bacteria 10068
68 Ga0105246_10009773 3300011119 Bacteria 5913
69 Ga0157345_1000542 3300012498 Bacteria 3390
70 Ga0157373_10008757 3300013100 Bacteria 7499
71 Ga0157373_10013063 3300013100 Bacteria 6093
72 Ga0157373_10018433 3300013100 Bacteria 5082
73 Ga0157373_10028306 3300013100 Bacteria 4042
74 Ga0157373_10029749 3300013100 Bacteria 3932
75 Ga0157373_10031891 3300013100 Bacteria 3795
76 Ga0157371_10001263 3300013102 Bacteria 26673
77 Ga0157371_10012076 3300013102 Bacteria 6619
78 Ga0157371_10061080 3300013102 Bacteria 2672
79 Ga0157370_10019275 3300013104 Bacteria 6849
80 Ga0157370_10111586 3300013104 Bacteria 2556
81 Ga0157369_10018609 3300013105 Bacteria 7786
82 Ga0157369_10059449 3300013105 Bacteria 4121
83 Ga0157369_10134462 3300013105 Bacteria 2618
84 Ga0157369_10137913 3300013105 Bacteria 2582
85 Ga0157369_10380808 3300013105 Bacteria 1464
86 Ga0157375_10013471 3300013308 Bacteria 7280
87 Ga0157375_10019265 3300013308 Bacteria 6203
88 Ga0182008_10000367 3300014497 Bacteria 35146
89 Ga0182008_10004974 3300014497 Bacteria 7653
90 Ga0182008_10008487 3300014497 Bacteria 5610
91 Ga0182008_10019285 3300014497 Bacteria 3522
92 Ga0182008_10025932 3300014497 Bacteria 2974
93 Ga0182006_1000961 3300015261 Bacteria 19104
94 Ga0182006_1005096 3300015261 Bacteria 6317
95 Ga0182007_10000742 3300015262 Bacteria 18459
96 Ga0182005_1000885 3300015265 Bacteria 13177
97 Ga0163161_10007642 3300017792 Bacteria 7477
98 Ga0163161_10019012 3300017792 Bacteria 4816
99 Ga0163161_10020244 3300017792 Bacteria 4668
100 Ga0163161_10037102 3300017792 Bacteria 3493
101 Ga0163161_10039705 3300017792 Bacteria 3380
102 Ga0163161_10047063 3300017792 Bacteria 3114
103 Ga0163161_10274463 3300017792 Bacteria 1320
104 Ga0209435_101384 3300025206 Bacteria 3107
105 Ga0209760_100020 3300025207 Bacteria 169879
106 Ga0209760_100082 3300025207 Bacteria 76168
107 Ga0209784_100007 3300025224 Bacteria 747715
108 Ga0209566_100009 3300025225 Bacteria 554018
109 Ga0209674_100021 3300025226 Bacteria 629811
110 Ga0209147_100009 3300025229 Bacteria 747409
111 Ga0209563_100018 3300025230 Bacteria 747850
112 Ga0207427_100005 3300025231 Bacteria 797999
113 Ga0207427_100006 3300025231 Bacteria 785415
114 Ga0209437_100013 3300025233 Bacteria 785457
115 Ga0209437_100018 3300025233 Bacteria 694400
116 Ga0209258_100237 3300025242 Bacteria 102220
117 Ga0209646_1000442 3300025246 Bacteria 22332
118 Ga0209677_100012 3300025253 Bacteria 554018
119 Ga0209759_1006997 3300025256 Bacteria 3700
120 Ga0209233_1000021 3300025261 Bacteria 798078
121 Ga0209233_1000022 3300025261 Bacteria 785415
122 Ga0209676_1000015 3300025292 Bacteria 784458
123 Ga0209676_1000157 3300025292 Bacteria 163094
124 Ga0209676_1000222 3300025292 Bacteria 124695
125 Ga0209676_1003038 3300025292 Bacteria 10850
126 Ga0209050_1000030 3300025298 Bacteria 463381
127 Ga0209050_1000296 3300025298 Bacteria 104732
128 Ga0209050_1001068 3300025298 Bacteria 33633
129 Ga0209051_1000143 3300025303 Bacteria 135182
130 Ga0209051_1000295 3300025303 Bacteria 79621
131 Ga0209257_1000422 3300025304 Bacteria 81630
132 Ga0207656_10000009 3300025321 Bacteria 245637
133 Ga0207696_1000165 3300025711 Bacteria 104683
134 Ga0207696_1003213 3300025711 Bacteria 7547
135 Ga0207655_1000135 3300025728 Bacteria 143597
136 Ga0207655_1000652 3300025728 Bacteria 41403
137 Ga0207655_1000961 3300025728 Bacteria 29731
138 Ga0207655_1006175 3300025728 Bacteria 7985
139 Ga0207655_1006536 3300025728 Bacteria 7704
140 Ga0207655_1011532 3300025728 Bacteria 5254
141 Ga0207655_1023395 3300025728 Bacteria 3066
142 Ga0207713_1000692 3300025735 Bacteria 31614
143 Ga0207713_1001400 3300025735 Bacteria 19498
144 Ga0207713_1001900 3300025735 Bacteria 15835
145 Ga0207713_1002728 3300025735 Bacteria 12593
146 Ga0207713_1003858 3300025735 Bacteria 10005
147 Ga0207713_1004885 3300025735 Bacteria 8583
148 Ga0207713_1007816 3300025735 Bacteria 6237
149 Ga0207713_1014386 3300025735 Bacteria 4116
150 Ga0207713_1021307 3300025735 Bacteria 3110
151 Ga0207671_10000713 3300025914 Bacteria 42635
152 Ga0207649_10000007 3300025920 Bacteria 334217
153 Ga0207681_10000163 3300025923 Bacteria 55005
154 Ga0207650_10000178 3300025925 Bacteria 74821
155 Ga0207650_10000210 3300025925 Bacteria 66574
156 Ga0207706_10000050 3300025933 Bacteria 116811
157 Ga0207706_10002848 3300025933 Bacteria 16783
158 Ga0207686_10028645 3300025934 Bacteria 3277
159 Ga0207709_10000269 3300025935 Bacteria 61223
160 Ga0207709_10004904 3300025935 Bacteria 7658
161 Ga0207709_10024799 3300025935 Bacteria 3429
162 Ga0207709_10045434 3300025935 Bacteria 2660
163 Ga0207709_10097616 3300025935 Bacteria 1935
164 Ga0207711_10006135 3300025941 Bacteria 10152
165 Ga0207679_10000013 3300025945 Bacteria 334197
166 Ga0207679_10015924 3300025945 Bacteria 4984
167 Ga0207712_10056233 3300025961 Bacteria 2771
168 Ga0207640_10040090 3300025981 Bacteria 2968
169 Ga0207639_10000079 3300026041 Bacteria 83859
170 Ga0209281_1000237 3300027111 Bacteria 112688
171 Ga0207428_10021747 3300027907 Bacteria 5426
172 Ga0207428_10056099 3300027907 Bacteria 3131
173 Ga0207428_10058422 3300027907 Bacteria 3061
174 Ga0207428_10062871 3300027907 Bacteria 2934
175 Ga0207428_10192579 3300027907 Bacteria 1537
176 Ga0207428_10268625 3300027907 Bacteria 1269
177 Ga0207428_10283735 3300027907 Bacteria 1229
178 Ga0307517_10057686 3300028786 Bacteria 3756
179 Ga0307511_10019783 3300030521 Bacteria 6393
180 Ga0307509_10021696 3300031507 Bacteria 7254
181 Ga0307408_100005159 3300031548 Bacteria 8760
182 Ga0307405_10000636 3300031731 Bacteria 13497
183 Ga0307405_10003329 3300031731 Bacteria 7358
184 Ga0307412_10017529 3300031911 Bacteria 4287
185 Ga0307412_10033246 3300031911 Bacteria 3276
186 Ga0307412_10057313 3300031911 Bacteria 2600
187 Ga0307416_100137823 3300032002 Bacteria 2211
188 Ga0307416_100169459 3300032002 Bacteria 2030
189 Ga0307414_10185343 3300032004 Bacteria 1678
190 Ga0307411_10117986 3300032005 Bacteria 1913
191 Ga0439438_000219 3300041405 Bacteria 26300
192 Ga0439438_000524 3300041405 Bacteria 17389
193 Ga0439438_000670 3300041405 Bacteria 15363
194 Ga0439438_001361 3300041405 Bacteria 10795
195 Ga0439438_002846 3300041405 Bacteria 7208
196 Ga0439438_002857 3300041405 Bacteria 7192
197 Ga0439438_004228 3300041405 Bacteria 5578
198 Ga0439438_005183 3300041405 Bacteria 4840
199 Ga0439438_007380 3300041405 Bacteria 3761
200 Ga0439438_012022 3300041405 Bacteria 2671
201 Ga0439438_012781 3300041405 Bacteria 2559
202 Ga0439447_000330 3300041407 Bacteria 17039
203 Ga0439447_000528 3300041407 Bacteria 14164
204 Ga0439447_000718 3300041407 Bacteria 12276
205 Ga0439447_001703 3300041407 Bacteria 8071
206 Ga0439447_005265 3300041407 Bacteria 4317
207 Ga0439447_022180 3300041407 Bacteria 1665
208 Ga0439461_0002057 3300041410 Bacteria 3185
209 Ga0439466_0000612 3300041411 Bacteria 13423
210 Ga0439466_0000697 3300041411 Bacteria 12686
211 Ga0439466_0002918 3300041411 Bacteria 6684
212 Ga0439466_0003428 3300041411 Bacteria 6152
213 Ga0439466_0004041 3300041411 Bacteria 5663
214 Ga0439466_0005067 3300041411 Bacteria 5051
215 Ga0439466_0007280 3300041411 Bacteria 4189
216 Ga0439466_0018241 3300041411 Bacteria 2519
217 Ga0439466_0024071 3300041411 Bacteria 2138
218 Ga0439465_0001504 3300041413 Bacteria 7562
219 Ga0451841_0345081 3300041498 Bacteria 1411
220 Ga0439445_0010898 3300042004 Bacteria 2159
221 Ga0439445_0014340 3300042004 Bacteria 1928
222 Ga0439432_000934 3300042006 Bacteria 10994
223 Ga0439432_003995 3300042006 Bacteria 5420
224 Ga0439432_006064 3300042006 Bacteria 4334
225 Ga0439432_010655 3300042006 Bacteria 3180
226 Ga0439432_011893 3300042006 Bacteria 2990
227 Ga0439432_021636 3300042006 Bacteria 2129
228 Ga0439432_036142 3300042006 Bacteria 1581
229 Ga0439451_000629 3300042009 Bacteria 6690
230 Ga0439451_000701 3300042009 Bacteria 6362
231 Ga0439451_001253 3300042009 Bacteria 5022
232 Ga0439451_005067 3300042009 Bacteria 2680
233 Ga0439451_005297 3300042009 Bacteria 2627
234 Ga0439451_006692 3300042009 Bacteria 2355
235 Ga0439452_000352 3300042010 Bacteria 28208
236 Ga0439452_000435 3300042010 Bacteria 24043
237 Ga0439452_000563 3300042010 Bacteria 19511
238 Ga0439452_001007 3300042010 Bacteria 12489
239 Ga0439452_001505 3300042010 Bacteria 9437
240 Ga0439452_001897 3300042010 Bacteria 8040
241 Ga0439452_003511 3300042010 Bacteria 5478
242 Ga0439452_013819 3300042010 Bacteria 2258
243 Ga0439452_013883 3300042010 Bacteria 2251
244 Ga0439452_018751 3300042010 Bacteria 1839
245 Ga0439456_001509 3300042013 Bacteria 4688
246 Ga0439456_002453 3300042013 Bacteria 3743
247 Ga0439456_009492 3300042013 Bacteria 2009
248 Ga0439456_014382 3300042013 Bacteria 1650
249 Ga0439456_016318 3300042013 Bacteria 1553
250 Ga0439456_026799 3300042013 Bacteria 1226
251 Ga0439463_000640 3300042016 Bacteria 9679
252 Ga0439463_003554 3300042016 Bacteria 3940
253 Ga0439463_014202 3300042016 Bacteria 1962
254 Ga0450911_000393 3300042115 Bacteria 14471
255 Ga0450911_000919 3300042115 Bacteria 7806
256 Ga0450911_001252 3300042115 Bacteria 6086
257 Ga0450911_002598 3300042115 Bacteria 3485
258 Ga0450911_004078 3300042115 Bacteria 2450
259 Ga0450911_005338 3300042115 Bacteria 2007
260 Ga0450919_000148 3300042121 Bacteria 7277
261 Ga0450921_000776 3300042123 Bacteria 1684
262 Ga0450922_000807 3300042124 Bacteria 3212
263 Ga0450922_000819 3300042124 Bacteria 3187
264 Ga0450922_001375 3300042124 Bacteria 2392
265 Ga0450923_000577 3300042125 Bacteria 4169
266 Ga0450890_000098 3300042127 Bacteria 14459
267 Ga0450894_001932 3300042131 Bacteria 2863
268 Ga0450896_011801 3300042133 Bacteria 1232
269 Ga0450898_000863 3300042134 Bacteria 3782
270 Ga0450899_001832 3300042135 Bacteria 2358
271 Ga0450900_000564 3300042136 Bacteria 3031
272 Ga0450900_008617 3300042136 Bacteria 1279
273 Ga0450902_002154 3300042137 Bacteria 2771
274 Ga0450902_004796 3300042137 Bacteria 2022
275 Ga0450902_005659 3300042137 Bacteria 1898
276 Ga0450903_000427 3300042138 Bacteria 9033
277 Ga0450903_000585 3300042138 Bacteria 7468
278 Ga0450903_001352 3300042138 Bacteria 4587
279 Ga0450903_004383 3300042138 Bacteria 2412
280 Ga0450903_008713 3300042138 Bacteria 1658
281 Ga0450904_001450 3300042139 Bacteria 3332
282 Ga0450904_001615 3300042139 Bacteria 3049
283 Ga0450905_001236 3300042142 Bacteria 3237
284 Ga0450905_012465 3300042142 Bacteria 1197
285 Ga0450906_000615 3300042145 Bacteria 7600
286 Ga0450906_000778 3300042145 Bacteria 6949
287 Ga0450906_002850 3300042145 Bacteria 3768
288 Ga0450906_004020 3300042145 Bacteria 3111
289 Ga0450906_015212 3300042145 Bacteria 1400
290 Ga0450907_000357 3300042146 Bacteria 14117
291 Ga0450907_001563 3300042146 Bacteria 4875
292 Ga0450907_003076 3300042146 Bacteria 3031
293 Ga0450910_000138 3300042147 Bacteria 7848
294 Ga0439446_0010265 3300042156 Bacteria 2520
295 Ga0439446_0019297 3300042156 Bacteria 1915
296 Ga0450908_000519 3300042184 Bacteria 7447
297 Ga0450909_000324 3300042185 Bacteria 5948
298 Ga0450909_000548 3300042185 Bacteria 4950
299 Ga0450909_005786 3300042185 Bacteria 1780
300 Ga0450909_007184 3300042185 Bacteria 1609
301 Ga0450909_009958 3300042185 Bacteria 1389
302 Ga0439434_0000177 3300042435 Bacteria 17489
303 Ga0439434_0013925 3300042435 Bacteria 2390
304 Ga0439464_0008473 3300042439 Bacteria 2693
305 Ga0439460_0000220 3300042461 Bacteria 11406
306 Ga0439460_0000423 3300042461 Bacteria 9016
307 Ga0439460_0009759 3300042461 Bacteria 2444
308 Ga0450918_000835 3300042531 Bacteria 6492
309 Ga0450918_010120 3300042531 Bacteria 1647
310 Ga0450893_0009252 3300042532 Bacteria 1608
311 Ga0450893_0013584 3300042532 Bacteria 1359
312 Ga0450901_000636 3300042533 Bacteria 4133
313 Ga0439440_0000589 3300042993 Bacteria 6160
314 Ga0439440_0000879 3300042993 Bacteria 5249
315 Ga0439440_0004943 3300042993 Bacteria 2630
316 Ga0495617_000380 3300046452 Bacteria 24621
317 Ga0495617_004640 3300046452 Bacteria 4971
318 Ga0495617_011245 3300046452 Bacteria 3054
319 Ga0495617_020728 3300046452 Bacteria 2221
320 Ga0495617_037361 3300046452 Bacteria 1627
321 Ga0495627_009991 3300046453 Bacteria 3468
322 Ga0495627_047213 3300046453 Bacteria 1306
323 Ga0495592_0028435 3300046454 Bacteria 4234
324 Ga0495603_0028467 3300046455 Bacteria 3370
325 Ga0495590_0002177 3300046457 Bacteria 8203
326 Ga0495590_0003420 3300046457 Bacteria 6483
327 Ga0495590_0012662 3300046457 Bacteria 3125
328 Ga0495590_0031926 3300046457 Bacteria 1842
329 Ga0495591_001346 3300046458 Bacteria 15427
330 Ga0495591_002535 3300046458 Bacteria 10074
331 Ga0495591_002732 3300046458 Bacteria 9554
332 Ga0495591_005229 3300046458 Bacteria 6070
333 Ga0495591_005358 3300046458 Bacteria 5960
334 Ga0495591_006966 3300046458 Bacteria 4886
335 Ga0495591_011465 3300046458 Bacteria 3357
336 Ga0495591_020295 3300046458 Bacteria 2198
337 Ga0495591_026471 3300046458 Bacteria 1801
338 Ga0495591_030469 3300046458 Bacteria 1628
339 Ga0495629_0010277 3300046459 Bacteria 6817
340 Ga0495638_0001277 3300046460 Bacteria 23481
341 Ga0495638_0002273 3300046460 Bacteria 15882
342 Ga0495638_0006882 3300046460 Bacteria 8209
343 Ga0495638_0009395 3300046460 Bacteria 6874
344 Ga0495638_0010042 3300046460 Bacteria 6599
345 Ga0495638_0021715 3300046460 Bacteria 4222
346 Ga0495638_0021951 3300046460 Bacteria 4195
347 Ga0495638_0030603 3300046460 Bacteria 3463
348 Ga0495638_0057394 3300046460 Bacteria 2414
349 Ga0495638_0058965 3300046460 Bacteria 2378
350 Ga0495638_0060638 3300046460 Bacteria 2339
351 Ga0495638_0078147 3300046460 Bacteria 2014
352 Ga0495653_0015864 3300046463 Bacteria 6139
353 Ga0495653_0088963 3300046463 Bacteria 2264
354 Ga0495650_0002307 3300046471 Bacteria 15821
355 Ga0495650_0006133 3300046471 Bacteria 7565
356 Ga0495650_0006144 3300046471 Bacteria 7554
357 Ga0495650_0007734 3300046471 Bacteria 6400
358 Ga0495650_0008201 3300046471 Bacteria 6136
359 Ga0495650_0012706 3300046471 Bacteria 4511
360 Ga0495582_0005461 3300046473 Bacteria 7085
361 Ga0495605_0001019 3300046474 Bacteria 18902
362 Ga0495605_0001927 3300046474 Bacteria 13197
363 Ga0495605_0014437 3300046474 Bacteria 4327
364 Ga0495605_0016429 3300046474 Bacteria 4006
365 Ga0495605_0022127 3300046474 Bacteria 3361
366 Ga0495605_0026693 3300046474 Bacteria 3000
367 Ga0495605_0033316 3300046474 Bacteria 2615
368 Ga0495639_0000239 3300046475 Bacteria 27346
369 Ga0495639_0007862 3300046475 Bacteria 4583
370 Ga0495584_0001101 3300046491 Bacteria 16778
371 Ga0495584_0004243 3300046491 Bacteria 7733
372 Ga0495584_0004614 3300046491 Bacteria 7388
373 Ga0495584_0008756 3300046491 Bacteria 5233
374 Ga0495584_0009005 3300046491 Bacteria 5156
375 Ga0495584_0013224 3300046491 Bacteria 4212
376 Ga0495584_0026328 3300046491 Bacteria 2946
377 Ga0495584_0037943 3300046491 Bacteria 2435
378 Ga0495584_0046743 3300046491 Bacteria 2183
379 Ga0495585_0000800 3300046492 Bacteria 27448
380 Ga0495585_0005089 3300046492 Bacteria 8372
381 Ga0495585_0006078 3300046492 Bacteria 7551
382 Ga0495585_0011791 3300046492 Bacteria 5164
383 Ga0495585_0015035 3300046492 Bacteria 4499
384 Ga0495585_0017059 3300046492 Bacteria 4201
385 Ga0495594_0004919 3300046499 Bacteria 6873
386 Ga0495594_0024156 3300046499 Bacteria 3262
387 Ga0495596_0000482 3300046500 Bacteria 25244
388 Ga0495607_0002401 3300046501 Bacteria 15280
389 Ga0495607_0002489 3300046501 Bacteria 14921
390 Ga0495607_0005282 3300046501 Bacteria 9291
391 Ga0495607_0006775 3300046501 Bacteria 8003
392 Ga0495607_0009819 3300046501 Bacteria 6460
393 Ga0495607_0012460 3300046501 Bacteria 5613
394 Ga0495607_0015455 3300046501 Bacteria 4948
395 Ga0495607_0016962 3300046501 Bacteria 4688
396 Ga0495607_0019527 3300046501 Bacteria 4303
397 Ga0495607_0032397 3300046501 Bacteria 3190
398 Ga0495607_0038022 3300046501 Bacteria 2886
399 Ga0495607_0069210 3300046501 Bacteria 1976
400 Ga0495607_0084703 3300046501 Bacteria 1733
401 Ga0495607_0119569 3300046501 Bacteria 1385
402 Ga0495583_0001586 3300046506 Bacteria 22403
403 Ga0495583_0004250 3300046506 Bacteria 10386
404 Ga0495583_0004393 3300046506 Bacteria 10118
405 Ga0495583_0006442 3300046506 Bacteria 7675
406 Ga0495583_0033253 3300046506 Bacteria 2480
407 Ga0495583_0040636 3300046506 Bacteria 2183
408 Ga0495583_0060815 3300046506 Bacteria 1687
409 Ga0495606_0003551 3300046507 Bacteria 16460
410 Ga0495606_0043025 3300046507 Bacteria 3016
411 Ga0495606_0058740 3300046507 Bacteria 2470
412 Ga0495610_0007502 3300046512 Bacteria 7246
413 Ga0495610_0008055 3300046512 Bacteria 6894
414 Ga0495610_0008473 3300046512 Bacteria 6653
415 Ga0495610_0008706 3300046512 Bacteria 6529
416 Ga0495610_0010757 3300046512 Bacteria 5659
417 Ga0495610_0011663 3300046512 Bacteria 5349
418 Ga0495610_0012437 3300046512 Bacteria 5124
419 Ga0495610_0022945 3300046512 Bacteria 3400
420 Ga0495610_0027408 3300046512 Bacteria 3028
421 Ga0495610_0067786 3300046512 Bacteria 1675
422 Ga0495610_0090013 3300046512 Bacteria 1392
423 Ga0495616_0001775 3300046513 Bacteria 14672
424 Ga0495616_0002772 3300046513 Bacteria 11443
425 Ga0495616_0008776 3300046513 Bacteria 5955
426 Ga0495616_0009840 3300046513 Bacteria 5567
427 Ga0495616_0013579 3300046513 Bacteria 4588
428 Ga0495620_0005558 3300046515 Bacteria 7026
429 Ga0495620_0006144 3300046515 Bacteria 6627
430 Ga0495620_0009264 3300046515 Bacteria 5243
431 Ga0495620_0013538 3300046515 Bacteria 4173
432 Ga0495620_0023108 3300046515 Bacteria 2980
433 Ga0495620_0062000 3300046515 Bacteria 1554
434 Ga0495628_0032258 3300046516 Bacteria 4230
435 Ga0495630_0018688 3300046517 Bacteria 5091
436 Ga0495630_0041876 3300046517 Bacteria 3420
437 Ga0495631_0001056 3300046518 Bacteria 17098
438 Ga0495631_0005870 3300046518 Bacteria 6398
439 Ga0495631_0014280 3300046518 Bacteria 3837
440 Ga0495631_0018963 3300046518 Bacteria 3232
441 Ga0495631_0038078 3300046518 Bacteria 2139
442 Ga0495631_0099249 3300046518 Bacteria 1253
443 Ga0495632_0000952 3300046519 Bacteria 25300
444 Ga0495632_0002331 3300046519 Bacteria 14584
445 Ga0495632_0005690 3300046519 Bacteria 8183
446 Ga0495632_0007116 3300046519 Bacteria 7079
447 Ga0495632_0009059 3300046519 Bacteria 6030
448 Ga0495632_0011397 3300046519 Bacteria 5188
449 Ga0495632_0020593 3300046519 Bacteria 3568
450 Ga0495632_0028343 3300046519 Bacteria 2923
451 Ga0495632_0032030 3300046519 Bacteria 2712
452 Ga0495637_0001352 3300046520 Bacteria 14721
453 Ga0495637_0001869 3300046520 Bacteria 12034
454 Ga0495637_0003492 3300046520 Bacteria 8342
455 Ga0495637_0003821 3300046520 Bacteria 7916
456 Ga0495637_0003957 3300046520 Bacteria 7748
457 Ga0495637_0005807 3300046520 Bacteria 6250
458 Ga0495637_0008564 3300046520 Bacteria 5019
459 Ga0495637_0010076 3300046520 Bacteria 4586
460 Ga0495637_0010768 3300046520 Bacteria 4410
461 Ga0495637_0015538 3300046520 Bacteria 3570
462 Ga0495637_0015950 3300046520 Bacteria 3517
463 Ga0495637_0024646 3300046520 Bacteria 2721
464 Ga0495637_0036009 3300046520 Bacteria 2159
465 Ga0495637_0061921 3300046520 Bacteria 1532
466 Ga0495637_0116538 3300046520 Bacteria 1031
467 Ga0495643_0005972 3300046522 Bacteria 8126
468 Ga0495643_0010329 3300046522 Bacteria 5748
469 Ga0495643_0018189 3300046522 Bacteria 4090
470 Ga0495643_0030872 3300046522 Bacteria 2987
471 Ga0495643_0033926 3300046522 Bacteria 2819
472 Ga0495644_0002846 3300046523 Bacteria 6854
473 Ga0495644_0003449 3300046523 Bacteria 6256
474 Ga0495644_0025640 3300046523 Bacteria 2237
475 Ga0495644_0047487 3300046523 Bacteria 1612
476 Ga0495644_0066360 3300046523 Bacteria 1355
477 Ga0495648_0001218 3300046524 Bacteria 25789
478 Ga0495648_0002655 3300046524 Bacteria 16198
479 Ga0495648_0002978 3300046524 Bacteria 15198
480 Ga0495648_0011516 3300046524 Bacteria 6652
481 Ga0495648_0018746 3300046524 Bacteria 4885
482 Ga0495648_0026763 3300046524 Bacteria 3876
483 Ga0495648_0048081 3300046524 Bacteria 2629
484 Ga0495648_0061142 3300046524 Bacteria 2238
485 Ga0495648_0067227 3300046524 Bacteria 2097
486 Ga0495648_0137751 3300046524 Bacteria 1288
487 Ga0495666_0001740 3300046526 Bacteria 10729
488 Ga0495666_0009683 3300046526 Bacteria 4815
489 Ga0495666_0058101 3300046526 Bacteria 1851
490 Ga0495642_0000291 3300046528 Bacteria 28351
491 Ga0495642_0000368 3300046528 Bacteria 24366
492 Ga0495642_0000824 3300046528 Bacteria 14888
493 Ga0495654_0001864 3300046530 Bacteria 14039
494 Ga0495654_0003754 3300046530 Bacteria 9195
495 Ga0495654_0004474 3300046530 Bacteria 8282
496 Ga0495654_0005730 3300046530 Bacteria 7158
497 Ga0495654_0006406 3300046530 Bacteria 6692
498 Ga0495654_0013249 3300046530 Bacteria 4415
499 Ga0495654_0018219 3300046530 Bacteria 3683
500 Ga0495654_0021050 3300046530 Bacteria 3395
501 Ga0495654_0025082 3300046530 Bacteria 3074
502 Ga0495654_0025483 3300046530 Bacteria 3045
503 Ga0495654_0032823 3300046530 Bacteria 2630
504 Ga0495654_0038894 3300046530 Bacteria 2376
505 Ga0495654_0080741 3300046530 Bacteria 1525
506 Ga0495654_0107427 3300046530 Bacteria 1276
507 Ga0495586_0002791 3300046535 Bacteria 9438
508 Ga0495587_0013048 3300046536 Bacteria 5226
509 Ga0495609_0000100 3300046538 Bacteria 100831
510 Ga0495609_0000756 3300046538 Bacteria 24390
511 Ga0495609_0003116 3300046538 Bacteria 9693
512 Ga0495609_0012155 3300046538 Bacteria 4085
513 Ga0495609_0073713 3300046538 Bacteria 1497
514 Ga0495597_0002530 3300046542 Bacteria 11469
515 Ga0495597_0004102 3300046542 Bacteria 8117
516 Ga0495597_0006520 3300046542 Bacteria 6023
517 Ga0495597_0007772 3300046542 Bacteria 5416
518 Ga0495597_0014685 3300046542 Bacteria 3725
519 Ga0495597_0015333 3300046542 Bacteria 3630
520 Ga0495597_0030984 3300046542 Bacteria 2435
521 Ga0495597_0043551 3300046542 Bacteria 1998
522 Ga0495597_0067048 3300046542 Bacteria 1553
523 Ga0495597_0069570 3300046542 Bacteria 1518
524 Ga0495622_0000466 3300046557 Bacteria 25861
525 Ga0495622_0013943 3300046557 Bacteria 3730
526 Ga0495622_0043015 3300046557 Bacteria 2100
527 Ga0495633_0007867 3300046558 Bacteria 6083
528 Ga0495633_0039511 3300046558 Bacteria 2252
529 Ga0495633_0109900 3300046558 Bacteria 1278
530 Ga0495656_0019846 3300046615 Bacteria 2599
531 Ga0495656_0094468 3300046615 Bacteria 1373
532 Ga0495668_0002000 3300046616 Bacteria 17820
533 Ga0495668_0015266 3300046616 Bacteria 4488
534 Ga0495668_0019541 3300046616 Bacteria 3903
535 Ga0495668_0153447 3300046616 Bacteria 1261
536 Ga0495634_0002187 3300046642 Bacteria 16425
537 Ga0495634_0024645 3300046642 Bacteria 4218
538 Ga0495611_0002835 3300046648 Bacteria 7745
539 Ga0495611_0010434 3300046648 Bacteria 3931
540 Ga0495611_0020505 3300046648 Bacteria 2846
541 Ga0495611_0032433 3300046648 Bacteria 2301
542 Ga0495611_0071639 3300046648 Bacteria 1585
543 Ga0495625_0011945 3300046660 Bacteria 7049
544 Ga0495625_0011959 3300046660 Bacteria 7045
545 Ga0495625_0015042 3300046660 Bacteria 6145
546 Ga0495625_0030255 3300046660 Bacteria 4041
547 Ga0495625_0039694 3300046660 Bacteria 3436
548 Ga0495625_0044214 3300046660 Bacteria 3225
549 Ga0495635_0001369 3300046663 Bacteria 16227
550 Ga0495635_0003679 3300046663 Bacteria 10623
551 Ga0495659_0000386 3300046664 Bacteria 16969
552 Ga0495659_0014280 3300046664 Bacteria 2598
553 Ga0495661_0000315 3300046665 Bacteria 54229
554 Ga0495661_0001817 3300046665 Bacteria 17115
555 Ga0495661_0008570 3300046665 Bacteria 7068
556 Ga0495661_0010510 3300046665 Bacteria 6314
557 Ga0495661_0011035 3300046665 Bacteria 6138
558 Ga0495661_0021815 3300046665 Bacteria 4169
559 Ga0495661_0043871 3300046665 Bacteria 2745
560 Ga0495661_0059351 3300046665 Bacteria 2277
561 Ga0495661_0176952 3300046665 Bacteria 1133
562 Ga0495588_0005649 3300046674 Bacteria 5577
563 Ga0495588_0024833 3300046674 Bacteria 2980
564 Ga0495588_0119280 3300046674 Bacteria 1390
565 Ga0495657_0037624 3300046675 Bacteria 3334
566 Ga0495599_0117289 3300046678 Bacteria 1656
567 Ga0495623_0006299 3300046679 Bacteria 7714
568 Ga0495646_0004999 3300046680 Bacteria 8369
569 Ga0495646_0005503 3300046680 Bacteria 8010
570 Ga0495646_0052624 3300046680 Bacteria 2458
571 Ga0495669_0012931 3300046684 Bacteria 3554
572 Ga0495613_0012685 3300046689 Bacteria 6266
573 Ga0495613_0019037 3300046689 Bacteria 5116
574 Ga0495613_0087878 3300046689 Bacteria 2253
575 Ga0495624_0007321 3300046690 Bacteria 7749
576 Ga0495670_0001360 3300046691 Bacteria 11935
577 Ga0495670_0003504 3300046691 Bacteria 7703
578 Ga0495670_0027151 3300046691 Bacteria 2834
579 Ga0495670_0101608 3300046691 Bacteria 1481
580 Ga0495671_0000561 3300046692 Bacteria 27871
581 Ga0495671_0003513 3300046692 Bacteria 9603
582 Ga0495671_0006513 3300046692 Bacteria 6741
583 Ga0495671_0007357 3300046692 Bacteria 6283
584 Ga0495671_0015217 3300046692 Bacteria 4128
585 Ga0495671_0040873 3300046692 Bacteria 2337
586 Ga0495671_0051653 3300046692 Bacteria 2044
587 Ga0495671_0146508 3300046692 Bacteria 1150
588 Ga0495649_0002380 3300046694 Bacteria 13304
589 Ga0495649_0006593 3300046694 Bacteria 7217
590 Ga0495649_0010762 3300046694 Bacteria 5389
591 Ga0495649_0015943 3300046694 Bacteria 4266
592 Ga0495649_0016014 3300046694 Bacteria 4256
593 Ga0495649_0018731 3300046694 Bacteria 3890
594 Ga0495649_0019782 3300046694 Bacteria 3781
595 Ga0495649_0022741 3300046694 Bacteria 3506
596 Ga0495649_0050279 3300046694 Bacteria 2262
597 Ga0495649_0101892 3300046694 Bacteria 1525
598 Ga0495649_0179611 3300046694 Bacteria 1104
599 Ga0495589_0000245 3300046794 Bacteria 45172
600 Ga0495589_0003887 3300046794 Bacteria 8026
601 Ga0495589_0007773 3300046794 Bacteria 5612
602 Ga0495589_0015693 3300046794 Bacteria 3893
603 Ga0495589_0025523 3300046794 Bacteria 2998
604 Ga0495600_0010835 3300046809 Bacteria 5669
605 Ga0495600_0051884 3300046809 Bacteria 2677
606 Ga0495600_0206549 3300046809 Bacteria 1260
607 Ga0495660_0012913 3300046810 Bacteria 4843
608 Ga0495660_0013059 3300046810 Bacteria 4814
609 Ga0495660_0019022 3300046810 Bacteria 3943
610 Ga0495660_0019900 3300046810 Bacteria 3850
611 Ga0495660_0025267 3300046810 Bacteria 3374
612 Ga0495660_0041150 3300046810 Bacteria 2560
613 Ga0495660_0043776 3300046810 Bacteria 2466
614 Ga0495660_0061363 3300046810 Bacteria 2017
615 Ga0495660_0082025 3300046810 Bacteria 1689
616 Ga0495660_0105594 3300046810 Bacteria 1443
617 Ga0495581_0009340 3300047315 Bacteria 5676
618 Ga0495581_0017302 3300047315 Bacteria 4187
619 Ga0495604_0003119 3300047317 Bacteria 13242
620 Ga0495604_0003340 3300047317 Bacteria 12790
621 Ga0495604_0023935 3300047317 Bacteria 4875
622 Ga0495636_0000767 3300047318 Bacteria 11818
623 Ga0495674_0026804 3300047319 Bacteria 5270
624 Ga0495672_0001274 3300047320 Bacteria 25229
625 Ga0495672_0003072 3300047320 Bacteria 14614
626 Ga0495672_0003235 3300047320 Bacteria 14138
627 Ga0495672_0006568 3300047320 Bacteria 8959
628 Ga0495672_0010052 3300047320 Bacteria 6776
629 Ga0495672_0010264 3300047320 Bacteria 6689
630 Ga0495672_0018080 3300047320 Bacteria 4693
631 Ga0495672_0020197 3300047320 Bacteria 4372
632 Ga0495672_0024320 3300047320 Bacteria 3904
633 Ga0495672_0024661 3300047320 Bacteria 3870
634 Ga0495672_0030403 3300047320 Bacteria 3389
635 Ga0495672_0039762 3300047320 Bacteria 2858
636 Ga0495672_0087541 3300047320 Bacteria 1719
637 Ga0495672_0100304 3300047320 Bacteria 1571
638 Ga0495676_0026135 3300047321 Bacteria 5029
639 Ga0495680_0002200 3300047322 Bacteria 20182
640 Ga0495680_0021720 3300047322 Bacteria 5367
641 Ga0495680_0023204 3300047322 Bacteria 5160
642 Ga0495680_0029728 3300047322 Bacteria 4471
643 Ga0495683_0001158 3300047323 Bacteria 18111
644 Ga0495683_0001356 3300047323 Bacteria 16315
645 Ga0495683_0006437 3300047323 Bacteria 6419
646 Ga0495683_0042390 3300047323 Bacteria 2294
647 Ga0495683_0051557 3300047323 Bacteria 2056
648 Ga0495683_0107968 3300047323 Bacteria 1331
649 Ga0495687_001396 3300047443 Bacteria 22282
650 Ga0495687_002321 3300047443 Bacteria 15500
651 Ga0495675_0016178 3300047444 Bacteria 4717
652 Ga0495675_0042006 3300047444 Bacteria 2912
653 Ga0495677_0003583 3300047445 Bacteria 6024
654 Ga0495677_0050606 3300047445 Bacteria 1529
655 Ga0495679_003553 3300047446 Bacteria 7452
656 Ga0495679_005105 3300047446 Bacteria 5890
657 Ga0495679_005606 3300047446 Bacteria 5535
658 Ga0495679_008438 3300047446 Bacteria 4188
659 Ga0495679_011316 3300047446 Bacteria 3450
660 Ga0495679_012815 3300047446 Bacteria 3173
661 Ga0495679_029115 3300047446 Bacteria 1804
662 Ga0495685_012043 3300047447 Bacteria 2925
663 Ga0495685_014978 3300047447 Bacteria 2640
664 Ga0495673_0001264 3300047469 Bacteria 20818
665 Ga0495673_0002023 3300047469 Bacteria 14906
666 Ga0495673_0002502 3300047469 Bacteria 12868
667 Ga0495673_0002635 3300047469 Bacteria 12426
668 Ga0495673_0003580 3300047469 Bacteria 10192
669 Ga0495673_0005113 3300047469 Bacteria 8002
670 Ga0495673_0005115 3300047469 Bacteria 8000
671 Ga0495673_0006415 3300047469 Bacteria 6917
672 Ga0495673_0006429 3300047469 Bacteria 6906
673 Ga0495673_0009010 3300047469 Bacteria 5552
674 Ga0495673_0011140 3300047469 Bacteria 4853
675 Ga0495673_0013147 3300047469 Bacteria 4359
676 Ga0495673_0087299 3300047469 Bacteria 1280
677 Ga0495681_0000692 3300047470 Bacteria 25721
678 Ga0495681_0004652 3300047470 Bacteria 9305
679 Ga0495681_0004750 3300047470 Bacteria 9207
680 Ga0495681_0005133 3300047470 Bacteria 8820
681 Ga0495681_0008475 3300047470 Bacteria 6447
682 Ga0495681_0009464 3300047470 Bacteria 5998
683 Ga0495681_0012042 3300047470 Bacteria 5104
684 Ga0495681_0018491 3300047470 Bacteria 3838
685 Ga0495681_0020123 3300047470 Bacteria 3627
686 Ga0495681_0021753 3300047470 Bacteria 3447
687 Ga0495681_0029926 3300047470 Bacteria 2780
688 Ga0495681_0084064 3300047470 Bacteria 1416
689 Ga0495681_0144730 3300047470 Bacteria 1001
690 Ga0495684_0014275 3300047471 Bacteria 6112
691 Ga0495686_0008623 3300047472 Bacteria 7448
692 Ga0495686_0063547 3300047472 Bacteria 2287
693 Ga0495593_0003540 3300047673 Bacteria 9343
694 Ga0495593_0015671 3300047673 Bacteria 4289
695 Ga0495593_0035663 3300047673 Bacteria 2699
696 Ga0495593_0039078 3300047673 Bacteria 2560
697 Ga0495593_0130099 3300047673 Bacteria 1278
698 Ga0495602_0021898 3300048088 Bacteria 6274
699 Ga0495626_0000941 3300048091 Bacteria 25315
700 Ga0495626_0000945 3300048091 Bacteria 25254
701 Ga0495626_0001363 3300048091 Bacteria 19726
702 Ga0495626_0001521 3300048091 Bacteria 18215
703 Ga0495626_0005270 3300048091 Bacteria 7640
704 Ga0495626_0006295 3300048091 Bacteria 6773
705 Ga0495626_0013180 3300048091 Bacteria 4306
706 Ga0495626_0027677 3300048091 Bacteria 2754
707 Ga0495626_0030728 3300048091 Bacteria 2589
708 Ga0496102_0002217 3300048905 Bacteria 16672
709 Ga0496103_0005207 3300048906 Bacteria 7819
710 Ga0496106_0101769 3300048909 Bacteria 2228
711 Ga0496107_0042718 3300048910 Bacteria 3256
712 Ga0496112_0040329 3300048915 Bacteria 4565
713 Ga0496114_0279121 3300048917 Bacteria 1473
714 Ga0496115_0016158 3300048918 Bacteria 5677
715 Ga0496116_0000242 3300048919 Bacteria 99455
716 Ga0496116_0001730 3300048919 Bacteria 23848
717 Ga0496116_0005949 3300048919 Bacteria 11187
718 Ga0496116_0134661 3300048919 Bacteria 1401
719 Ga0496117_0000270 3300048920 Bacteria 97077
720 Ga0496117_0002501 3300048920 Bacteria 23069
721 Ga0496117_0011018 3300048920 Bacteria 8141
722 Ga0496117_0021059 3300048920 Bacteria 5294
723 Ga0496117_0042727 3300048920 Bacteria 3305
724 Ga0496117_0049779 3300048920 Bacteria 2976
725 Ga0496118_0004563 3300048921 Bacteria 16329
726 Ga0496118_0023391 3300048921 Bacteria 5368
727 Ga0496118_0031917 3300048921 Bacteria 4351
728 Ga0496118_0038936 3300048921 Bacteria 3802
729 Ga0496118_0055627 3300048921 Bacteria 2983
730 Ga0496119_0196566 3300048922 Bacteria 1047
731 Ga0496120_0027062 3300048923 Bacteria 3533
732 Ga0496120_0035592 3300048923 Bacteria 2972
733 Ga0496121_0000318 3300048924 Bacteria 100833
734 Ga0496121_0021091 3300048924 Bacteria 6401
735 Ga0496121_0036018 3300048924 Bacteria 4419
736 Ga0496121_0094513 3300048924 Bacteria 2325
737 Ga0496121_0101359 3300048924 Bacteria 2220
738 Ga0496121_0110600 3300048924 Bacteria 2096
739 Ga0496121_0155785 3300048924 Bacteria 1676
740 Ga0496122_0004499 3300048925 Bacteria 17225
741 Ga0496122_0018570 3300048925 Bacteria 6413
742 Ga0496122_0036234 3300048925 Bacteria 3994
743 Ga0496123_0005798 3300048926 Bacteria 12263
744 Ga0496123_0012553 3300048926 Bacteria 7212
745 Ga0496123_0027227 3300048926 Bacteria 4262
746 Ga0496123_0049174 3300048926 Bacteria 2830
747 Ga0496124_0004075 3300048927 Bacteria 17310
748 Ga0496124_0035573 3300048927 Bacteria 4356
749 Ga0496124_0047584 3300048927 Bacteria 3668
750 Ga0496124_0068369 3300048927 Bacteria 2952
751 Ga0496124_0082563 3300048927 Bacteria 2637
752 Ga0496124_0150871 3300048927 Bacteria 1823
753 Ga0496124_0152762 3300048927 Bacteria 1809
754 Ga0496125_0004056 3300048928 Bacteria 17150
755 Ga0496125_0007474 3300048928 Bacteria 11623
756 Ga0496125_0014234 3300048928 Bacteria 7756
757 Ga0496125_0017348 3300048928 Bacteria 6870
758 Ga0496125_0033259 3300048928 Bacteria 4566
759 Ga0496125_0042854 3300048928 Bacteria 3849
760 Ga0496125_0049483 3300048928 Bacteria 3492
761 Ga0496125_0068939 3300048928 Bacteria 2778
762 Ga0496126_0058173 3300048929 Bacteria 3485
763 Ga0496126_0074250 3300048929 Bacteria 3020
764 Ga0496126_0105507 3300048929 Bacteria 2460
765 Ga0495678_001921 3300049459 Bacteria 15083
766 Ga0495678_002035 3300049459 Bacteria 14480
767 Ga0495678_005412 3300049459 Bacteria 7052
768 Ga0495678_007046 3300049459 Bacteria 5891
769 Ga0495678_014926 3300049459 Bacteria 3595
770 Ga0495678_016804 3300049459 Bacteria 3333
771 Ga0495678_019682 3300049459 Bacteria 3005
772 Ga0495678_019908 3300049459 Bacteria 2982
773 Ga0495678_022620 3300049459 Bacteria 2745
774 Ga0495682_0004188 3300049460 Bacteria 6247
775 Ga0495682_0006113 3300049460 Bacteria 4909
776 Ga0495682_0019640 3300049460 Bacteria 2540
777 Ga0495682_0073603 3300049460 Bacteria 1229
778 Ga0495682_0099947 3300049460 Bacteria 1040
779 Ga0501241_000573 3300049758 Bacteria 7895
780 Ga0501269_001400 3300049766 Bacteria 3149
781 nmdc:mga03683_10946_c1 3300050489 Bacteria 3266
782 nmdc:mga00v17_46459_c1 3300050491 Bacteria 2627
783 nmdc:mga00v17_51036_c1 3300050491 Bacteria 2515
784 nmdc:mga00v17_62635_c1 3300050491 Bacteria 2289
785 nmdc:mga08x19_111018_c1 3300050514 Bacteria 1829
786 Ga0500634_0012544 3300053161 Bacteria 4417
787 2511256229 2511231004 Bacteria 6669789
788 2511265750 2511231006 Bacteria 6794709
789 2511273703 2511231007 Bacteria 6306603
790 2511279666 2511231008 Bacteria 6624100
791 2511298864 2511231012 Bacteria 6738011
792 2511315294 2511231014 Bacteria 6462302
793 2511322180 2511231015 Bacteria 6598026
794 2511325309 2511231016 Bacteria 6704427
795 2511332291 2511231017 Bacteria 6503007
796 2511337730 2511231018 Bacteria 6436256
797 2511347373 2511231019 Bacteria 6520662
798 2511348066 2511231020 Bacteria 6115223
799 2511359210 2511231021 Bacteria 7302637
800 2511366068 2511231022 Bacteria 6719296
801 2511368877 2511231023 Bacteria 6808468
802 2512325271 2512047018 Bacteria 6663241
803 2555666987 2554235341 Bacteria 6867980
804 2583795370 2582580891 Bacteria 6800976
805 2597855237 2597489887 Bacteria 6666321
806 2597861239 2597489888 Bacteria 6179543
807 2597866986 2597489889 Bacteria 6297495
808 2599327784 2599185155 Bacteria 5827168
809 2599355607 2599185160 Bacteria 6844013
810 2599362990 2599185161 Bacteria 6960462
811 2599368704 2599185162 Bacteria 6957254
812 2599376099 2599185163 Bacteria 6995158
813 2599380713 2599185164 Bacteria 6841688
814 2599387771 2599185165 Bacteria 6843250
815 2599394957 2599185166 Bacteria 6959206
816 2599401126 2599185167 Bacteria 6353609
817 2599406722 2599185168 Bacteria 6997636
818 2599449541 2599185179 Bacteria 6611171
819 2599462441 2599185181 Bacteria 6844519
820 2599468136 2599185182 Bacteria 6883168
821 2599487363 2599185185 Bacteria 6652270
822 2599491458 2599185186 Bacteria 6831633
823 2599506066 2599185189 Bacteria 5862825
824 2599511613 2599185190 Bacteria 6285678
825 2599516587 2599185191 Bacteria 6297582
826 2599804281 2599185257 Bacteria 6492581
827 2599879360 2599185288 Bacteria 6666191
828 2599893116 2599185290 Bacteria 6289611
829 2599948694 2599185303 Bacteria 6512725
830 2600363153 2600254931 Bacteria 6734225
831 2601693313 2600255296 Bacteria 5784754
832 2601775229 2600255313 Bacteria 6842543
833 2621296506 2619619299 Bacteria 6649820
834 2624489443 2623620446 Bacteria 6500345
835 2643843432 2643221565 Bacteria 6216018
836 2643873529 2643221571 Bacteria 6228673
837 2643955977 2643221589 Bacteria 6250934
838 2644020099 2643221602 Bacteria 6249926
839 2644184107 2643221633 Bacteria 6733554
840 2644624454 2643221713 Bacteria 6554480
841 2671099631 2667528171 Bacteria 6900659
842 2671771290 2671180172 Bacteria 6495783
843 2677900430 2675903420 Bacteria 6247433
844 2715754446 2713897149 Bacteria 6506249
845 2723246143 2721755607 Bacteria 5841722
846 2738673452 2738541265 Bacteria 6594665
847 2738751845 2738541282 Bacteria 6593925
848 2738807584 2738541294 Bacteria 6925949
849 2738860886 2738541303 Bacteria 6591772
850 2738894944 2738541309 Bacteria 6926455
851 2739200895 2738543004 Bacteria 6381073
852 2739261721 2738543015 Bacteria 6750701
853 2743740808 2740892503 Bacteria 6855563
854 2774117971 2773857670 Bacteria 6407454
855 2774136596 2773857673 Bacteria 6513460
856 2784316458 2784132072 Bacteria 6596533
857 2808928052 2808606377 Bacteria 6646337
858 2808950766 2808606381 Bacteria 6646461
859 2808960731 2808606382 Bacteria 6841132
860 2808980105 2808606385 Bacteria 6711065
861 2808995825 2808606388 Bacteria 6706662
862 2809217625 2808606445 Bacteria 6057339
863 2817488015 2816332298 Bacteria 6852809
864 2819704778 2818991464 Bacteria 6907494
865 2834031272 2834028612 Bacteria 6354979
866 2842828433 2842826826 Bacteria 5974129
867 2842833846 2842832357 Bacteria 5959113
868 2842838246 2842837860 Bacteria 6066181
869 2842846074 2842843487 Bacteria 6004777
870 2844667472 2844665904 Bacteria 6817974
871 2852616671 2852612431 Bacteria 6885235
872 2852662672 2852657418 Bacteria 6472974
873 2852671639 2852667396 Bacteria 6885555
874 2860345310 2860339153 Bacteria 6846989
875 2860868039 2860867994 Bacteria 5645326
876 2880230764 2880230671 Bacteria 6140320
877 2904518547 2904518522 Bacteria 6068986
878 2904553496 2904550169 Bacteria 6221258
879 2908446617 2908446538 Bacteria 6829095
880 2917070721 2917070673 Bacteria 6868303
881 2919457962 2919456309 Bacteria 6586567
882 2919702352 2919697872 Bacteria 6553725
883 2923153640 2923153595 Bacteria 6870622
884 2929189922 2929189879 Bacteria 5930554
885 2931390983 2931390751 Bacteria 6273349
886 2931398509 2931396565 Bacteria 7251677
887 2935357944 2935353572 Unclassified 6955622
888 2939640467 2939636861 Bacteria 6297853
889 2945967192 2945961074 Bacteria 7342064
890 2946012909 2946006987 Bacteria 6705746
891 2946028227 2946027586 Bacteria 6049274
892 2947234749 2947233263 Bacteria 6439278
893 2974293673 2974289157 Bacteria 6080362
894 2984292475 2984286254 Bacteria 6702062
895 2998140136 2998139840 Bacteria 6073514
896 3007399036 3007395558 Bacteria 6755444
897 3007517548 3007511990 Bacteria 6481491
898 3007616983 3007614139 Bacteria 6053559
899 3007623872 3007619802 Bacteria 6411688
900 3007859588 3007855910 Bacteria 5637581
901 3007864684 3007861166 Bacteria 6045338
902 637317390 637000220 Bacteria 7074893
903 8015687900 8015687852 Bacteria 6613826
904 8019769434 8019769354 Bacteria 6924660
905 8019779575 8019775933 Bacteria 6858656
906 8029995116 8029995093 Bacteria 5990776
907 8054287247 8054285046 Bacteria 6919322
908 8054349268 8054347763 Bacteria 5901107
909 8055771000 8055770955 Bacteria 6827675
910 8055817953 8055817908 Bacteria 6609162
911 8056126148 8056125926 Bacteria 6228218
912 8056131922 8056131705 Bacteria 6107031
913 8056151179 8056148874 Bacteria 6479865
914 8056160126 8056155041 Bacteria 6486948
915 8056177046 8056172158 Bacteria 6133900
916 8056182351 8056177738 Bacteria 6748268
917 8056570863 8056569372 Bacteria 5997322
918 Ga0495654_0029812
919 MRS2a_Contig_126
920 JGI25162J39368_1000185
921 JGI25162J39368_1000219
922 JGI25163J39215_1000823
923 JGI25163J39215_1000834
924 JGI25164J39214_1000175
925 JGI25165J46597_1000175
926 JGI25165J46597_1000193
927 Ga0055538_1000012
928 Ga0055539_1000017
929 Ga0055533_1000021
930 Ga0055532_1000020
931 Ga0055525_1000117
932 Ga0055535_1002840
933 Ga0055536_1000237
934 Ga0055536_1000241
935 Ga0055530_10000159
936 Ga0055540_1000378
937 Ga0055540_1000725
938 Ga0055541_1000012
939 Ga0065714_10000191
940 Ga0065714_10005418
941 Ga0065714_10066629
942 Ga0065714_10082121
943 Ga0065714_10127279
944 Ga0065704_10167645
945 Ga0070670_100000258
946 Ga0070670_100001386
947 Ga0070661_100000146
948 Ga0070669_100000153
949 Ga0070662_100005956
950 Ga0070662_100064104
951 Ga0068853_100000184
952 Ga0070665_100037664
953 Ga0070664_100000049
954 Ga0070664_100060694
955 Ga0068851_10000018
956 Ga0075364_10087404
957 Ga0075432_10012519
958 Ga0075432_10062015
959 Ga0075362_10098534
960 Ga0075436_100042695
961 Ga0079104_1000735
962 Ga0105251_10001924
963 Ga0105251_10006951
964 Ga0105251_10014141
965 Ga0105244_10000186
966 Ga0105244_10001003
967 Ga0105244_10007387
968 Ga0105244_10009695
969 Ga0105244_10128377
970 Ga0105250_10015261
971 Ga0105250_10018871
972 Ga0105250_10031667
973 Ga0105243_10000075
974 Ga0105243_10000862
975 Ga0105243_10008056
976 Ga0105243_10020990
977 Ga0105243_10144963
978 Ga0105242_10001632
979 Ga0105242_10005717
980 Ga0105248_10002239
981 Ga0105237_10002463
982 Ga0105249_10010831
983 Ga0105246_10000958
984 Ga0105246_10003117
985 Ga0105246_10009773
986 Ga0157345_1000542
987 Ga0157373_10008757
988 Ga0157373_10013063
989 Ga0157373_10018433
990 Ga0157373_10028306
991 Ga0157373_10029749
992 Ga0157373_10031891
993 Ga0157371_10001263
994 Ga0157371_10012076
995 Ga0157371_10061080
996 Ga0157370_10019275
997 Ga0157370_10111586
998 Ga0157369_10018609
999 Ga0157369_10059449
1000 Ga0157369_10134462
1001 Ga0157369_10137913
1002 Ga0157369_10380808
1003 Ga0157375_10013471
1004 Ga0157375_10019265
1005 Ga0182008_10000367
1006 Ga0182008_10004974
1007 Ga0182008_10008487
1008 Ga0182008_10019285
1009 Ga0182008_10025932
1010 Ga0182006_1000961
1011 Ga0182006_1005096
1012 Ga0182007_10000742
1013 Ga0182005_1000885
1014 Ga0163161_10007642
1015 Ga0163161_10019012
1016 Ga0163161_10020244
1017 Ga0163161_10037102
1018 Ga0163161_10039705
1019 Ga0163161_10047063
1020 Ga0163161_10274463
1021 Ga0209435_101384
1022 Ga0209760_100020
1023 Ga0209760_100082
1024 Ga0209784_100007
1025 Ga0209566_100009
1026 Ga0209674_100021
1027 Ga0209147_100009
1028 Ga0209563_100018
1029 Ga0207427_100005
1030 Ga0207427_100006
1031 Ga0209437_100013
1032 Ga0209437_100018
1033 Ga0209258_100237
1034 Ga0209646_1000442
1035 Ga0209677_100012
1036 Ga0209759_1006997
1037 Ga0209233_1000021
1038 Ga0209233_1000022
1039 Ga0209676_1000015
1040 Ga0209676_1000157
1041 Ga0209676_1000222
1042 Ga0209676_1003038
1043 Ga0209050_1000030
1044 Ga0209050_1000296
1045 Ga0209050_1001068
1046 Ga0209051_1000143
1047 Ga0209051_1000295
1048 Ga0209257_1000422
1049 Ga0207656_10000009
1050 Ga0207696_1000165
1051 Ga0207696_1003213
1052 Ga0207655_1000135
1053 Ga0207655_1000652
1054 Ga0207655_1000961
1055 Ga0207655_1006175
1056 Ga0207655_1006536
1057 Ga0207655_1011532
1058 Ga0207655_1023395
1059 Ga0207713_1000692
1060 Ga0207713_1001400
1061 Ga0207713_1001900
1062 Ga0207713_1002728
1063 Ga0207713_1003858
1064 Ga0207713_1004885
1065 Ga0207713_1007816
1066 Ga0207713_1014386
1067 Ga0207713_1021307
1068 Ga0207671_10000713
1069 Ga0207649_10000007
1070 Ga0207681_10000163
1071 Ga0207650_10000178
1072 Ga0207650_10000210
1073 Ga0207706_10000050
1074 Ga0207706_10002848
1075 Ga0207686_10028645
1076 Ga0207709_10000269
1077 Ga0207709_10004904
1078 Ga0207709_10024799
1079 Ga0207709_10045434
1080 Ga0207709_10097616
1081 Ga0207711_10006135
1082 Ga0207679_10000013
1083 Ga0207679_10015924
1084 Ga0207712_10056233
1085 Ga0207640_10040090
1086 Ga0207639_10000079
1087 Ga0209281_1000237
1088 Ga0207428_10021747
1089 Ga0207428_10056099
1090 Ga0207428_10058422
1091 Ga0207428_10062871
1092 Ga0207428_10192579
1093 Ga0207428_10268625
1094 Ga0207428_10283735
1095 Ga0307517_10057686
1096 Ga0307511_10019783
1097 Ga0307509_10021696
1098 Ga0307408_100005159
1099 Ga0307405_10000636
1100 Ga0307405_10003329
1101 Ga0307412_10017529
1102 Ga0307412_10033246
1103 Ga0307412_10057313
1104 Ga0307416_100137823
1105 Ga0307416_100169459
1106 Ga0307414_10185343
1107 Ga0307411_10117986
1108 Ga0439438_000219
1109 Ga0439438_000524
1110 Ga0439438_000670
1111 Ga0439438_001361
1112 Ga0439438_002846
1113 Ga0439438_002857
1114 Ga0439438_004228
1115 Ga0439438_005183
1116 Ga0439438_007380
1117 Ga0439438_012022
1118 Ga0439438_012781
1119 Ga0439447_000330
1120 Ga0439447_000528
1121 Ga0439447_000718
1122 Ga0439447_001703
1123 Ga0439447_005265
1124 Ga0439447_022180
1125 Ga0439461_0002057
1126 Ga0439466_0000612
1127 Ga0439466_0000697
1128 Ga0439466_0002918
1129 Ga0439466_0003428
1130 Ga0439466_0004041
1131 Ga0439466_0005067
1132 Ga0439466_0007280
1133 Ga0439466_0018241
1134 Ga0439466_0024071
1135 Ga0439465_0001504
1136 Ga0451841_0345081
1137 Ga0439445_0010898
1138 Ga0439445_0014340
1139 Ga0439432_000934
1140 Ga0439432_003995
1141 Ga0439432_006064
1142 Ga0439432_010655
1143 Ga0439432_011893
1144 Ga0439432_021636
1145 Ga0439432_036142
1146 Ga0439451_000629
1147 Ga0439451_000701
1148 Ga0439451_001253
1149 Ga0439451_005067
1150 Ga0439451_005297
1151 Ga0439451_006692
1152 Ga0439452_000352
1153 Ga0439452_000435
1154 Ga0439452_000563
1155 Ga0439452_001007
1156 Ga0439452_001505
1157 Ga0439452_001897
1158 Ga0439452_003511
1159 Ga0439452_013819
1160 Ga0439452_013883
1161 Ga0439452_018751
1162 Ga0439456_001509
1163 Ga0439456_002453
1164 Ga0439456_009492
1165 Ga0439456_014382
1166 Ga0439456_016318
1167 Ga0439456_026799
1168 Ga0439463_000640
1169 Ga0439463_003554
1170 Ga0439463_014202
1171 Ga0450911_000393
1172 Ga0450911_000919
1173 Ga0450911_001252
1174 Ga0450911_002598
1175 Ga0450911_004078
1176 Ga0450911_005338
1177 Ga0450919_000148
1178 Ga0450921_000776
1179 Ga0450922_000807
1180 Ga0450922_000819
1181 Ga0450922_001375
1182 Ga0450923_000577
1183 Ga0450890_000098
1184 Ga0450894_001932
1185 Ga0450896_011801
1186 Ga0450898_000863
1187 Ga0450899_001832
1188 Ga0450900_000564
1189 Ga0450900_008617
1190 Ga0450902_002154
1191 Ga0450902_004796
1192 Ga0450902_005659
1193 Ga0450903_000427
1194 Ga0450903_000585
1195 Ga0450903_001352
1196 Ga0450903_004383
1197 Ga0450903_008713
1198 Ga0450904_001450
1199 Ga0450904_001615
1200 Ga0450905_001236
1201 Ga0450905_012465
1202 Ga0450906_000615
1203 Ga0450906_000778
1204 Ga0450906_002850
1205 Ga0450906_004020
1206 Ga0450906_015212
1207 Ga0450907_000357
1208 Ga0450907_001563
1209 Ga0450907_003076
1210 Ga0450910_000138
1211 Ga0439446_0010265
1212 Ga0439446_0019297
1213 Ga0450908_000519
1214 Ga0450909_000324
1215 Ga0450909_000548
1216 Ga0450909_005786
1217 Ga0450909_007184
1218 Ga0450909_009958
1219 Ga0439434_0000177
1220 Ga0439434_0013925
1221 Ga0439464_0008473
1222 Ga0439460_0000220
1223 Ga0439460_0000423
1224 Ga0439460_0009759
1225 Ga0450918_000835
1226 Ga0450918_010120
1227 Ga0450893_0009252
1228 Ga0450893_0013584
1229 Ga0450901_000636
1230 Ga0439440_0000589
1231 Ga0439440_0000879
1232 Ga0439440_0004943
1233 Ga0495617_000380
1234 Ga0495617_004640
1235 Ga0495617_011245
1236 Ga0495617_020728
1237 Ga0495617_037361
1238 Ga0495627_009991
1239 Ga0495627_047213
1240 Ga0495592_0028435
1241 Ga0495603_0028467
1242 Ga0495590_0002177
1243 Ga0495590_0003420
1244 Ga0495590_0012662
1245 Ga0495590_0031926
1246 Ga0495591_001346
1247 Ga0495591_002535
1248 Ga0495591_002732
1249 Ga0495591_005229
1250 Ga0495591_005358
1251 Ga0495591_006966
1252 Ga0495591_011465
1253 Ga0495591_020295
1254 Ga0495591_026471
1255 Ga0495591_030469
1256 Ga0495629_0010277
1257 Ga0495638_0001277
1258 Ga0495638_0002273
1259 Ga0495638_0006882
1260 Ga0495638_0009395
1261 Ga0495638_0010042
1262 Ga0495638_0021715
1263 Ga0495638_0021951
1264 Ga0495638_0030603
1265 Ga0495638_0057394
1266 Ga0495638_0058965
1267 Ga0495638_0060638
1268 Ga0495638_0078147
1269 Ga0495653_0015864
1270 Ga0495653_0088963
1271 Ga0495650_0002307
1272 Ga0495650_0006133
1273 Ga0495650_0006144
1274 Ga0495650_0007734
1275 Ga0495650_0008201
1276 Ga0495650_0012706
1277 Ga0495582_0005461
1278 Ga0495605_0001019
1279 Ga0495605_0001927
1280 Ga0495605_0014437
1281 Ga0495605_0016429
1282 Ga0495605_0022127
1283 Ga0495605_0026693
1284 Ga0495605_0033316
1285 Ga0495639_0000239
1286 Ga0495639_0007862
1287 Ga0495584_0001101
1288 Ga0495584_0004243
1289 Ga0495584_0004614
1290 Ga0495584_0008756
1291 Ga0495584_0009005
1292 Ga0495584_0013224
1293 Ga0495584_0026328
1294 Ga0495584_0037943
1295 Ga0495584_0046743
1296 Ga0495585_0000800
1297 Ga0495585_0005089
1298 Ga0495585_0006078
1299 Ga0495585_0011791
1300 Ga0495585_0015035
1301 Ga0495585_0017059
1302 Ga0495594_0004919
1303 Ga0495594_0024156
1304 Ga0495596_0000482
1305 Ga0495607_0002401
1306 Ga0495607_0002489
1307 Ga0495607_0005282
1308 Ga0495607_0006775
1309 Ga0495607_0009819
1310 Ga0495607_0012460
1311 Ga0495607_0015455
1312 Ga0495607_0016962
1313 Ga0495607_0019527
1314 Ga0495607_0032397
1315 Ga0495607_0038022
1316 Ga0495607_0069210
1317 Ga0495607_0084703
1318 Ga0495607_0119569
1319 Ga0495583_0001586
1320 Ga0495583_0004250
1321 Ga0495583_0004393
1322 Ga0495583_0006442
1323 Ga0495583_0033253
1324 Ga0495583_0040636
1325 Ga0495583_0060815
1326 Ga0495606_0003551
1327 Ga0495606_0043025
1328 Ga0495606_0058740
1329 Ga0495610_0007502
1330 Ga0495610_0008055
1331 Ga0495610_0008473
1332 Ga0495610_0008706
1333 Ga0495610_0010757
1334 Ga0495610_0011663
1335 Ga0495610_0012437
1336 Ga0495610_0022945
1337 Ga0495610_0027408
1338 Ga0495610_0067786
1339 Ga0495610_0090013
1340 Ga0495616_0001775
1341 Ga0495616_0002772
1342 Ga0495616_0008776
1343 Ga0495616_0009840
1344 Ga0495616_0013579
1345 Ga0495620_0005558
1346 Ga0495620_0006144
1347 Ga0495620_0009264
1348 Ga0495620_0013538
1349 Ga0495620_0023108
1350 Ga0495620_0062000
1351 Ga0495628_0032258
1352 Ga0495630_0018688
1353 Ga0495630_0041876
1354 Ga0495631_0001056
1355 Ga0495631_0005870
1356 Ga0495631_0014280
1357 Ga0495631_0018963
1358 Ga0495631_0038078
1359 Ga0495631_0099249
1360 Ga0495632_0000952
1361 Ga0495632_0002331
1362 Ga0495632_0005690
1363 Ga0495632_0007116
1364 Ga0495632_0009059
1365 Ga0495632_0011397
1366 Ga0495632_0020593
1367 Ga0495632_0028343
1368 Ga0495632_0032030
1369 Ga0495637_0001352
1370 Ga0495637_0001869
1371 Ga0495637_0003492
1372 Ga0495637_0003821
1373 Ga0495637_0003957
1374 Ga0495637_0005807
1375 Ga0495637_0008564
1376 Ga0495637_0010076
1377 Ga0495637_0010768
1378 Ga0495637_0015538
1379 Ga0495637_0015950
1380 Ga0495637_0024646
1381 Ga0495637_0036009
1382 Ga0495637_0061921
1383 Ga0495637_0116538
1384 Ga0495643_0005972
1385 Ga0495643_0010329
1386 Ga0495643_0018189
1387 Ga0495643_0030872
1388 Ga0495643_0033926
1389 Ga0495644_0002846
1390 Ga0495644_0003449
1391 Ga0495644_0025640
1392 Ga0495644_0047487
1393 Ga0495644_0066360
1394 Ga0495648_0001218
1395 Ga0495648_0002655
1396 Ga0495648_0002978
1397 Ga0495648_0011516
1398 Ga0495648_0018746
1399 Ga0495648_0026763
1400 Ga0495648_0048081
1401 Ga0495648_0061142
1402 Ga0495648_0067227
1403 Ga0495648_0137751
1404 Ga0495666_0001740
1405 Ga0495666_0009683
1406 Ga0495666_0058101
1407 Ga0495642_0000291
1408 Ga0495642_0000368
1409 Ga0495642_0000824
1410 Ga0495654_0001864
1411 Ga0495654_0003754
1412 Ga0495654_0004474
1413 Ga0495654_0005730
1414 Ga0495654_0006406
1415 Ga0495654_0013249
1416 Ga0495654_0018219
1417 Ga0495654_0021050
1418 Ga0495654_0025082
1419 Ga0495654_0025483
1420 Ga0495654_0032823
1421 Ga0495654_0038894
1422 Ga0495654_0080741
1423 Ga0495654_0107427
1424 Ga0495586_0002791
1425 Ga0495587_0013048
1426 Ga0495609_0000100
1427 Ga0495609_0000756
1428 Ga0495609_0003116
1429 Ga0495609_0012155
1430 Ga0495609_0073713
1431 Ga0495597_0002530
1432 Ga0495597_0004102
1433 Ga0495597_0006520
1434 Ga0495597_0007772
1435 Ga0495597_0014685
1436 Ga0495597_0015333
1437 Ga0495597_0030984
1438 Ga0495597_0043551
1439 Ga0495597_0067048
1440 Ga0495597_0069570
1441 Ga0495622_0000466
1442 Ga0495622_0013943
1443 Ga0495622_0043015
1444 Ga0495633_0007867
1445 Ga0495633_0039511
1446 Ga0495633_0109900
1447 Ga0495656_0019846
1448 Ga0495656_0094468
1449 Ga0495668_0002000
1450 Ga0495668_0015266
1451 Ga0495668_0019541
1452 Ga0495668_0153447
1453 Ga0495634_0002187
1454 Ga0495634_0024645
1455 Ga0495611_0002835
1456 Ga0495611_0010434
1457 Ga0495611_0020505
1458 Ga0495611_0032433
1459 Ga0495611_0071639
1460 Ga0495625_0011945
1461 Ga0495625_0011959
1462 Ga0495625_0015042
1463 Ga0495625_0030255
1464 Ga0495625_0039694
1465 Ga0495625_0044214
1466 Ga0495635_0001369
1467 Ga0495635_0003679
1468 Ga0495659_0000386
1469 Ga0495659_0014280
1470 Ga0495661_0000315
1471 Ga0495661_0001817
1472 Ga0495661_0008570
1473 Ga0495661_0010510
1474 Ga0495661_0011035
1475 Ga0495661_0021815
1476 Ga0495661_0043871
1477 Ga0495661_0059351
1478 Ga0495661_0176952
1479 Ga0495588_0005649
1480 Ga0495588_0024833
1481 Ga0495588_0119280
1482 Ga0495657_0037624
1483 Ga0495599_0117289
1484 Ga0495623_0006299
1485 Ga0495646_0004999
1486 Ga0495646_0005503
1487 Ga0495646_0052624
1488 Ga0495669_0012931
1489 Ga0495613_0012685
1490 Ga0495613_0019037
1491 Ga0495613_0087878
1492 Ga0495624_0007321
1493 Ga0495670_0001360
1494 Ga0495670_0003504
1495 Ga0495670_0027151
1496 Ga0495670_0101608
1497 Ga0495671_0000561
1498 Ga0495671_0003513
1499 Ga0495671_0006513
1500 Ga0495671_0007357
1501 Ga0495671_0015217
1502 Ga0495671_0040873
1503 Ga0495671_0051653
1504 Ga0495671_0146508
1505 Ga0495649_0002380
1506 Ga0495649_0006593
1507 Ga0495649_0010762
1508 Ga0495649_0015943
1509 Ga0495649_0016014
1510 Ga0495649_0018731
1511 Ga0495649_0019782
1512 Ga0495649_0022741
1513 Ga0495649_0050279
1514 Ga0495649_0101892
1515 Ga0495649_0179611
1516 Ga0495589_0000245
1517 Ga0495589_0003887
1518 Ga0495589_0007773
1519 Ga0495589_0015693
1520 Ga0495589_0025523
1521 Ga0495600_0010835
1522 Ga0495600_0051884
1523 Ga0495600_0206549
1524 Ga0495660_0012913
1525 Ga0495660_0013059
1526 Ga0495660_0019022
1527 Ga0495660_0019900
1528 Ga0495660_0025267
1529 Ga0495660_0041150
1530 Ga0495660_0043776
1531 Ga0495660_0061363
1532 Ga0495660_0082025
1533 Ga0495660_0105594
1534 Ga0495581_0009340
1535 Ga0495581_0017302
1536 Ga0495604_0003119
1537 Ga0495604_0003340
1538 Ga0495604_0023935
1539 Ga0495636_0000767
1540 Ga0495674_0026804
1541 Ga0495672_0001274
1542 Ga0495672_0003072
1543 Ga0495672_0003235
1544 Ga0495672_0006568
1545 Ga0495672_0010052
1546 Ga0495672_0010264
1547 Ga0495672_0018080
1548 Ga0495672_0020197
1549 Ga0495672_0024320
1550 Ga0495672_0024661
1551 Ga0495672_0030403
1552 Ga0495672_0039762
1553 Ga0495672_0087541
1554 Ga0495672_0100304
1555 Ga0495676_0026135
1556 Ga0495680_0002200
1557 Ga0495680_0021720
1558 Ga0495680_0023204
1559 Ga0495680_0029728
1560 Ga0495683_0001158
1561 Ga0495683_0001356
1562 Ga0495683_0006437
1563 Ga0495683_0042390
1564 Ga0495683_0051557
1565 Ga0495683_0107968
1566 Ga0495687_001396
1567 Ga0495687_002321
1568 Ga0495675_0016178
1569 Ga0495675_0042006
1570 Ga0495677_0003583
1571 Ga0495677_0050606
1572 Ga0495679_003553
1573 Ga0495679_005105
1574 Ga0495679_005606
1575 Ga0495679_008438
1576 Ga0495679_011316
1577 Ga0495679_012815
1578 Ga0495679_029115
1579 Ga0495685_012043
1580 Ga0495685_014978
1581 Ga0495673_0001264
1582 Ga0495673_0002023
1583 Ga0495673_0002502
1584 Ga0495673_0002635
1585 Ga0495673_0003580
1586 Ga0495673_0005113
1587 Ga0495673_0005115
1588 Ga0495673_0006415
1589 Ga0495673_0006429
1590 Ga0495673_0009010
1591 Ga0495673_0011140
1592 Ga0495673_0013147
1593 Ga0495673_0087299
1594 Ga0495681_0000692
1595 Ga0495681_0004652
1596 Ga0495681_0004750
1597 Ga0495681_0005133
1598 Ga0495681_0008475
1599 Ga0495681_0009464
1600 Ga0495681_0012042
1601 Ga0495681_0018491
1602 Ga0495681_0020123
1603 Ga0495681_0021753
1604 Ga0495681_0029926
1605 Ga0495681_0084064
1606 Ga0495681_0144730
1607 Ga0495684_0014275
1608 Ga0495686_0008623
1609 Ga0495686_0063547
1610 Ga0495593_0003540
1611 Ga0495593_0015671
1612 Ga0495593_0035663
1613 Ga0495593_0039078
1614 Ga0495593_0130099
1615 Ga0495602_0021898
1616 Ga0495626_0000941
1617 Ga0495626_0000945
1618 Ga0495626_0001363
1619 Ga0495626_0001521
1620 Ga0495626_0005270
1621 Ga0495626_0006295
1622 Ga0495626_0013180
1623 Ga0495626_0027677
1624 Ga0495626_0030728
1625 Ga0496102_0002217
1626 Ga0496103_0005207
1627 Ga0496106_0101769
1628 Ga0496107_0042718
1629 Ga0496112_0040329
1630 Ga0496114_0279121
1631 Ga0496115_0016158
1632 Ga0496116_0000242
1633 Ga0496116_0001730
1634 Ga0496116_0005949
1635 Ga0496116_0134661
1636 Ga0496117_0000270
1637 Ga0496117_0002501
1638 Ga0496117_0011018
1639 Ga0496117_0021059
1640 Ga0496117_0042727
1641 Ga0496117_0049779
1642 Ga0496118_0004563
1643 Ga0496118_0023391
1644 Ga0496118_0031917
1645 Ga0496118_0038936
1646 Ga0496118_0055627
1647 Ga0496119_0196566
1648 Ga0496120_0027062
1649 Ga0496120_0035592
1650 Ga0496121_0000318
1651 Ga0496121_0021091
1652 Ga0496121_0036018
1653 Ga0496121_0094513
1654 Ga0496121_0101359
1655 Ga0496121_0110600
1656 Ga0496121_0155785
1657 Ga0496122_0004499
1658 Ga0496122_0018570
1659 Ga0496122_0036234
1660 Ga0496123_0005798
1661 Ga0496123_0012553
1662 Ga0496123_0027227
1663 Ga0496123_0049174
1664 Ga0496124_0004075
1665 Ga0496124_0035573
1666 Ga0496124_0047584
1667 Ga0496124_0068369
1668 Ga0496124_0082563
1669 Ga0496124_0150871
1670 Ga0496124_0152762
1671 Ga0496125_0004056
1672 Ga0496125_0007474
1673 Ga0496125_0014234
1674 Ga0496125_0017348
1675 Ga0496125_0033259
1676 Ga0496125_0042854
1677 Ga0496125_0049483
1678 Ga0496125_0068939
1679 Ga0496126_0058173
1680 Ga0496126_0074250
1681 Ga0496126_0105507
1682 Ga0495678_001921
1683 Ga0495678_002035
1684 Ga0495678_005412
1685 Ga0495678_007046
1686 Ga0495678_014926
1687 Ga0495678_016804
1688 Ga0495678_019682
1689 Ga0495678_019908
1690 Ga0495678_022620
1691 Ga0495682_0004188
1692 Ga0495682_0006113
1693 Ga0495682_0019640
1694 Ga0495682_0073603
1695 Ga0495682_0099947
1696 Ga0501241_000573
1697 Ga0501269_001400
1698 nmdc:mga03683_10946_c1
1699 nmdc:mga00v17_46459_c1
1700 nmdc:mga00v17_51036_c1
1701 nmdc:mga00v17_62635_c1
1702 nmdc:mga08x19_111018_c1
1703 Ga0500634_0012544
1704 2511256229
1705 2511265750
1706 2511273703
1707 2511279666
1708 2511298864
1709 2511315294
1710 2511322180
1711 2511325309
1712 2511332291
1713 2511337730
1714 2511347373
1715 2511348066
1716 2511359210
1717 2511366068
1718 2511368877
1719 2512325271
1720 2555666987
1721 2583795370
1722 2597855237
1723 2597861239
1724 2597866986
1725 2599327784
1726 2599355607
1727 2599362990
1728 2599368704
1729 2599376099
1730 2599380713
1731 2599387771
1732 2599394957
1733 2599401126
1734 2599406722
1735 2599449541
1736 2599462441
1737 2599468136
1738 2599487363
1739 2599491458
1740 2599506066
1741 2599511613
1742 2599516587
1743 2599804281
1744 2599879360
1745 2599893116
1746 2599948694
1747 2600363153
1748 2601693313
1749 2601775229
1750 2621296506
1751 2624489443
1752 2643843432
1753 2643873529
1754 2643955977
1755 2644020099
1756 2644184107
1757 2644624454
1758 2671099631
1759 2671771290
1760 2677900430
1761 2715754446
1762 2723246143
1763 2738673452
1764 2738751845
1765 2738807584
1766 2738860886
1767 2738894944
1768 2739200895
1769 2739261721
1770 2743740808
1771 2774117971
1772 2774136596
1773 2784316458
1774 2808928052
1775 2808950766
1776 2808960731
1777 2808980105
1778 2808995825
1779 2809217625
1780 2817488015
1781 2819704778
1782 2834031272
1783 2842828433
1784 2842833846
1785 2842838246
1786 2842846074
1787 2844667472
1788 2852616671
1789 2852662672
1790 2852671639
1791 2860345310
1792 2860868039
1793 2880230764
1794 2904518547
1795 2904553496
1796 2908446617
1797 2917070721
1798 2919457962
1799 2919702352
1800 2923153640
1801 2929189922
1802 2931390983
1803 2931398509
1804 2935357944
1805 2939640467
1806 2945967192
1807 2946012909
1808 2946028227
1809 2947234749
1810 2974293673
1811 2984292475
1812 2998140136
1813 3007399036
1814 3007517548
1815 3007616983
1816 3007623872
1817 3007859588
1818 3007864684
1819 637317390
1820 8015687900
1821 8019769434
1822 8019779575
1823 8029995116
1824 8054287247
1825 8054349268
1826 8055771000
1827 8055817953
1828 8056126148
1829 8056131922
1830 8056151179
1831 8056160126
1832 8056177046
1833 8056182351
1834 8056570863

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10023

Aminopep

Putative aminopeptidase

12

325

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ev1-assembly1.cif.gz_A anabaena tic22 (protein transport) 0.446 79 137
5xxu-assembly1.cif.gz_N small subunit of toxoplasma gondii ribosome 0.4151 194 287
5xxu-assembly1.cif.gz_N small subunit of toxoplasma gondii ribosome 0.2501 194 287
7mdz-assembly1.cif.gz_NN 80s rabbit ribosome stalled with benzamide-chx 0.2489 159 286
8qu8-assembly1.cif.gz_D protac-mediated complex of kras with vhl/elongin-b/elongin-c/cullin-2/rbx1 0.2428 156 323
ID Description Score Start End Superfamily
af_P9WHM9_121_187_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.653 82 134 3.30.1490.20
af_Q2FVN0_86_212_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.5518 147 206 3.40.390.10
5flxN02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5119 216 286 1.10.287.10
af_C6KSM4_604_682_3.30.70.870 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.4829 84 134 3.30.70.870
5flxN02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.458 216 286 1.10.287.10
ID Description Score Start End GO Terms
AF-A0A0F3JXF2-F1-model_v4 Aminopeptidase 0.9489 16 287 GO:0004177
AF-A0A836NV60-F1-model_v4 deleted 0.9432 37 321
AF-A0A436RLW1-F1-model_v4 Aminopeptidase 0.9258 16 285 GO:0004177
AF-A0A2N2FY86-F1-model_v4 Aminopeptidase 0.9244 16 319 GO:0004177
AF-A0A1G0K5J9-F1-model_v4 Aminopeptidase 0.9213 16 321

Map