F485278
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 904 | 264 | 1808 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300025929|Ga0207664_10088568|Ga0207664_100885683 |
| Length | 317 |
| Sequence | VGSSNRLEASRPHNLPNANTTGWGLIAGNGRFPFLVLEGARSQGIDMAVIALKEEASEDLAQSAKRLHWVSLGELSKAIDLMHREGVTQAVMAGQVKHAKIFSSIRPDWKLAKLLFSLPRKNTDSLIGAVARVLEDEGIRLVDSTLFLKPLVPEAGVITKRAPDAHEAEDIAYGLTVARQISAMDIGQTVVISDRACVAVEAMEGTDETIARAARIAGGKPLVVVKVSKPGQDMRFDVPVVGLPTIEQMKSARATALALDAGRTLLFDKEKLLAQADAAGIAIQVFPPASAAQGNELSARQASIAEPRGTSRGMNEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 175 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 253 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 264 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 1.55 |
| Rhizosphere | 97.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207664_10088568 | 3300025929 | Bacteria | 2533 |
| 2 | JGI25406J46586_10069973 | 3300003203 | Bacteria | 1104 |
| 3 | Ga0070658_10003050 | 3300005327 | Bacteria | 13842 |
| 4 | Ga0070658_10029220 | 3300005327 | Bacteria | 4428 |
| 5 | Ga0070658_10048826 | 3300005327 | Unclassified | 3427 |
| 6 | Ga0070658_10120924 | 3300005327 | Bacteria | 2176 |
| 7 | Ga0070683_100001900 | 3300005329 | Bacteria | 16333 |
| 8 | Ga0070683_100005281 | 3300005329 | Bacteria | 10755 |
| 9 | Ga0070683_100012237 | 3300005329 | Bacteria | 7452 |
| 10 | Ga0070683_100033124 | 3300005329 | Bacteria | 4709 |
| 11 | Ga0070683_100040772 | 3300005329 | Bacteria | 4269 |
| 12 | Ga0070683_100209025 | 3300005329 | Bacteria | 1854 |
| 13 | Ga0070683_100280494 | 3300005329 | Bacteria | 1585 |
| 14 | Ga0070683_100320182 | 3300005329 | Unclassified | 1476 |
| 15 | Ga0070683_100527857 | 3300005329 | Unclassified | 1128 |
| 16 | Ga0070690_100001594 | 3300005330 | Bacteria | 11916 |
| 17 | Ga0070690_100316418 | 3300005330 | Bacteria | 1123 |
| 18 | Ga0070690_100326648 | 3300005330 | Bacteria | 1107 |
| 19 | Ga0070670_100003201 | 3300005331 | Bacteria | 13511 |
| 20 | Ga0068869_100067653 | 3300005334 | Bacteria | 2636 |
| 21 | Ga0070666_10000915 | 3300005335 | Bacteria | 17887 |
| 22 | Ga0070666_10159491 | 3300005335 | Bacteria | 1576 |
| 23 | Ga0070666_10459372 | 3300005335 | Bacteria | 920 |
| 24 | Ga0070680_100007816 | 3300005336 | Bacteria | 8149 |
| 25 | Ga0070680_100072604 | 3300005336 | Unclassified | 2828 |
| 26 | Ga0070680_100591952 | 3300005336 | Unclassified | 952 |
| 27 | Ga0068868_100000678 | 3300005338 | Bacteria | 22849 |
| 28 | Ga0068868_100000918 | 3300005338 | Bacteria | 20048 |
| 29 | Ga0068868_100023755 | 3300005338 | Bacteria | 4643 |
| 30 | Ga0068868_100367139 | 3300005338 | Unclassified | 1236 |
| 31 | Ga0070660_100002216 | 3300005339 | Bacteria | 13396 |
| 32 | Ga0070660_100214212 | 3300005339 | Bacteria | 1564 |
| 33 | Ga0070660_100281139 | 3300005339 | Bacteria | 1362 |
| 34 | Ga0070689_100045498 | 3300005340 | Bacteria | 3380 |
| 35 | Ga0070689_100336794 | 3300005340 | Bacteria | 1263 |
| 36 | Ga0070691_10001699 | 3300005341 | Bacteria | 9537 |
| 37 | Ga0070691_10136885 | 3300005341 | Unclassified | 1245 |
| 38 | Ga0070661_100025330 | 3300005344 | Bacteria | 4262 |
| 39 | Ga0070661_100178415 | 3300005344 | Bacteria | 1615 |
| 40 | Ga0070669_100089861 | 3300005353 | Bacteria | 2301 |
| 41 | Ga0070669_100217661 | 3300005353 | Bacteria | 1509 |
| 42 | Ga0070669_100562400 | 3300005353 | Unclassified | 952 |
| 43 | Ga0070675_100000136 | 3300005354 | Bacteria | 44031 |
| 44 | Ga0070675_100005130 | 3300005354 | Bacteria | 9996 |
| 45 | Ga0070675_100010267 | 3300005354 | Bacteria | 7307 |
| 46 | Ga0070671_100010333 | 3300005355 | Bacteria | 7488 |
| 47 | Ga0070671_100022081 | 3300005355 | Bacteria | 5200 |
| 48 | Ga0070671_100065451 | 3300005355 | Bacteria | 3028 |
| 49 | Ga0070673_100003742 | 3300005364 | Bacteria | 9538 |
| 50 | Ga0070673_100111787 | 3300005364 | Bacteria | 2267 |
| 51 | Ga0070673_100128215 | 3300005364 | Bacteria | 2125 |
| 52 | Ga0070673_100334700 | 3300005364 | Bacteria | 1340 |
| 53 | Ga0070688_100024993 | 3300005365 | Bacteria | 3532 |
| 54 | Ga0070688_100129899 | 3300005365 | Bacteria | 1698 |
| 55 | Ga0070667_100002038 | 3300005367 | Bacteria | 17910 |
| 56 | Ga0070667_100004312 | 3300005367 | Bacteria | 12010 |
| 57 | Ga0070667_100043529 | 3300005367 | Bacteria | 3768 |
| 58 | Ga0070667_100162796 | 3300005367 | Bacteria | 1966 |
| 59 | Ga0070667_100206419 | 3300005367 | Bacteria | 1745 |
| 60 | Ga0070667_100278990 | 3300005367 | Bacteria | 1500 |
| 61 | Ga0070709_10005850 | 3300005434 | Bacteria | 6669 |
| 62 | Ga0070709_10044371 | 3300005434 | Bacteria | 2753 |
| 63 | Ga0070709_10263242 | 3300005434 | Bacteria | 1247 |
| 64 | Ga0070709_10288878 | 3300005434 | Bacteria | 1194 |
| 65 | Ga0070714_100003182 | 3300005435 | Bacteria | 12206 |
| 66 | Ga0070714_100077867 | 3300005435 | Bacteria | 2881 |
| 67 | Ga0070714_100096505 | 3300005435 | Bacteria | 2597 |
| 68 | Ga0070714_100118114 | 3300005435 | Bacteria | 2356 |
| 69 | Ga0070713_100003816 | 3300005436 | Bacteria | 9971 |
| 70 | Ga0070713_100007840 | 3300005436 | Bacteria | 7528 |
| 71 | Ga0070713_100027097 | 3300005436 | Bacteria | 4508 |
| 72 | Ga0070713_100037077 | 3300005436 | Bacteria | 3940 |
| 73 | Ga0070713_100214376 | 3300005436 | Bacteria | 1745 |
| 74 | Ga0070710_10070219 | 3300005437 | Bacteria | 2017 |
| 75 | Ga0070711_100006359 | 3300005439 | Bacteria | 7118 |
| 76 | Ga0070711_100015355 | 3300005439 | Bacteria | 4847 |
| 77 | Ga0070711_100111553 | 3300005439 | Bacteria | 2008 |
| 78 | Ga0070711_100120314 | 3300005439 | Bacteria | 1941 |
| 79 | Ga0070711_100236266 | 3300005439 | Bacteria | 1427 |
| 80 | Ga0070711_100420821 | 3300005439 | Bacteria | 1088 |
| 81 | Ga0070705_100037525 | 3300005440 | Unclassified | 2734 |
| 82 | Ga0070705_100226318 | 3300005440 | Bacteria | 1298 |
| 83 | Ga0070708_100005443 | 3300005445 | Bacteria | 10093 |
| 84 | Ga0070708_100040585 | 3300005445 | Bacteria | 4076 |
| 85 | Ga0070708_100459283 | 3300005445 | Bacteria | 1201 |
| 86 | Ga0070708_100459551 | 3300005445 | Bacteria | 1201 |
| 87 | Ga0070708_100596055 | 3300005445 | Unclassified | 1042 |
| 88 | Ga0070681_10008586 | 3300005458 | Bacteria | 10011 |
| 89 | Ga0070681_10040925 | 3300005458 | Unclassified | 4642 |
| 90 | Ga0070681_10080937 | 3300005458 | Bacteria | 3204 |
| 91 | Ga0070681_10120786 | 3300005458 | Bacteria | 2555 |
| 92 | Ga0070681_10192630 | 3300005458 | Unclassified | 1958 |
| 93 | Ga0068867_100023290 | 3300005459 | Bacteria | 4434 |
| 94 | Ga0068867_100064139 | 3300005459 | Bacteria | 2731 |
| 95 | Ga0068867_100525537 | 3300005459 | Unclassified | 1021 |
| 96 | Ga0070685_10012215 | 3300005466 | Bacteria | 4507 |
| 97 | Ga0070706_100140330 | 3300005467 | Unclassified | 2256 |
| 98 | Ga0070707_100040186 | 3300005468 | Bacteria | 4475 |
| 99 | Ga0070707_100078931 | 3300005468 | Bacteria | 3176 |
| 100 | Ga0070707_100098827 | 3300005468 | Bacteria | 2827 |
| 101 | Ga0070707_100165732 | 3300005468 | Unclassified | 2153 |
| 102 | Ga0070707_100267356 | 3300005468 | Unclassified | 1663 |
| 103 | Ga0070698_100001738 | 3300005471 | Bacteria | 24305 |
| 104 | Ga0070698_100010877 | 3300005471 | Bacteria | 9681 |
| 105 | Ga0070698_100132531 | 3300005471 | Bacteria | 2447 |
| 106 | Ga0070698_100212854 | 3300005471 | Bacteria | 1867 |
| 107 | Ga0070699_100161923 | 3300005518 | Bacteria | 1980 |
| 108 | Ga0070679_100007104 | 3300005530 | Bacteria | 10449 |
| 109 | Ga0070679_100128201 | 3300005530 | Bacteria | 2519 |
| 110 | Ga0070679_100144403 | 3300005530 | Bacteria | 2358 |
| 111 | Ga0070684_100003837 | 3300005535 | Bacteria | 11361 |
| 112 | Ga0070684_100017195 | 3300005535 | Bacteria | 5929 |
| 113 | Ga0070684_100038530 | 3300005535 | Bacteria | 4106 |
| 114 | Ga0070684_100058346 | 3300005535 | Bacteria | 3373 |
| 115 | Ga0070684_100123815 | 3300005535 | Unclassified | 2327 |
| 116 | Ga0070684_100256125 | 3300005535 | Bacteria | 1600 |
| 117 | Ga0070697_100006562 | 3300005536 | Archaea | 9015 |
| 118 | Ga0070697_100090022 | 3300005536 | Bacteria | 2536 |
| 119 | Ga0070697_100126299 | 3300005536 | Unclassified | 2143 |
| 120 | Ga0070697_100199388 | 3300005536 | Bacteria | 1701 |
| 121 | Ga0068853_100061903 | 3300005539 | Bacteria | 3237 |
| 122 | Ga0068853_100111374 | 3300005539 | Bacteria | 2432 |
| 123 | Ga0068853_100131621 | 3300005539 | Bacteria | 2240 |
| 124 | Ga0068853_100292665 | 3300005539 | Bacteria | 1503 |
| 125 | Ga0068853_100374256 | 3300005539 | Unclassified | 1329 |
| 126 | Ga0070672_100001104 | 3300005543 | Bacteria | 16478 |
| 127 | Ga0070672_100024447 | 3300005543 | Bacteria | 4466 |
| 128 | Ga0070686_100006557 | 3300005544 | Bacteria | 6479 |
| 129 | Ga0070695_100087998 | 3300005545 | Bacteria | 2067 |
| 130 | Ga0070695_100195845 | 3300005545 | Unclassified | 1441 |
| 131 | Ga0070696_100024300 | 3300005546 | Bacteria | 4118 |
| 132 | Ga0070693_100044200 | 3300005547 | Bacteria | 2519 |
| 133 | Ga0070693_100081730 | 3300005547 | Unclassified | 1928 |
| 134 | Ga0070665_100000839 | 3300005548 | Bacteria | 40097 |
| 135 | Ga0070665_100003393 | 3300005548 | Bacteria | 17031 |
| 136 | Ga0070665_100548966 | 3300005548 | Unclassified | 1168 |
| 137 | Ga0070704_100023975 | 3300005549 | Unclassified | 3996 |
| 138 | Ga0070704_100127237 | 3300005549 | Bacteria | 1968 |
| 139 | Ga0068855_100009996 | 3300005563 | Bacteria | 11432 |
| 140 | Ga0068855_100016105 | 3300005563 | Bacteria | 8989 |
| 141 | Ga0068855_100042695 | 3300005563 | Bacteria | 5373 |
| 142 | Ga0068855_100043272 | 3300005563 | Bacteria | 5335 |
| 143 | Ga0068855_100060778 | 3300005563 | Bacteria | 4417 |
| 144 | Ga0068855_100075243 | 3300005563 | Bacteria | 3921 |
| 145 | Ga0068855_100077384 | 3300005563 | Unclassified | 3860 |
| 146 | Ga0068855_100115083 | 3300005563 | Bacteria | 3083 |
| 147 | Ga0068855_100166985 | 3300005563 | Bacteria | 2494 |
| 148 | Ga0068855_100188660 | 3300005563 | Bacteria | 2326 |
| 149 | Ga0068855_100270220 | 3300005563 | Bacteria | 1891 |
| 150 | Ga0068855_100308247 | 3300005563 | Unclassified | 1752 |
| 151 | Ga0070664_100000435 | 3300005564 | Bacteria | 31361 |
| 152 | Ga0070664_100068245 | 3300005564 | Bacteria | 3040 |
| 153 | Ga0070664_100108181 | 3300005564 | Bacteria | 2424 |
| 154 | Ga0068857_100003127 | 3300005577 | Bacteria | 13693 |
| 155 | Ga0068857_100004683 | 3300005577 | Bacteria | 11588 |
| 156 | Ga0068857_100013247 | 3300005577 | Bacteria | 7183 |
| 157 | Ga0068857_100066059 | 3300005577 | Bacteria | 3218 |
| 158 | Ga0068857_100101643 | 3300005577 | Bacteria | 2580 |
| 159 | Ga0068856_100005417 | 3300005614 | Bacteria | 12572 |
| 160 | Ga0068856_100006391 | 3300005614 | Bacteria | 11559 |
| 161 | Ga0068856_100022247 | 3300005614 | Bacteria | 6163 |
| 162 | Ga0068856_100038311 | 3300005614 | Bacteria | 4706 |
| 163 | Ga0068856_100213484 | 3300005614 | Bacteria | 1945 |
| 164 | Ga0068856_100257647 | 3300005614 | Bacteria | 1760 |
| 165 | Ga0068856_100401928 | 3300005614 | Unclassified | 1389 |
| 166 | Ga0068856_100545787 | 3300005614 | Bacteria | 1180 |
| 167 | Ga0068852_100008659 | 3300005616 | Bacteria | 7518 |
| 168 | Ga0068852_100054840 | 3300005616 | Bacteria | 3438 |
| 169 | Ga0068852_100307294 | 3300005616 | Bacteria | 1537 |
| 170 | Ga0068852_100308263 | 3300005616 | Bacteria | 1534 |
| 171 | Ga0068852_100700028 | 3300005616 | Bacteria | 1023 |
| 172 | Ga0068859_100010309 | 3300005617 | Bacteria | 9405 |
| 173 | Ga0068859_100014970 | 3300005617 | Bacteria | 7787 |
| 174 | Ga0068859_100016748 | 3300005617 | Bacteria | 7359 |
| 175 | Ga0068859_100059735 | 3300005617 | Bacteria | 3841 |
| 176 | Ga0068859_100122466 | 3300005617 | Bacteria | 2668 |
| 177 | Ga0068859_100221728 | 3300005617 | Bacteria | 1979 |
| 178 | Ga0068859_100436808 | 3300005617 | Unclassified | 1405 |
| 179 | Ga0068859_100485268 | 3300005617 | Bacteria | 1331 |
| 180 | Ga0068859_100492600 | 3300005617 | Bacteria | 1321 |
| 181 | Ga0068864_100002738 | 3300005618 | Bacteria | 14521 |
| 182 | Ga0068864_100121155 | 3300005618 | Bacteria | 2339 |
| 183 | Ga0068864_100239779 | 3300005618 | Bacteria | 1680 |
| 184 | Ga0068864_100346455 | 3300005618 | Unclassified | 1401 |
| 185 | Ga0068864_100518064 | 3300005618 | Bacteria | 1149 |
| 186 | Ga0068866_10047099 | 3300005718 | Unclassified | 2172 |
| 187 | Ga0068866_10153868 | 3300005718 | Unclassified | 1334 |
| 188 | Ga0068866_10180640 | 3300005718 | Bacteria | 1246 |
| 189 | Ga0068851_10133357 | 3300005834 | Bacteria | 1345 |
| 190 | Ga0068863_100000371 | 3300005841 | Bacteria | 45695 |
| 191 | Ga0068863_100011700 | 3300005841 | Bacteria | 8485 |
| 192 | Ga0068863_100032534 | 3300005841 | Bacteria | 4971 |
| 193 | Ga0068863_100036635 | 3300005841 | Bacteria | 4673 |
| 194 | Ga0068863_100049424 | 3300005841 | Bacteria | 3988 |
| 195 | Ga0068863_100140633 | 3300005841 | Bacteria | 2307 |
| 196 | Ga0068863_100297572 | 3300005841 | Bacteria | 1565 |
| 197 | Ga0068858_100004331 | 3300005842 | Bacteria | 13929 |
| 198 | Ga0068858_100009236 | 3300005842 | Bacteria | 9415 |
| 199 | Ga0068858_100105815 | 3300005842 | Bacteria | 2626 |
| 200 | Ga0068858_100259705 | 3300005842 | Bacteria | 1651 |
| 201 | Ga0068858_100554097 | 3300005842 | Bacteria | 1113 |
| 202 | Ga0068858_100628191 | 3300005842 | Bacteria | 1043 |
| 203 | Ga0068860_100008522 | 3300005843 | Bacteria | 10215 |
| 204 | Ga0068860_100022257 | 3300005843 | Bacteria | 6134 |
| 205 | Ga0068860_100061320 | 3300005843 | Bacteria | 3573 |
| 206 | Ga0068860_100158438 | 3300005843 | Bacteria | 2182 |
| 207 | Ga0068860_100385957 | 3300005843 | Unclassified | 1383 |
| 208 | Ga0068862_100199131 | 3300005844 | Bacteria | 1805 |
| 209 | Ga0068862_100332919 | 3300005844 | Bacteria | 1404 |
| 210 | Ga0081539_10026678 | 3300005985 | Unclassified | 3678 |
| 211 | Ga0070717_10004753 | 3300006028 | Bacteria | 9874 |
| 212 | Ga0070717_10007547 | 3300006028 | Bacteria | 8083 |
| 213 | Ga0070717_10129844 | 3300006028 | Bacteria | 2166 |
| 214 | Ga0070715_10003552 | 3300006163 | Bacteria | 4988 |
| 215 | Ga0070716_100000265 | 3300006173 | Bacteria | 21026 |
| 216 | Ga0070716_100000367 | 3300006173 | Bacteria | 18546 |
| 217 | Ga0070716_100048689 | 3300006173 | Bacteria | 2397 |
| 218 | Ga0070716_100121293 | 3300006173 | Bacteria | 1637 |
| 219 | Ga0070716_100239244 | 3300006173 | Unclassified | 1230 |
| 220 | Ga0070712_100037784 | 3300006175 | Bacteria | 3294 |
| 221 | Ga0070712_100051290 | 3300006175 | Bacteria | 2874 |
| 222 | Ga0070712_100406002 | 3300006175 | Unclassified | 1126 |
| 223 | Ga0097621_100001949 | 3300006237 | Bacteria | 14077 |
| 224 | Ga0097621_100010152 | 3300006237 | Bacteria | 6875 |
| 225 | Ga0097621_100021916 | 3300006237 | Unclassified | 4951 |
| 226 | Ga0097621_100042437 | 3300006237 | Bacteria | 3664 |
| 227 | Ga0097621_100045920 | 3300006237 | Bacteria | 3531 |
| 228 | Ga0097621_100052611 | 3300006237 | Bacteria | 3318 |
| 229 | Ga0097621_100415995 | 3300006237 | Bacteria | 1206 |
| 230 | Ga0097621_100452750 | 3300006237 | Bacteria | 1156 |
| 231 | Ga0068871_100004288 | 3300006358 | Bacteria | 9897 |
| 232 | Ga0068871_100020760 | 3300006358 | Bacteria | 5036 |
| 233 | Ga0068871_100048660 | 3300006358 | Bacteria | 3423 |
| 234 | Ga0068871_100051754 | 3300006358 | Bacteria | 3325 |
| 235 | Ga0068871_100068954 | 3300006358 | Bacteria | 2904 |
| 236 | Ga0068871_100085100 | 3300006358 | Bacteria | 2625 |
| 237 | Ga0068871_100094118 | 3300006358 | Bacteria | 2501 |
| 238 | Ga0068871_100327388 | 3300006358 | Unclassified | 1351 |
| 239 | Ga0075434_100010829 | 3300006871 | Bacteria | 8570 |
| 240 | Ga0075434_100137532 | 3300006871 | Unclassified | 2462 |
| 241 | Ga0075434_100208930 | 3300006871 | Bacteria | 1972 |
| 242 | Ga0075429_100609158 | 3300006880 | Archaea | 957 |
| 243 | Ga0068865_100017604 | 3300006881 | Bacteria | 4598 |
| 244 | Ga0068865_100094284 | 3300006881 | Bacteria | 2178 |
| 245 | Ga0075436_100004213 | 3300006914 | Bacteria | 9869 |
| 246 | Ga0075436_100005914 | 3300006914 | Bacteria | 8407 |
| 247 | Ga0075436_100049030 | 3300006914 | Bacteria | 2914 |
| 248 | Ga0075436_100142989 | 3300006914 | Unclassified | 1682 |
| 249 | Ga0097620_100010309 | 3300006931 | Bacteria | 9405 |
| 250 | Ga0097620_100014970 | 3300006931 | Bacteria | 7787 |
| 251 | Ga0097620_100016748 | 3300006931 | Bacteria | 7359 |
| 252 | Ga0097620_100059735 | 3300006931 | Bacteria | 3841 |
| 253 | Ga0097620_100122465 | 3300006931 | Bacteria | 2668 |
| 254 | Ga0097620_100221731 | 3300006931 | Bacteria | 1979 |
| 255 | Ga0097620_100268398 | 3300006931 | Unclassified | 1798 |
| 256 | Ga0097620_100436783 | 3300006931 | Unclassified | 1405 |
| 257 | Ga0097620_100485215 | 3300006931 | Bacteria | 1331 |
| 258 | Ga0097620_100492620 | 3300006931 | Bacteria | 1321 |
| 259 | Ga0075435_100038984 | 3300007076 | Bacteria | 3791 |
| 260 | Ga0075435_100159534 | 3300007076 | Bacteria | 1899 |
| 261 | Ga0075435_100204167 | 3300007076 | Bacteria | 1675 |
| 262 | Ga0099794_10000457 | 3300007265 | Bacteria | 13680 |
| 263 | Ga0099794_10002706 | 3300007265 | Bacteria | 6603 |
| 264 | Ga0099794_10044655 | 3300007265 | Bacteria | 2118 |
| 265 | Ga0099794_10063912 | 3300007265 | Unclassified | 1792 |
| 266 | Ga0099794_10067411 | 3300007265 | Unclassified | 1748 |
| 267 | Ga0099794_10071693 | 3300007265 | Bacteria | 1697 |
| 268 | Ga0099794_10093001 | 3300007265 | Bacteria | 1498 |
| 269 | Ga0099794_10118618 | 3300007265 | Unclassified | 1330 |
| 270 | Ga0099794_10185489 | 3300007265 | Bacteria | 1063 |
| 271 | Ga0099795_10013309 | 3300007788 | Unclassified | 2521 |
| 272 | Ga0105240_10000391 | 3300009093 | Bacteria | 81829 |
| 273 | Ga0105240_10002259 | 3300009093 | Bacteria | 31243 |
| 274 | Ga0105240_10007071 | 3300009093 | Bacteria | 16360 |
| 275 | Ga0105240_10007752 | 3300009093 | Bacteria | 15530 |
| 276 | Ga0105240_10008797 | 3300009093 | Bacteria | 14382 |
| 277 | Ga0105240_10016627 | 3300009093 | Bacteria | 9950 |
| 278 | Ga0105240_10018958 | 3300009093 | Bacteria | 9213 |
| 279 | Ga0105240_10056639 | 3300009093 | Bacteria | 4904 |
| 280 | Ga0105240_10065955 | 3300009093 | Bacteria | 4493 |
| 281 | Ga0105240_10083006 | 3300009093 | Bacteria | 3934 |
| 282 | Ga0105240_10144177 | 3300009093 | Bacteria | 2844 |
| 283 | Ga0105240_10481624 | 3300009093 | Bacteria | 1383 |
| 284 | Ga0105240_10495450 | 3300009093 | Bacteria | 1359 |
| 285 | Ga0105240_10520214 | 3300009093 | Bacteria | 1320 |
| 286 | Ga0105240_10833538 | 3300009093 | Bacteria | 997 |
| 287 | Ga0111539_10006672 | 3300009094 | Bacteria | 14867 |
| 288 | Ga0111539_10042929 | 3300009094 | Bacteria | 5426 |
| 289 | Ga0105245_10000579 | 3300009098 | Bacteria | 33283 |
| 290 | Ga0105245_10000827 | 3300009098 | Bacteria | 28177 |
| 291 | Ga0105245_10015898 | 3300009098 | Bacteria | 6556 |
| 292 | Ga0105245_10020675 | 3300009098 | Bacteria | 5770 |
| 293 | Ga0105245_10050526 | 3300009098 | Bacteria | 3727 |
| 294 | Ga0105245_10077615 | 3300009098 | Bacteria | 3028 |
| 295 | Ga0105245_10078163 | 3300009098 | Bacteria | 3019 |
| 296 | Ga0105245_10101701 | 3300009098 | Unclassified | 2661 |
| 297 | Ga0105245_10113057 | 3300009098 | Bacteria | 2528 |
| 298 | Ga0105245_10263507 | 3300009098 | Bacteria | 1678 |
| 299 | Ga0105245_10310416 | 3300009098 | Bacteria | 1551 |
| 300 | Ga0114129_10072289 | 3300009147 | Bacteria | 4808 |
| 301 | Ga0105243_10298865 | 3300009148 | Unclassified | 1458 |
| 302 | Ga0105243_10342699 | 3300009148 | Bacteria | 1369 |
| 303 | Ga0105241_10000998 | 3300009174 | Bacteria | 21446 |
| 304 | Ga0105241_10015222 | 3300009174 | Bacteria | 5633 |
| 305 | Ga0105241_10024716 | 3300009174 | Unclassified | 4462 |
| 306 | Ga0105241_10054503 | 3300009174 | Bacteria | 3061 |
| 307 | Ga0105241_10131533 | 3300009174 | Bacteria | 2027 |
| 308 | Ga0105241_10326397 | 3300009174 | Unclassified | 1325 |
| 309 | Ga0105241_10365037 | 3300009174 | Unclassified | 1257 |
| 310 | Ga0105241_10492157 | 3300009174 | Bacteria | 1092 |
| 311 | Ga0105242_10019003 | 3300009176 | Bacteria | 5383 |
| 312 | Ga0105242_10025918 | 3300009176 | Bacteria | 4643 |
| 313 | Ga0105242_10027397 | 3300009176 | Bacteria | 4524 |
| 314 | Ga0105242_10044638 | 3300009176 | Unclassified | 3590 |
| 315 | Ga0105242_10082704 | 3300009176 | Bacteria | 2687 |
| 316 | Ga0105242_10243051 | 3300009176 | Bacteria | 1619 |
| 317 | Ga0105248_10000556 | 3300009177 | Bacteria | 42341 |
| 318 | Ga0105248_10002632 | 3300009177 | Bacteria | 19965 |
| 319 | Ga0105248_10004875 | 3300009177 | Bacteria | 14836 |
| 320 | Ga0105248_10007047 | 3300009177 | Bacteria | 12315 |
| 321 | Ga0105248_10012800 | 3300009177 | Bacteria | 9253 |
| 322 | Ga0105248_10040749 | 3300009177 | Bacteria | 5206 |
| 323 | Ga0105248_10143142 | 3300009177 | Bacteria | 2697 |
| 324 | Ga0105248_10146199 | 3300009177 | Bacteria | 2668 |
| 325 | Ga0105248_10298063 | 3300009177 | Bacteria | 1816 |
| 326 | Ga0105248_10351924 | 3300009177 | Bacteria | 1658 |
| 327 | Ga0105248_10377190 | 3300009177 | Bacteria | 1597 |
| 328 | Ga0105248_10399245 | 3300009177 | Bacteria | 1548 |
| 329 | Ga0105237_10001090 | 3300009545 | Bacteria | 36343 |
| 330 | Ga0105237_10001318 | 3300009545 | Bacteria | 32923 |
| 331 | Ga0105237_10001791 | 3300009545 | Bacteria | 27763 |
| 332 | Ga0105237_10008309 | 3300009545 | Bacteria | 11263 |
| 333 | Ga0105237_10016782 | 3300009545 | Bacteria | 7602 |
| 334 | Ga0105237_10057211 | 3300009545 | Bacteria | 3903 |
| 335 | Ga0105237_10084974 | 3300009545 | Bacteria | 3154 |
| 336 | Ga0105237_10101674 | 3300009545 | Bacteria | 2866 |
| 337 | Ga0105238_10003080 | 3300009551 | Bacteria | 16631 |
| 338 | Ga0105238_10011625 | 3300009551 | Bacteria | 8868 |
| 339 | Ga0105238_10012285 | 3300009551 | Bacteria | 8636 |
| 340 | Ga0105238_10013612 | 3300009551 | Bacteria | 8215 |
| 341 | Ga0105238_10035869 | 3300009551 | Bacteria | 5041 |
| 342 | Ga0105238_10037255 | 3300009551 | Bacteria | 4945 |
| 343 | Ga0105238_10075773 | 3300009551 | Bacteria | 3356 |
| 344 | Ga0105238_10114224 | 3300009551 | Unclassified | 2680 |
| 345 | Ga0105238_10500286 | 3300009551 | Bacteria | 1216 |
| 346 | Ga0105249_10077028 | 3300009553 | Unclassified | 3092 |
| 347 | Ga0105249_10090127 | 3300009553 | Bacteria | 2867 |
| 348 | Ga0105249_10122325 | 3300009553 | Bacteria | 2475 |
| 349 | Ga0099796_10004924 | 3300010159 | Unclassified | 3284 |
| 350 | Ga0105239_10002592 | 3300010375 | Bacteria | 22902 |
| 351 | Ga0105239_10009694 | 3300010375 | Bacteria | 10829 |
| 352 | Ga0105239_10010882 | 3300010375 | Bacteria | 10165 |
| 353 | Ga0105239_10017658 | 3300010375 | Bacteria | 7891 |
| 354 | Ga0105239_10026819 | 3300010375 | Bacteria | 6341 |
| 355 | Ga0105239_10037748 | 3300010375 | Bacteria | 5294 |
| 356 | Ga0105239_10048082 | 3300010375 | Bacteria | 4677 |
| 357 | Ga0105239_10399189 | 3300010375 | Bacteria | 1556 |
| 358 | Ga0105239_10400132 | 3300010375 | Unclassified | 1554 |
| 359 | Ga0105246_10031235 | 3300011119 | Bacteria | 3523 |
| 360 | Ga0105246_10110539 | 3300011119 | Bacteria | 2018 |
| 361 | Ga0157371_10097378 | 3300013102 | Unclassified | 2085 |
| 362 | Ga0157370_10012939 | 3300013104 | Bacteria | 8626 |
| 363 | Ga0157370_10019301 | 3300013104 | Bacteria | 6843 |
| 364 | Ga0157370_10127944 | 3300013104 | Bacteria | 2370 |
| 365 | Ga0157370_10175980 | 3300013104 | Bacteria | 1989 |
| 366 | Ga0157370_10181600 | 3300013104 | Unclassified | 1955 |
| 367 | Ga0157370_10184516 | 3300013104 | Unclassified | 1937 |
| 368 | Ga0157369_10001514 | 3300013105 | Bacteria | 28521 |
| 369 | Ga0157369_10007349 | 3300013105 | Bacteria | 12682 |
| 370 | Ga0157369_10051325 | 3300013105 | Bacteria | 4463 |
| 371 | Ga0157369_10057221 | 3300013105 | Bacteria | 4207 |
| 372 | Ga0157369_10103491 | 3300013105 | Bacteria | 3033 |
| 373 | Ga0157369_10147214 | 3300013105 | Unclassified | 2490 |
| 374 | Ga0157369_10193209 | 3300013105 | Bacteria | 2138 |
| 375 | Ga0157369_10343598 | 3300013105 | Unclassified | 1550 |
| 376 | Ga0157369_10846882 | 3300013105 | Bacteria | 939 |
| 377 | Ga0157374_10022622 | 3300013296 | Bacteria | 5608 |
| 378 | Ga0157374_10046263 | 3300013296 | Unclassified | 4029 |
| 379 | Ga0157374_10132699 | 3300013296 | Bacteria | 2411 |
| 380 | Ga0157374_10171035 | 3300013296 | Bacteria | 2119 |
| 381 | Ga0157374_10340963 | 3300013296 | Bacteria | 1488 |
| 382 | Ga0157374_10397119 | 3300013296 | Bacteria | 1375 |
| 383 | Ga0157374_10416395 | 3300013296 | Bacteria | 1342 |
| 384 | Ga0157378_10000066 | 3300013297 | Bacteria | 93325 |
| 385 | Ga0157378_10003953 | 3300013297 | Bacteria | 13093 |
| 386 | Ga0157378_10023380 | 3300013297 | Bacteria | 5439 |
| 387 | Ga0157378_10031313 | 3300013297 | Bacteria | 4700 |
| 388 | Ga0157378_10051095 | 3300013297 | Bacteria | 3678 |
| 389 | Ga0157378_10085046 | 3300013297 | Bacteria | 2865 |
| 390 | Ga0157378_10154947 | 3300013297 | Bacteria | 2138 |
| 391 | Ga0157378_10362445 | 3300013297 | Bacteria | 1419 |
| 392 | Ga0157378_10684849 | 3300013297 | Bacteria | 1043 |
| 393 | Ga0163162_10000945 | 3300013306 | Bacteria | 27009 |
| 394 | Ga0163162_10024661 | 3300013306 | Bacteria | 5940 |
| 395 | Ga0163162_10040484 | 3300013306 | Bacteria | 4660 |
| 396 | Ga0163162_10121564 | 3300013306 | Unclassified | 2716 |
| 397 | Ga0163162_10126467 | 3300013306 | Unclassified | 2662 |
| 398 | Ga0163162_10180498 | 3300013306 | Bacteria | 2237 |
| 399 | Ga0163162_10263824 | 3300013306 | Bacteria | 1854 |
| 400 | Ga0163162_10322815 | 3300013306 | Bacteria | 1676 |
| 401 | Ga0157372_10004812 | 3300013307 | Bacteria | 14350 |
| 402 | Ga0157372_10013185 | 3300013307 | Bacteria | 8819 |
| 403 | Ga0157372_10027675 | 3300013307 | Bacteria | 6178 |
| 404 | Ga0157372_10085024 | 3300013307 | Bacteria | 3587 |
| 405 | Ga0157372_10211925 | 3300013307 | Bacteria | 2245 |
| 406 | Ga0157372_10409767 | 3300013307 | Unclassified | 1580 |
| 407 | Ga0157372_10575215 | 3300013307 | Bacteria | 1313 |
| 408 | Ga0157375_10000096 | 3300013308 | Bacteria | 88714 |
| 409 | Ga0157375_10005989 | 3300013308 | Bacteria | 10606 |
| 410 | Ga0157375_10043968 | 3300013308 | Bacteria | 4335 |
| 411 | Ga0157375_10060652 | 3300013308 | Bacteria | 3752 |
| 412 | Ga0157375_10126450 | 3300013308 | Bacteria | 2671 |
| 413 | Ga0157375_10776789 | 3300013308 | Unclassified | 1108 |
| 414 | Ga0163163_10001971 | 3300014325 | Bacteria | 17355 |
| 415 | Ga0163163_10002245 | 3300014325 | Bacteria | 16271 |
| 416 | Ga0163163_10003104 | 3300014325 | Bacteria | 14075 |
| 417 | Ga0163163_10008926 | 3300014325 | Bacteria | 8930 |
| 418 | Ga0163163_10013616 | 3300014325 | Bacteria | 7448 |
| 419 | Ga0163163_10016721 | 3300014325 | Bacteria | 6823 |
| 420 | Ga0163163_10037643 | 3300014325 | Bacteria | 4707 |
| 421 | Ga0163163_10048272 | 3300014325 | Bacteria | 4186 |
| 422 | Ga0163163_10061598 | 3300014325 | Bacteria | 3717 |
| 423 | Ga0163163_10067233 | 3300014325 | Unclassified | 3563 |
| 424 | Ga0163163_10170348 | 3300014325 | Bacteria | 2224 |
| 425 | Ga0163163_10282896 | 3300014325 | Bacteria | 1710 |
| 426 | Ga0163163_10306625 | 3300014325 | Bacteria | 1640 |
| 427 | Ga0157380_10134921 | 3300014326 | Bacteria | 2111 |
| 428 | Ga0157379_10000048 | 3300014968 | Bacteria | 74712 |
| 429 | Ga0157379_10006936 | 3300014968 | Bacteria | 9796 |
| 430 | Ga0157379_10007071 | 3300014968 | Bacteria | 9701 |
| 431 | Ga0157379_10106546 | 3300014968 | Unclassified | 2516 |
| 432 | Ga0157376_10000014 | 3300014969 | Bacteria | 303001 |
| 433 | Ga0157376_10000158 | 3300014969 | Bacteria | 47028 |
| 434 | Ga0157376_10020791 | 3300014969 | Bacteria | 5087 |
| 435 | Ga0157376_10093372 | 3300014969 | Bacteria | 2612 |
| 436 | Ga0157376_10213167 | 3300014969 | Bacteria | 1784 |
| 437 | Ga0157376_10234762 | 3300014969 | Unclassified | 1705 |
| 438 | Ga0157376_10481650 | 3300014969 | Unclassified | 1216 |
| 439 | Ga0213876_10091042 | 3300021384 | Unclassified | 1615 |
| 440 | Ga0213875_10084777 | 3300021388 | Unclassified | 1478 |
| 441 | Ga0207692_10057659 | 3300025898 | Bacteria | 1998 |
| 442 | Ga0207710_10077993 | 3300025900 | Bacteria | 1531 |
| 443 | Ga0207680_10012636 | 3300025903 | Bacteria | 4308 |
| 444 | Ga0207680_10058232 | 3300025903 | Bacteria | 2341 |
| 445 | Ga0207680_10141994 | 3300025903 | Bacteria | 1593 |
| 446 | Ga0207685_10052725 | 3300025905 | Bacteria | 1577 |
| 447 | Ga0207699_10053510 | 3300025906 | Bacteria | 2394 |
| 448 | Ga0207699_10066192 | 3300025906 | Unclassified | 2193 |
| 449 | Ga0207699_10202857 | 3300025906 | Bacteria | 1345 |
| 450 | Ga0207705_10072274 | 3300025909 | Unclassified | 2502 |
| 451 | Ga0207705_10099713 | 3300025909 | Bacteria | 2136 |
| 452 | Ga0207684_10026650 | 3300025910 | Unclassified | 4927 |
| 453 | Ga0207684_10237641 | 3300025910 | Bacteria | 1572 |
| 454 | Ga0207654_10002783 | 3300025911 | Bacteria | 8883 |
| 455 | Ga0207654_10011639 | 3300025911 | Bacteria | 4489 |
| 456 | Ga0207654_10033945 | 3300025911 | Bacteria | 2831 |
| 457 | Ga0207654_10047482 | 3300025911 | Bacteria | 2453 |
| 458 | Ga0207654_10109254 | 3300025911 | Bacteria | 1718 |
| 459 | Ga0207654_10416068 | 3300025911 | Bacteria | 937 |
| 460 | Ga0207707_10002258 | 3300025912 | Bacteria | 17436 |
| 461 | Ga0207707_10007218 | 3300025912 | Bacteria | 9671 |
| 462 | Ga0207707_10013893 | 3300025912 | Bacteria | 7021 |
| 463 | Ga0207707_10019841 | 3300025912 | Bacteria | 5868 |
| 464 | Ga0207707_10065483 | 3300025912 | Bacteria | 3165 |
| 465 | Ga0207707_10228373 | 3300025912 | Bacteria | 1620 |
| 466 | Ga0207695_10000470 | 3300025913 | Bacteria | 87551 |
| 467 | Ga0207695_10002146 | 3300025913 | Bacteria | 29894 |
| 468 | Ga0207695_10002387 | 3300025913 | Bacteria | 27843 |
| 469 | Ga0207695_10006140 | 3300025913 | Bacteria | 15663 |
| 470 | Ga0207695_10012000 | 3300025913 | Bacteria | 10425 |
| 471 | Ga0207695_10012068 | 3300025913 | Bacteria | 10387 |
| 472 | Ga0207695_10021525 | 3300025913 | Bacteria | 7354 |
| 473 | Ga0207695_10043389 | 3300025913 | Bacteria | 4793 |
| 474 | Ga0207695_10058904 | 3300025913 | Bacteria | 3985 |
| 475 | Ga0207695_10077372 | 3300025913 | Bacteria | 3379 |
| 476 | Ga0207695_10119822 | 3300025913 | Bacteria | 2601 |
| 477 | Ga0207671_10018063 | 3300025914 | Bacteria | 5420 |
| 478 | Ga0207671_10021284 | 3300025914 | Bacteria | 4921 |
| 479 | Ga0207671_10024949 | 3300025914 | Bacteria | 4492 |
| 480 | Ga0207671_10038256 | 3300025914 | Bacteria | 3555 |
| 481 | Ga0207671_10198521 | 3300025914 | Unclassified | 1566 |
| 482 | Ga0207693_10035670 | 3300025915 | Bacteria | 3921 |
| 483 | Ga0207693_10122096 | 3300025915 | Bacteria | 2046 |
| 484 | Ga0207693_10325986 | 3300025915 | Unclassified | 1202 |
| 485 | Ga0207663_10012104 | 3300025916 | Bacteria | 4654 |
| 486 | Ga0207663_10044414 | 3300025916 | Bacteria | 2727 |
| 487 | Ga0207663_10176876 | 3300025916 | Bacteria | 1520 |
| 488 | Ga0207660_10022362 | 3300025917 | Bacteria | 4260 |
| 489 | Ga0207662_10119047 | 3300025918 | Bacteria | 1654 |
| 490 | Ga0207657_10272435 | 3300025919 | Bacteria | 1345 |
| 491 | Ga0207657_10380593 | 3300025919 | Bacteria | 1111 |
| 492 | Ga0207649_10091158 | 3300025920 | Unclassified | 1996 |
| 493 | Ga0207649_10097054 | 3300025920 | Unclassified | 1943 |
| 494 | Ga0207652_10041528 | 3300025921 | Bacteria | 3910 |
| 495 | Ga0207652_10067295 | 3300025921 | Bacteria | 3106 |
| 496 | Ga0207646_10001594 | 3300025922 | Bacteria | 27709 |
| 497 | Ga0207646_10040355 | 3300025922 | Bacteria | 4197 |
| 498 | Ga0207646_10067849 | 3300025922 | Bacteria | 3184 |
| 499 | Ga0207646_10251741 | 3300025922 | Unclassified | 1596 |
| 500 | Ga0207681_10110697 | 3300025923 | Bacteria | 1997 |
| 501 | Ga0207681_10180794 | 3300025923 | Bacteria | 1606 |
| 502 | Ga0207681_10452508 | 3300025923 | Unclassified | 1045 |
| 503 | Ga0207681_10486065 | 3300025923 | Unclassified | 1009 |
| 504 | Ga0207694_10000818 | 3300025924 | Bacteria | 27805 |
| 505 | Ga0207694_10010381 | 3300025924 | Bacteria | 7020 |
| 506 | Ga0207694_10016689 | 3300025924 | Bacteria | 5550 |
| 507 | Ga0207694_10018272 | 3300025924 | Bacteria | 5300 |
| 508 | Ga0207694_10023498 | 3300025924 | Bacteria | 4680 |
| 509 | Ga0207694_10031937 | 3300025924 | Bacteria | 4026 |
| 510 | Ga0207694_10114030 | 3300025924 | Bacteria | 2152 |
| 511 | Ga0207694_10147884 | 3300025924 | Unclassified | 1892 |
| 512 | Ga0207694_10193928 | 3300025924 | Bacteria | 1651 |
| 513 | Ga0207650_10000527 | 3300025925 | Bacteria | 31363 |
| 514 | Ga0207650_10277832 | 3300025925 | Bacteria | 1363 |
| 515 | Ga0207659_10001273 | 3300025926 | Bacteria | 15105 |
| 516 | Ga0207659_10001861 | 3300025926 | Bacteria | 12496 |
| 517 | Ga0207659_10097328 | 3300025926 | Unclassified | 2211 |
| 518 | Ga0207687_10021179 | 3300025927 | Bacteria | 4317 |
| 519 | Ga0207687_10042910 | 3300025927 | Bacteria | 3115 |
| 520 | Ga0207687_10164740 | 3300025927 | Bacteria | 1705 |
| 521 | Ga0207687_10204769 | 3300025927 | Bacteria | 1544 |
| 522 | Ga0207687_10309016 | 3300025927 | Bacteria | 1276 |
| 523 | Ga0207687_10358537 | 3300025927 | Bacteria | 1189 |
| 524 | Ga0207700_10005188 | 3300025928 | Bacteria | 7761 |
| 525 | Ga0207700_10008715 | 3300025928 | Bacteria | 6298 |
| 526 | Ga0207700_10024811 | 3300025928 | Unclassified | 4155 |
| 527 | Ga0207700_10032163 | 3300025928 | Unclassified | 3738 |
| 528 | Ga0207700_10138221 | 3300025928 | Bacteria | 1998 |
| 529 | Ga0207700_10211967 | 3300025928 | Bacteria | 1638 |
| 530 | Ga0207700_10297711 | 3300025928 | Unclassified | 1392 |
| 531 | Ga0207700_10373911 | 3300025928 | Unclassified | 1245 |
| 532 | Ga0207700_10558054 | 3300025928 | Unclassified | 1017 |
| 533 | Ga0207664_10234828 | 3300025929 | Bacteria | 1595 |
| 534 | Ga0207644_10020256 | 3300025931 | Bacteria | 4521 |
| 535 | Ga0207644_10032200 | 3300025931 | Bacteria | 3656 |
| 536 | Ga0207644_10089511 | 3300025931 | Bacteria | 2291 |
| 537 | Ga0207644_10106157 | 3300025931 | Bacteria | 2117 |
| 538 | Ga0207706_10034377 | 3300025933 | Bacteria | 4510 |
| 539 | Ga0207686_10041865 | 3300025934 | Bacteria | 2796 |
| 540 | Ga0207686_10059551 | 3300025934 | Bacteria | 2413 |
| 541 | Ga0207686_10067097 | 3300025934 | Bacteria | 2294 |
| 542 | Ga0207686_10095796 | 3300025934 | Bacteria | 1970 |
| 543 | Ga0207686_10200939 | 3300025934 | Bacteria | 1427 |
| 544 | Ga0207686_10242090 | 3300025934 | Bacteria | 1313 |
| 545 | Ga0207709_10022981 | 3300025935 | Bacteria | 3544 |
| 546 | Ga0207670_10030524 | 3300025936 | Bacteria | 3444 |
| 547 | Ga0207670_10266409 | 3300025936 | Bacteria | 1330 |
| 548 | Ga0207669_10220203 | 3300025937 | Unclassified | 1392 |
| 549 | Ga0207704_10018391 | 3300025938 | Bacteria | 3646 |
| 550 | Ga0207704_10021044 | 3300025938 | Bacteria | 3465 |
| 551 | Ga0207704_10025185 | 3300025938 | Bacteria | 3243 |
| 552 | Ga0207704_10120861 | 3300025938 | Bacteria | 1792 |
| 553 | Ga0207665_10000028 | 3300025939 | Bacteria | 96657 |
| 554 | Ga0207665_10015114 | 3300025939 | Bacteria | 5070 |
| 555 | Ga0207665_10020973 | 3300025939 | Bacteria | 4294 |
| 556 | Ga0207665_10030036 | 3300025939 | Bacteria | 3591 |
| 557 | Ga0207665_10192407 | 3300025939 | Unclassified | 1483 |
| 558 | Ga0207691_10006640 | 3300025940 | Bacteria | 11164 |
| 559 | Ga0207691_10121715 | 3300025940 | Bacteria | 2312 |
| 560 | Ga0207711_10000640 | 3300025941 | Bacteria | 35100 |
| 561 | Ga0207711_10010200 | 3300025941 | Bacteria | 7799 |
| 562 | Ga0207711_10010568 | 3300025941 | Bacteria | 7673 |
| 563 | Ga0207711_10020435 | 3300025941 | Bacteria | 5519 |
| 564 | Ga0207711_10220136 | 3300025941 | Bacteria | 1736 |
| 565 | Ga0207711_10663189 | 3300025941 | Bacteria | 973 |
| 566 | Ga0207689_10068443 | 3300025942 | Bacteria | 2918 |
| 567 | Ga0207689_10108730 | 3300025942 | Unclassified | 2279 |
| 568 | Ga0207689_10178926 | 3300025942 | Bacteria | 1749 |
| 569 | Ga0207689_10344472 | 3300025942 | Bacteria | 1238 |
| 570 | Ga0207661_10001072 | 3300025944 | Bacteria | 18217 |
| 571 | Ga0207661_10015296 | 3300025944 | Bacteria | 5642 |
| 572 | Ga0207661_10046854 | 3300025944 | Bacteria | 3429 |
| 573 | Ga0207661_10122177 | 3300025944 | Bacteria | 2218 |
| 574 | Ga0207661_10422096 | 3300025944 | Bacteria | 1211 |
| 575 | Ga0207661_10455226 | 3300025944 | Bacteria | 1166 |
| 576 | Ga0207679_10005576 | 3300025945 | Bacteria | 7889 |
| 577 | Ga0207679_10007986 | 3300025945 | Bacteria | 6728 |
| 578 | Ga0207679_10380711 | 3300025945 | Unclassified | 1237 |
| 579 | Ga0207667_10000145 | 3300025949 | Bacteria | 107389 |
| 580 | Ga0207667_10000290 | 3300025949 | Bacteria | 69361 |
| 581 | Ga0207667_10008202 | 3300025949 | Bacteria | 12433 |
| 582 | Ga0207667_10021667 | 3300025949 | Bacteria | 7119 |
| 583 | Ga0207667_10034554 | 3300025949 | Bacteria | 5428 |
| 584 | Ga0207651_10007860 | 3300025960 | Bacteria | 5711 |
| 585 | Ga0207651_10143861 | 3300025960 | Bacteria | 1846 |
| 586 | Ga0207712_10131010 | 3300025961 | Bacteria | 1911 |
| 587 | Ga0207640_10172792 | 3300025981 | Bacteria | 1612 |
| 588 | Ga0207658_10003089 | 3300025986 | Bacteria | 11911 |
| 589 | Ga0207658_10004420 | 3300025986 | Bacteria | 9782 |
| 590 | Ga0207658_10262863 | 3300025986 | Bacteria | 1471 |
| 591 | Ga0207658_10471920 | 3300025986 | Bacteria | 1114 |
| 592 | Ga0207677_10001702 | 3300026023 | Bacteria | 11633 |
| 593 | Ga0207677_10002443 | 3300026023 | Bacteria | 9756 |
| 594 | Ga0207677_10022485 | 3300026023 | Bacteria | 3876 |
| 595 | Ga0207677_10412031 | 3300026023 | Unclassified | 1149 |
| 596 | Ga0207703_10006989 | 3300026035 | Bacteria | 8981 |
| 597 | Ga0207703_10026365 | 3300026035 | Bacteria | 4574 |
| 598 | Ga0207703_10180316 | 3300026035 | Bacteria | 1864 |
| 599 | Ga0207703_10212012 | 3300026035 | Bacteria | 1727 |
| 600 | Ga0207703_10225491 | 3300026035 | Bacteria | 1677 |
| 601 | Ga0207703_10328813 | 3300026035 | Bacteria | 1402 |
| 602 | Ga0207639_10025075 | 3300026041 | Bacteria | 4322 |
| 603 | Ga0207639_10237817 | 3300026041 | Bacteria | 1582 |
| 604 | Ga0207639_10323109 | 3300026041 | Unclassified | 1371 |
| 605 | Ga0207678_10312558 | 3300026067 | Bacteria | 1351 |
| 606 | Ga0207702_10051271 | 3300026078 | Bacteria | 3486 |
| 607 | Ga0207702_10057386 | 3300026078 | Bacteria | 3309 |
| 608 | Ga0207702_10060374 | 3300026078 | Bacteria | 3232 |
| 609 | Ga0207702_10180028 | 3300026078 | Bacteria | 1946 |
| 610 | Ga0207702_10687161 | 3300026078 | Bacteria | 1008 |
| 611 | Ga0207641_10004072 | 3300026088 | Bacteria | 12749 |
| 612 | Ga0207641_10012039 | 3300026088 | Bacteria | 7096 |
| 613 | Ga0207641_10026890 | 3300026088 | Bacteria | 4750 |
| 614 | Ga0207641_10154996 | 3300026088 | Bacteria | 2078 |
| 615 | Ga0207641_10214189 | 3300026088 | Bacteria | 1783 |
| 616 | Ga0207641_10257294 | 3300026088 | Bacteria | 1633 |
| 617 | Ga0207648_10014775 | 3300026089 | Bacteria | 7203 |
| 618 | Ga0207648_10082637 | 3300026089 | Bacteria | 2801 |
| 619 | Ga0207648_10242005 | 3300026089 | Bacteria | 1606 |
| 620 | Ga0207676_10003103 | 3300026095 | Bacteria | 11854 |
| 621 | Ga0207676_10281555 | 3300026095 | Bacteria | 1510 |
| 622 | Ga0207674_10000264 | 3300026116 | Bacteria | 65695 |
| 623 | Ga0207674_10001670 | 3300026116 | Bacteria | 28551 |
| 624 | Ga0207674_10003178 | 3300026116 | Bacteria | 20227 |
| 625 | Ga0207674_10011784 | 3300026116 | Bacteria | 9809 |
| 626 | Ga0207674_10047969 | 3300026116 | Bacteria | 4375 |
| 627 | Ga0207674_10391832 | 3300026116 | Unclassified | 1343 |
| 628 | Ga0207698_10001006 | 3300026142 | Bacteria | 16400 |
| 629 | Ga0207698_10036501 | 3300026142 | Bacteria | 3609 |
| 630 | Ga0207698_10108410 | 3300026142 | Bacteria | 2321 |
| 631 | Ga0207698_10116086 | 3300026142 | Unclassified | 2255 |
| 632 | Ga0209179_1020983 | 3300027512 | Unclassified | 1272 |
| 633 | Ga0209588_1016671 | 3300027671 | Unclassified | 2271 |
| 634 | Ga0209588_1018828 | 3300027671 | Unclassified | 2150 |
| 635 | Ga0209588_1033512 | 3300027671 | Unclassified | 1647 |
| 636 | Ga0209588_1037250 | 3300027671 | Unclassified | 1565 |
| 637 | Ga0209588_1059399 | 3300027671 | Unclassified | 1237 |
| 638 | Ga0207428_10046337 | 3300027907 | Bacteria | 3497 |
| 639 | Ga0268266_10000072 | 3300028379 | Bacteria | 232245 |
| 640 | Ga0268266_10007146 | 3300028379 | Bacteria | 10116 |
| 641 | Ga0268266_10051727 | 3300028379 | Bacteria | 3527 |
| 642 | Ga0268266_10414093 | 3300028379 | Bacteria | 1276 |
| 643 | Ga0268265_10342313 | 3300028380 | Bacteria | 1362 |
| 644 | Ga0268264_10005574 | 3300028381 | Bacteria | 10663 |
| 645 | Ga0268264_10008566 | 3300028381 | Bacteria | 8501 |
| 646 | Ga0268264_10014228 | 3300028381 | Bacteria | 6543 |
| 647 | Ga0268264_10103298 | 3300028381 | Bacteria | 2482 |
| 648 | Ga0268264_10310788 | 3300028381 | Unclassified | 1487 |
| 649 | Ga0265323_10001824 | 3300028653 | Bacteria | 10107 |
| 650 | Ga0265336_10011577 | 3300028666 | Bacteria | 2992 |
| 651 | Ga0265338_10057022 | 3300028800 | Unclassified | 3459 |
| 652 | Ga0265324_10007051 | 3300029957 | Bacteria | 4610 |
| 653 | Ga0265330_10049959 | 3300031235 | Bacteria | 1835 |
| 654 | Ga0265330_10090028 | 3300031235 | Bacteria | 1318 |
| 655 | Ga0265320_10000164 | 3300031240 | Bacteria | 55580 |
| 656 | Ga0265325_10034314 | 3300031241 | Bacteria | 2700 |
| 657 | Ga0265325_10039185 | 3300031241 | Bacteria | 2496 |
| 658 | Ga0265325_10067762 | 3300031241 | Unclassified | 1798 |
| 659 | Ga0265325_10120453 | 3300031241 | Bacteria | 1266 |
| 660 | Ga0265329_10014906 | 3300031242 | Bacteria | 2731 |
| 661 | Ga0265331_10000594 | 3300031250 | Bacteria | 32157 |
| 662 | Ga0265316_10001101 | 3300031344 | Bacteria | 29304 |
| 663 | Ga0265316_10001923 | 3300031344 | Bacteria | 21816 |
| 664 | Ga0265316_10003154 | 3300031344 | Bacteria | 16783 |
| 665 | Ga0265316_10055804 | 3300031344 | Bacteria | 3088 |
| 666 | Ga0265316_10105686 | 3300031344 | Unclassified | 2136 |
| 667 | Ga0265316_10178127 | 3300031344 | Unclassified | 1583 |
| 668 | Ga0265316_10196801 | 3300031344 | Unclassified | 1495 |
| 669 | Ga0265316_10215617 | 3300031344 | Unclassified | 1418 |
| 670 | Ga0265316_10296281 | 3300031344 | Archaea | 1179 |
| 671 | Ga0265313_10003281 | 3300031595 | Bacteria | 13290 |
| 672 | Ga0265314_10001266 | 3300031711 | Bacteria | 28791 |
| 673 | Ga0265314_10005327 | 3300031711 | Bacteria | 11638 |
| 674 | Ga0265314_10008616 | 3300031711 | Bacteria | 8721 |
| 675 | Ga0265314_10018082 | 3300031711 | Bacteria | 5509 |
| 676 | Ga0265314_10111170 | 3300031711 | Bacteria | 1741 |
| 677 | Ga0265342_10021316 | 3300031712 | Bacteria | 4142 |
| 678 | Ga0265342_10266066 | 3300031712 | Bacteria | 911 |
| 679 | Ga0307510_10074621 | 3300033180 | Bacteria | 3349 |
| 680 | Ga0373934_0003027 | 3300035086 | Bacteria | 6137 |
| 681 | Ga0373940_0006103 | 3300035088 | Unclassified | 2651 |
| 682 | Ga0373923_0055010 | 3300035111 | Bacteria | 1676 |
| 683 | Ga0373936_0064057 | 3300035113 | Bacteria | 1506 |
| 684 | Ga0373953_0001899 | 3300035117 | Bacteria | 6195 |
| 685 | Ga0373953_0053522 | 3300035117 | Bacteria | 1636 |
| 686 | Ga0373954_0001617 | 3300035118 | Bacteria | 9207 |
| 687 | Ga0373954_0017771 | 3300035118 | Bacteria | 3197 |
| 688 | Ga0373954_0033868 | 3300035118 | Bacteria | 2364 |
| 689 | Ga0373954_0108445 | 3300035118 | Bacteria | 1342 |
| 690 | Ga0373956_0003458 | 3300035119 | Bacteria | 6353 |
| 691 | Ga0373957_0003790 | 3300035120 | Bacteria | 4531 |
| 692 | Ga0373943_0198130 | 3300035170 | Bacteria | 1110 |
| 693 | Ga0373943_0198713 | 3300035170 | Unclassified | 1109 |
| 694 | Ga0373946_0054921 | 3300035171 | Bacteria | 1678 |
| 695 | Ga0373955_0001915 | 3300035172 | Bacteria | 8985 |
| 696 | Ga0373955_0023421 | 3300035172 | Bacteria | 3145 |
| 697 | Ga0373955_0032074 | 3300035172 | Bacteria | 2755 |
| 698 | Ga0373955_0187404 | 3300035172 | Bacteria | 1229 |
| 699 | Ga0373955_0315839 | 3300035172 | Unclassified | 943 |
| 700 | Ga0373935_0010194 | 3300035692 | Bacteria | 5630 |
| 701 | Ga0373935_0036583 | 3300035692 | Bacteria | 3070 |
| 702 | Ga0373935_0229795 | 3300035692 | Bacteria | 1291 |
| 703 | Ga0373927_0000114 | 3300035695 | Bacteria | 60543 |
| 704 | Ga0373927_0000738 | 3300035695 | Bacteria | 24971 |
| 705 | Ga0373927_0001078 | 3300035695 | Bacteria | 20830 |
| 706 | Ga0373927_0001327 | 3300035695 | Bacteria | 18670 |
| 707 | Ga0373927_0022705 | 3300035695 | Bacteria | 4108 |
| 708 | Ga0373927_0201438 | 3300035695 | Bacteria | 1307 |
| 709 | Ga0373933_0000693 | 3300035724 | Bacteria | 20752 |
| 710 | Ga0373933_0037183 | 3300035724 | Unclassified | 2855 |
| 711 | Ga0373933_0086429 | 3300035724 | Unclassified | 1930 |
| 712 | Ga0373933_0088564 | 3300035724 | Unclassified | 1907 |
| 713 | Ga0373947_0000597 | 3300035725 | Bacteria | 21269 |
| 714 | Ga0373947_0005282 | 3300035725 | Bacteria | 7551 |
| 715 | Ga0373947_0037007 | 3300035725 | Bacteria | 2895 |
| 716 | Ga0373947_0048104 | 3300035725 | Bacteria | 2558 |
| 717 | Ga0373937_0001689 | 3300036401 | Bacteria | 18562 |
| 718 | Ga0373937_0007146 | 3300036401 | Bacteria | 9651 |
| 719 | Ga0373937_0007683 | 3300036401 | Bacteria | 9344 |
| 720 | Ga0373937_0009122 | 3300036401 | Bacteria | 8609 |
| 721 | Ga0373937_0013688 | 3300036401 | Bacteria | 7146 |
| 722 | Ga0373937_0025287 | 3300036401 | Bacteria | 5360 |
| 723 | Ga0373937_0041183 | 3300036401 | Bacteria | 4214 |
| 724 | Ga0373937_0096441 | 3300036401 | Unclassified | 2743 |
| 725 | Ga0373937_0143143 | 3300036401 | Bacteria | 2237 |
| 726 | Ga0373937_0144769 | 3300036401 | Bacteria | 2224 |
| 727 | Ga0373937_0147451 | 3300036401 | Bacteria | 2203 |
| 728 | Ga0373937_0218258 | 3300036401 | Bacteria | 1795 |
| 729 | Ga0373937_0318404 | 3300036401 | Unclassified | 1472 |
| 730 | Ga0373937_0460545 | 3300036401 | Unclassified | 1208 |
| 731 | Ga0373937_0731828 | 3300036401 | Unclassified | 936 |
| 732 | Ga0373925_0000115 | 3300037068 | Bacteria | 85776 |
| 733 | Ga0373925_0000147 | 3300037068 | Bacteria | 75183 |
| 734 | Ga0373925_0006711 | 3300037068 | Bacteria | 8444 |
| 735 | Ga0373925_0077416 | 3300037068 | Bacteria | 2524 |
| 736 | Ga0373925_0080532 | 3300037068 | Bacteria | 2475 |
| 737 | Ga0373925_0096980 | 3300037068 | Unclassified | 2261 |
| 738 | Ga0373925_0272399 | 3300037068 | Bacteria | 1362 |
| 739 | Ga0395900_0656826 | 3300037418 | Unclassified | 985 |
| 740 | Ga0436364_0781733 | 3300037853 | Unclassified | 1199 |
| 741 | Ga0436365_0256021 | 3300039437 | Unclassified | 3442 |
| 742 | Ga0436365_0645428 | 3300039437 | Bacteria | 3053 |
| 743 | Ga0436362_0543372 | 3300039453 | Unclassified | 3416 |
| 744 | Ga0451577_0102207 | 3300042876 | Bacteria | 2561 |
| 745 | Ga0451576_0115075 | 3300045051 | Bacteria | 2800 |
| 746 | Ga0451576_0350086 | 3300045051 | Bacteria | 1547 |
| 747 | Ga0466958_0065425 | 3300045836 | Bacteria | 2219 |
| 748 | Ga0495592_0036311 | 3300046454 | Unclassified | 3712 |
| 749 | Ga0495592_0046124 | 3300046454 | Bacteria | 3249 |
| 750 | Ga0495592_0046439 | 3300046454 | Unclassified | 3237 |
| 751 | Ga0495592_0088576 | 3300046454 | Unclassified | 2224 |
| 752 | Ga0495603_0008797 | 3300046455 | Bacteria | 6102 |
| 753 | Ga0495603_0112687 | 3300046455 | Bacteria | 1586 |
| 754 | Ga0495629_0090256 | 3300046459 | Bacteria | 2138 |
| 755 | Ga0495641_0031442 | 3300046461 | Bacteria | 2536 |
| 756 | Ga0495651_0023207 | 3300046462 | Unclassified | 4825 |
| 757 | Ga0495651_0213737 | 3300046462 | Bacteria | 1340 |
| 758 | Ga0495653_0074786 | 3300046463 | Bacteria | 2523 |
| 759 | Ga0495580_0000388 | 3300046472 | Bacteria | 36163 |
| 760 | Ga0495580_0000800 | 3300046472 | Bacteria | 27228 |
| 761 | Ga0495580_0007663 | 3300046472 | Bacteria | 8658 |
| 762 | Ga0495580_0014363 | 3300046472 | Bacteria | 6007 |
| 763 | Ga0495580_0040911 | 3300046472 | Unclassified | 3308 |
| 764 | Ga0495580_0051285 | 3300046472 | Bacteria | 2917 |
| 765 | Ga0495580_0065664 | 3300046472 | Bacteria | 2541 |
| 766 | Ga0495580_0071375 | 3300046472 | Bacteria | 2426 |
| 767 | Ga0495580_0211411 | 3300046472 | Bacteria | 1335 |
| 768 | Ga0495580_0309047 | 3300046472 | Bacteria | 1076 |
| 769 | Ga0495582_0004522 | 3300046473 | Bacteria | 7814 |
| 770 | Ga0495582_0008694 | 3300046473 | Bacteria | 5599 |
| 771 | Ga0495582_0014003 | 3300046473 | Unclassified | 4416 |
| 772 | Ga0495582_0274907 | 3300046473 | Unclassified | 967 |
| 773 | Ga0495639_0124156 | 3300046475 | Unclassified | 1233 |
| 774 | Ga0495662_0008262 | 3300046476 | Bacteria | 5125 |
| 775 | Ga0495662_0029319 | 3300046476 | Bacteria | 2658 |
| 776 | Ga0495664_0004398 | 3300046477 | Bacteria | 7710 |
| 777 | Ga0495664_0287333 | 3300046477 | Bacteria | 993 |
| 778 | Ga0495594_0097089 | 3300046499 | Unclassified | 1656 |
| 779 | Ga0495594_0156496 | 3300046499 | Unclassified | 1294 |
| 780 | Ga0495618_0211646 | 3300046514 | Bacteria | 1225 |
| 781 | Ga0495628_0025093 | 3300046516 | Bacteria | 4873 |
| 782 | Ga0495628_0083859 | 3300046516 | Bacteria | 2474 |
| 783 | Ga0495628_0232337 | 3300046516 | Unclassified | 1382 |
| 784 | Ga0495628_0446418 | 3300046516 | Unclassified | 940 |
| 785 | Ga0495630_0004578 | 3300046517 | Bacteria | 9691 |
| 786 | Ga0495630_0058431 | 3300046517 | Unclassified | 2891 |
| 787 | Ga0495666_0146648 | 3300046526 | Unclassified | 1098 |
| 788 | Ga0495666_0148253 | 3300046526 | Unclassified | 1092 |
| 789 | Ga0495666_0155470 | 3300046526 | Bacteria | 1062 |
| 790 | Ga0495652_0212158 | 3300046529 | Bacteria | 1461 |
| 791 | Ga0495652_0290741 | 3300046529 | Bacteria | 1192 |
| 792 | Ga0495652_0297309 | 3300046529 | Unclassified | 1175 |
| 793 | Ga0495665_0030972 | 3300046531 | Unclassified | 2862 |
| 794 | Ga0495665_0047456 | 3300046531 | Bacteria | 2278 |
| 795 | Ga0495665_0173972 | 3300046531 | Bacteria | 1120 |
| 796 | Ga0495640_0025931 | 3300046533 | Unclassified | 4245 |
| 797 | Ga0495587_0000640 | 3300046536 | Bacteria | 23483 |
| 798 | Ga0495587_0003625 | 3300046536 | Bacteria | 10278 |
| 799 | Ga0495587_0005232 | 3300046536 | Bacteria | 8480 |
| 800 | Ga0495587_0218557 | 3300046536 | Unclassified | 1075 |
| 801 | Ga0495621_0083896 | 3300046539 | Bacteria | 1192 |
| 802 | Ga0495645_0014862 | 3300046543 | Bacteria | 5531 |
| 803 | Ga0495645_0045374 | 3300046543 | Unclassified | 3206 |
| 804 | Ga0495645_0081411 | 3300046543 | Unclassified | 2323 |
| 805 | Ga0495667_0000368 | 3300046559 | Bacteria | 28503 |
| 806 | Ga0495667_0047143 | 3300046559 | Bacteria | 2848 |
| 807 | Ga0495667_0076477 | 3300046559 | Bacteria | 2178 |
| 808 | Ga0495667_0077738 | 3300046559 | Bacteria | 2158 |
| 809 | Ga0495667_0088978 | 3300046559 | Unclassified | 2002 |
| 810 | Ga0495634_0018358 | 3300046642 | Unclassified | 4980 |
| 811 | Ga0495634_0023967 | 3300046642 | Bacteria | 4286 |
| 812 | Ga0495635_0106022 | 3300046663 | Unclassified | 1920 |
| 813 | Ga0495657_0001274 | 3300046675 | Bacteria | 21925 |
| 814 | Ga0495599_0004509 | 3300046678 | Bacteria | 8258 |
| 815 | Ga0495599_0041771 | 3300046678 | Bacteria | 2878 |
| 816 | Ga0495599_0139457 | 3300046678 | Bacteria | 1504 |
| 817 | Ga0495599_0159501 | 3300046678 | Unclassified | 1394 |
| 818 | Ga0495599_0309692 | 3300046678 | Bacteria | 952 |
| 819 | Ga0495623_0012210 | 3300046679 | Bacteria | 5564 |
| 820 | Ga0495623_0092010 | 3300046679 | Bacteria | 1860 |
| 821 | Ga0495646_0136845 | 3300046680 | Bacteria | 1373 |
| 822 | Ga0495647_0067409 | 3300046681 | Unclassified | 1425 |
| 823 | Ga0495658_0023170 | 3300046683 | Unclassified | 3293 |
| 824 | Ga0495658_0099577 | 3300046683 | Bacteria | 1733 |
| 825 | Ga0495658_0106612 | 3300046683 | Bacteria | 1680 |
| 826 | Ga0495658_0110324 | 3300046683 | Unclassified | 1653 |
| 827 | Ga0495658_0190406 | 3300046683 | Unclassified | 1275 |
| 828 | Ga0495613_0021781 | 3300046689 | Bacteria | 4776 |
| 829 | Ga0495613_0089609 | 3300046689 | Unclassified | 2228 |
| 830 | Ga0495613_0106500 | 3300046689 | Bacteria | 2023 |
| 831 | Ga0495613_0204975 | 3300046689 | Bacteria | 1389 |
| 832 | Ga0495624_0042107 | 3300046690 | Bacteria | 2919 |
| 833 | Ga0495624_0053882 | 3300046690 | Unclassified | 2538 |
| 834 | Ga0495581_0012629 | 3300047315 | Unclassified | 4894 |
| 835 | Ga0495604_0038986 | 3300047317 | Bacteria | 3736 |
| 836 | Ga0495604_0085304 | 3300047317 | Unclassified | 2357 |
| 837 | Ga0495604_0122261 | 3300047317 | Bacteria | 1883 |
| 838 | Ga0495604_0255057 | 3300047317 | Bacteria | 1194 |
| 839 | Ga0495674_0026515 | 3300047319 | Bacteria | 5302 |
| 840 | Ga0495674_0037329 | 3300047319 | Bacteria | 4366 |
| 841 | Ga0495674_0068931 | 3300047319 | Bacteria | 3060 |
| 842 | Ga0495674_0085545 | 3300047319 | Bacteria | 2701 |
| 843 | Ga0495674_0148569 | 3300047319 | Bacteria | 1966 |
| 844 | Ga0495674_0177844 | 3300047319 | Unclassified | 1773 |
| 845 | Ga0495674_0185824 | 3300047319 | Unclassified | 1729 |
| 846 | Ga0495676_0011431 | 3300047321 | Bacteria | 8015 |
| 847 | Ga0495680_0033478 | 3300047322 | Unclassified | 4160 |
| 848 | Ga0495680_0046323 | 3300047322 | Bacteria | 3429 |
| 849 | Ga0495675_0047069 | 3300047444 | Bacteria | 2745 |
| 850 | Ga0495675_0066796 | 3300047444 | Bacteria | 2273 |
| 851 | Ga0495675_0137472 | 3300047444 | Bacteria | 1516 |
| 852 | Ga0495684_0009445 | 3300047471 | Bacteria | 7530 |
| 853 | Ga0495684_0045885 | 3300047471 | Bacteria | 3343 |
| 854 | Ga0495684_0074333 | 3300047471 | Unclassified | 2582 |
| 855 | Ga0495684_0128593 | 3300047471 | Bacteria | 1904 |
| 856 | Ga0495684_0162297 | 3300047471 | Unclassified | 1666 |
| 857 | Ga0495684_0162324 | 3300047471 | Bacteria | 1666 |
| 858 | Ga0495684_0254545 | 3300047471 | Unclassified | 1276 |
| 859 | Ga0495593_0201586 | 3300047673 | Bacteria | 1000 |
| 860 | Ga0495602_0007373 | 3300048088 | Bacteria | 11517 |
| 861 | Ga0495602_0012714 | 3300048088 | Bacteria | 8634 |
| 862 | Ga0495602_0227204 | 3300048088 | Bacteria | 1405 |
| 863 | Ga0495614_0083508 | 3300048089 | Unclassified | 1385 |
| 864 | Ga0496102_0003262 | 3300048905 | Bacteria | 13749 |
| 865 | Ga0496104_0187071 | 3300048907 | Unclassified | 1982 |
| 866 | Ga0496104_0529846 | 3300048907 | Bacteria | 1089 |
| 867 | Ga0496104_0546347 | 3300048907 | Unclassified | 1069 |
| 868 | Ga0496105_0040092 | 3300048908 | Bacteria | 3861 |
| 869 | Ga0496105_0124838 | 3300048908 | Bacteria | 2122 |
| 870 | Ga0496106_0047796 | 3300048909 | Bacteria | 3221 |
| 871 | Ga0496106_0105172 | 3300048909 | Bacteria | 2193 |
| 872 | Ga0496112_0076683 | 3300048915 | Bacteria | 3306 |
| 873 | Ga0496112_0574865 | 3300048915 | Bacteria | 1060 |
| 874 | Ga0496114_0084575 | 3300048917 | Bacteria | 2686 |
| 875 | Ga0496115_0013162 | 3300048918 | Bacteria | 6249 |
| 876 | Ga0496115_0030708 | 3300048918 | Unclassified | 4229 |
| 877 | Ga0496115_0377678 | 3300048918 | Bacteria | 1153 |
| 878 | Ga0501034_0148196 | 3300049571 | Bacteria | 2323 |
| 879 | Ga0501040_0494889 | 3300049576 | Bacteria | 881 |
| 880 | Ga0501047_0585681 | 3300049581 | Unclassified | 938 |
| 881 | Ga0501257_030100 | 3300049686 | Unclassified | 1306 |
| 882 | Ga0501083_0155085 | 3300049744 | Unclassified | 1499 |
| 883 | nmdc:mga05p37_374426_c1 | 3300050507 | Bacteria | 1670 |
| 884 | nmdc:mga06r32_18770_c1 | 3300050510 | Bacteria | 6337 |
| 885 | nmdc:mga06r32_3006_c1 | 3300050510 | Bacteria | 15104 |
| 886 | nmdc:mga08y16_7533_c1 | 3300050511 | Bacteria | 11401 |
| 887 | nmdc:mga0n895_147823_c1 | 3300050512 | Bacteria | 2379 |
| 888 | nmdc:mga0n895_27628_c1 | 3300050512 | Bacteria | 5393 |
| 889 | nmdc:mga0n895_37419_c1 | 3300050512 | Bacteria | 4694 |
| 890 | nmdc:mga0rr50_144380_c1 | 3300050513 | Bacteria | 1917 |
| 891 | nmdc:mga0rr50_146360_c1 | 3300050513 | Bacteria | 1905 |
| 892 | nmdc:mga0rr50_69829_c1 | 3300050513 | Bacteria | 2675 |
| 893 | nmdc:mga0rr50_90421_c1 | 3300050513 | Bacteria | 2382 |
| 894 | nmdc:mga08x19_119315_c1 | 3300050514 | Bacteria | 1767 |
| 895 | nmdc:mga08x19_1487_c1 | 3300050514 | Bacteria | 14518 |
| 896 | nmdc:mga08x19_19216_c1 | 3300050514 | Bacteria | 4190 |
| 897 | nmdc:mga08x19_35195_c1 | 3300050514 | Unclassified | 3167 |
| 898 | nmdc:mga08x19_663_c1 | 3300050514 | Bacteria | 22179 |
| 899 | nmdc:mga0a205_391124_c1 | 3300050515 | Bacteria | 1255 |
| 900 | Ga0495612_0047102 | 3300053078 | Unclassified | 1766 |
| 901 | Ga0495619_0062666 | 3300053085 | Unclassified | 2476 |
| 902 | Ga0495619_0063711 | 3300053085 | Unclassified | 2456 |
| 903 | Ga0500568_0006476 | 3300053139 | Bacteria | 5871 |
| 904 | Ga0501082_0006860 | 3300060353 | Bacteria | 9847 |
| 905 | Ga0207664_10088568 | |||
| 906 | JGI25406J46586_10069973 | |||
| 907 | Ga0070658_10003050 | |||
| 908 | Ga0070658_10029220 | |||
| 909 | Ga0070658_10048826 | |||
| 910 | Ga0070658_10120924 | |||
| 911 | Ga0070683_100001900 | |||
| 912 | Ga0070683_100005281 | |||
| 913 | Ga0070683_100012237 | |||
| 914 | Ga0070683_100033124 | |||
| 915 | Ga0070683_100040772 | |||
| 916 | Ga0070683_100209025 | |||
| 917 | Ga0070683_100280494 | |||
| 918 | Ga0070683_100320182 | |||
| 919 | Ga0070683_100527857 | |||
| 920 | Ga0070690_100001594 | |||
| 921 | Ga0070690_100316418 | |||
| 922 | Ga0070690_100326648 | |||
| 923 | Ga0070670_100003201 | |||
| 924 | Ga0068869_100067653 | |||
| 925 | Ga0070666_10000915 | |||
| 926 | Ga0070666_10159491 | |||
| 927 | Ga0070666_10459372 | |||
| 928 | Ga0070680_100007816 | |||
| 929 | Ga0070680_100072604 | |||
| 930 | Ga0070680_100591952 | |||
| 931 | Ga0068868_100000678 | |||
| 932 | Ga0068868_100000918 | |||
| 933 | Ga0068868_100023755 | |||
| 934 | Ga0068868_100367139 | |||
| 935 | Ga0070660_100002216 | |||
| 936 | Ga0070660_100214212 | |||
| 937 | Ga0070660_100281139 | |||
| 938 | Ga0070689_100045498 | |||
| 939 | Ga0070689_100336794 | |||
| 940 | Ga0070691_10001699 | |||
| 941 | Ga0070691_10136885 | |||
| 942 | Ga0070661_100025330 | |||
| 943 | Ga0070661_100178415 | |||
| 944 | Ga0070669_100089861 | |||
| 945 | Ga0070669_100217661 | |||
| 946 | Ga0070669_100562400 | |||
| 947 | Ga0070675_100000136 | |||
| 948 | Ga0070675_100005130 | |||
| 949 | Ga0070675_100010267 | |||
| 950 | Ga0070671_100010333 | |||
| 951 | Ga0070671_100022081 | |||
| 952 | Ga0070671_100065451 | |||
| 953 | Ga0070673_100003742 | |||
| 954 | Ga0070673_100111787 | |||
| 955 | Ga0070673_100128215 | |||
| 956 | Ga0070673_100334700 | |||
| 957 | Ga0070688_100024993 | |||
| 958 | Ga0070688_100129899 | |||
| 959 | Ga0070667_100002038 | |||
| 960 | Ga0070667_100004312 | |||
| 961 | Ga0070667_100043529 | |||
| 962 | Ga0070667_100162796 | |||
| 963 | Ga0070667_100206419 | |||
| 964 | Ga0070667_100278990 | |||
| 965 | Ga0070709_10005850 | |||
| 966 | Ga0070709_10044371 | |||
| 967 | Ga0070709_10263242 | |||
| 968 | Ga0070709_10288878 | |||
| 969 | Ga0070714_100003182 | |||
| 970 | Ga0070714_100077867 | |||
| 971 | Ga0070714_100096505 | |||
| 972 | Ga0070714_100118114 | |||
| 973 | Ga0070713_100003816 | |||
| 974 | Ga0070713_100007840 | |||
| 975 | Ga0070713_100027097 | |||
| 976 | Ga0070713_100037077 | |||
| 977 | Ga0070713_100214376 | |||
| 978 | Ga0070710_10070219 | |||
| 979 | Ga0070711_100006359 | |||
| 980 | Ga0070711_100015355 | |||
| 981 | Ga0070711_100111553 | |||
| 982 | Ga0070711_100120314 | |||
| 983 | Ga0070711_100236266 | |||
| 984 | Ga0070711_100420821 | |||
| 985 | Ga0070705_100037525 | |||
| 986 | Ga0070705_100226318 | |||
| 987 | Ga0070708_100005443 | |||
| 988 | Ga0070708_100040585 | |||
| 989 | Ga0070708_100459283 | |||
| 990 | Ga0070708_100459551 | |||
| 991 | Ga0070708_100596055 | |||
| 992 | Ga0070681_10008586 | |||
| 993 | Ga0070681_10040925 | |||
| 994 | Ga0070681_10080937 | |||
| 995 | Ga0070681_10120786 | |||
| 996 | Ga0070681_10192630 | |||
| 997 | Ga0068867_100023290 | |||
| 998 | Ga0068867_100064139 | |||
| 999 | Ga0068867_100525537 | |||
| 1000 | Ga0070685_10012215 | |||
| 1001 | Ga0070706_100140330 | |||
| 1002 | Ga0070707_100040186 | |||
| 1003 | Ga0070707_100078931 | |||
| 1004 | Ga0070707_100098827 | |||
| 1005 | Ga0070707_100165732 | |||
| 1006 | Ga0070707_100267356 | |||
| 1007 | Ga0070698_100001738 | |||
| 1008 | Ga0070698_100010877 | |||
| 1009 | Ga0070698_100132531 | |||
| 1010 | Ga0070698_100212854 | |||
| 1011 | Ga0070699_100161923 | |||
| 1012 | Ga0070679_100007104 | |||
| 1013 | Ga0070679_100128201 | |||
| 1014 | Ga0070679_100144403 | |||
| 1015 | Ga0070684_100003837 | |||
| 1016 | Ga0070684_100017195 | |||
| 1017 | Ga0070684_100038530 | |||
| 1018 | Ga0070684_100058346 | |||
| 1019 | Ga0070684_100123815 | |||
| 1020 | Ga0070684_100256125 | |||
| 1021 | Ga0070697_100006562 | |||
| 1022 | Ga0070697_100090022 | |||
| 1023 | Ga0070697_100126299 | |||
| 1024 | Ga0070697_100199388 | |||
| 1025 | Ga0068853_100061903 | |||
| 1026 | Ga0068853_100111374 | |||
| 1027 | Ga0068853_100131621 | |||
| 1028 | Ga0068853_100292665 | |||
| 1029 | Ga0068853_100374256 | |||
| 1030 | Ga0070672_100001104 | |||
| 1031 | Ga0070672_100024447 | |||
| 1032 | Ga0070686_100006557 | |||
| 1033 | Ga0070695_100087998 | |||
| 1034 | Ga0070695_100195845 | |||
| 1035 | Ga0070696_100024300 | |||
| 1036 | Ga0070693_100044200 | |||
| 1037 | Ga0070693_100081730 | |||
| 1038 | Ga0070665_100000839 | |||
| 1039 | Ga0070665_100003393 | |||
| 1040 | Ga0070665_100548966 | |||
| 1041 | Ga0070704_100023975 | |||
| 1042 | Ga0070704_100127237 | |||
| 1043 | Ga0068855_100009996 | |||
| 1044 | Ga0068855_100016105 | |||
| 1045 | Ga0068855_100042695 | |||
| 1046 | Ga0068855_100043272 | |||
| 1047 | Ga0068855_100060778 | |||
| 1048 | Ga0068855_100075243 | |||
| 1049 | Ga0068855_100077384 | |||
| 1050 | Ga0068855_100115083 | |||
| 1051 | Ga0068855_100166985 | |||
| 1052 | Ga0068855_100188660 | |||
| 1053 | Ga0068855_100270220 | |||
| 1054 | Ga0068855_100308247 | |||
| 1055 | Ga0070664_100000435 | |||
| 1056 | Ga0070664_100068245 | |||
| 1057 | Ga0070664_100108181 | |||
| 1058 | Ga0068857_100003127 | |||
| 1059 | Ga0068857_100004683 | |||
| 1060 | Ga0068857_100013247 | |||
| 1061 | Ga0068857_100066059 | |||
| 1062 | Ga0068857_100101643 | |||
| 1063 | Ga0068856_100005417 | |||
| 1064 | Ga0068856_100006391 | |||
| 1065 | Ga0068856_100022247 | |||
| 1066 | Ga0068856_100038311 | |||
| 1067 | Ga0068856_100213484 | |||
| 1068 | Ga0068856_100257647 | |||
| 1069 | Ga0068856_100401928 | |||
| 1070 | Ga0068856_100545787 | |||
| 1071 | Ga0068852_100008659 | |||
| 1072 | Ga0068852_100054840 | |||
| 1073 | Ga0068852_100307294 | |||
| 1074 | Ga0068852_100308263 | |||
| 1075 | Ga0068852_100700028 | |||
| 1076 | Ga0068859_100010309 | |||
| 1077 | Ga0068859_100014970 | |||
| 1078 | Ga0068859_100016748 | |||
| 1079 | Ga0068859_100059735 | |||
| 1080 | Ga0068859_100122466 | |||
| 1081 | Ga0068859_100221728 | |||
| 1082 | Ga0068859_100436808 | |||
| 1083 | Ga0068859_100485268 | |||
| 1084 | Ga0068859_100492600 | |||
| 1085 | Ga0068864_100002738 | |||
| 1086 | Ga0068864_100121155 | |||
| 1087 | Ga0068864_100239779 | |||
| 1088 | Ga0068864_100346455 | |||
| 1089 | Ga0068864_100518064 | |||
| 1090 | Ga0068866_10047099 | |||
| 1091 | Ga0068866_10153868 | |||
| 1092 | Ga0068866_10180640 | |||
| 1093 | Ga0068851_10133357 | |||
| 1094 | Ga0068863_100000371 | |||
| 1095 | Ga0068863_100011700 | |||
| 1096 | Ga0068863_100032534 | |||
| 1097 | Ga0068863_100036635 | |||
| 1098 | Ga0068863_100049424 | |||
| 1099 | Ga0068863_100140633 | |||
| 1100 | Ga0068863_100297572 | |||
| 1101 | Ga0068858_100004331 | |||
| 1102 | Ga0068858_100009236 | |||
| 1103 | Ga0068858_100105815 | |||
| 1104 | Ga0068858_100259705 | |||
| 1105 | Ga0068858_100554097 | |||
| 1106 | Ga0068858_100628191 | |||
| 1107 | Ga0068860_100008522 | |||
| 1108 | Ga0068860_100022257 | |||
| 1109 | Ga0068860_100061320 | |||
| 1110 | Ga0068860_100158438 | |||
| 1111 | Ga0068860_100385957 | |||
| 1112 | Ga0068862_100199131 | |||
| 1113 | Ga0068862_100332919 | |||
| 1114 | Ga0081539_10026678 | |||
| 1115 | Ga0070717_10004753 | |||
| 1116 | Ga0070717_10007547 | |||
| 1117 | Ga0070717_10129844 | |||
| 1118 | Ga0070715_10003552 | |||
| 1119 | Ga0070716_100000265 | |||
| 1120 | Ga0070716_100000367 | |||
| 1121 | Ga0070716_100048689 | |||
| 1122 | Ga0070716_100121293 | |||
| 1123 | Ga0070716_100239244 | |||
| 1124 | Ga0070712_100037784 | |||
| 1125 | Ga0070712_100051290 | |||
| 1126 | Ga0070712_100406002 | |||
| 1127 | Ga0097621_100001949 | |||
| 1128 | Ga0097621_100010152 | |||
| 1129 | Ga0097621_100021916 | |||
| 1130 | Ga0097621_100042437 | |||
| 1131 | Ga0097621_100045920 | |||
| 1132 | Ga0097621_100052611 | |||
| 1133 | Ga0097621_100415995 | |||
| 1134 | Ga0097621_100452750 | |||
| 1135 | Ga0068871_100004288 | |||
| 1136 | Ga0068871_100020760 | |||
| 1137 | Ga0068871_100048660 | |||
| 1138 | Ga0068871_100051754 | |||
| 1139 | Ga0068871_100068954 | |||
| 1140 | Ga0068871_100085100 | |||
| 1141 | Ga0068871_100094118 | |||
| 1142 | Ga0068871_100327388 | |||
| 1143 | Ga0075434_100010829 | |||
| 1144 | Ga0075434_100137532 | |||
| 1145 | Ga0075434_100208930 | |||
| 1146 | Ga0075429_100609158 | |||
| 1147 | Ga0068865_100017604 | |||
| 1148 | Ga0068865_100094284 | |||
| 1149 | Ga0075436_100004213 | |||
| 1150 | Ga0075436_100005914 | |||
| 1151 | Ga0075436_100049030 | |||
| 1152 | Ga0075436_100142989 | |||
| 1153 | Ga0097620_100010309 | |||
| 1154 | Ga0097620_100014970 | |||
| 1155 | Ga0097620_100016748 | |||
| 1156 | Ga0097620_100059735 | |||
| 1157 | Ga0097620_100122465 | |||
| 1158 | Ga0097620_100221731 | |||
| 1159 | Ga0097620_100268398 | |||
| 1160 | Ga0097620_100436783 | |||
| 1161 | Ga0097620_100485215 | |||
| 1162 | Ga0097620_100492620 | |||
| 1163 | Ga0075435_100038984 | |||
| 1164 | Ga0075435_100159534 | |||
| 1165 | Ga0075435_100204167 | |||
| 1166 | Ga0099794_10000457 | |||
| 1167 | Ga0099794_10002706 | |||
| 1168 | Ga0099794_10044655 | |||
| 1169 | Ga0099794_10063912 | |||
| 1170 | Ga0099794_10067411 | |||
| 1171 | Ga0099794_10071693 | |||
| 1172 | Ga0099794_10093001 | |||
| 1173 | Ga0099794_10118618 | |||
| 1174 | Ga0099794_10185489 | |||
| 1175 | Ga0099795_10013309 | |||
| 1176 | Ga0105240_10000391 | |||
| 1177 | Ga0105240_10002259 | |||
| 1178 | Ga0105240_10007071 | |||
| 1179 | Ga0105240_10007752 | |||
| 1180 | Ga0105240_10008797 | |||
| 1181 | Ga0105240_10016627 | |||
| 1182 | Ga0105240_10018958 | |||
| 1183 | Ga0105240_10056639 | |||
| 1184 | Ga0105240_10065955 | |||
| 1185 | Ga0105240_10083006 | |||
| 1186 | Ga0105240_10144177 | |||
| 1187 | Ga0105240_10481624 | |||
| 1188 | Ga0105240_10495450 | |||
| 1189 | Ga0105240_10520214 | |||
| 1190 | Ga0105240_10833538 | |||
| 1191 | Ga0111539_10006672 | |||
| 1192 | Ga0111539_10042929 | |||
| 1193 | Ga0105245_10000579 | |||
| 1194 | Ga0105245_10000827 | |||
| 1195 | Ga0105245_10015898 | |||
| 1196 | Ga0105245_10020675 | |||
| 1197 | Ga0105245_10050526 | |||
| 1198 | Ga0105245_10077615 | |||
| 1199 | Ga0105245_10078163 | |||
| 1200 | Ga0105245_10101701 | |||
| 1201 | Ga0105245_10113057 | |||
| 1202 | Ga0105245_10263507 | |||
| 1203 | Ga0105245_10310416 | |||
| 1204 | Ga0114129_10072289 | |||
| 1205 | Ga0105243_10298865 | |||
| 1206 | Ga0105243_10342699 | |||
| 1207 | Ga0105241_10000998 | |||
| 1208 | Ga0105241_10015222 | |||
| 1209 | Ga0105241_10024716 | |||
| 1210 | Ga0105241_10054503 | |||
| 1211 | Ga0105241_10131533 | |||
| 1212 | Ga0105241_10326397 | |||
| 1213 | Ga0105241_10365037 | |||
| 1214 | Ga0105241_10492157 | |||
| 1215 | Ga0105242_10019003 | |||
| 1216 | Ga0105242_10025918 | |||
| 1217 | Ga0105242_10027397 | |||
| 1218 | Ga0105242_10044638 | |||
| 1219 | Ga0105242_10082704 | |||
| 1220 | Ga0105242_10243051 | |||
| 1221 | Ga0105248_10000556 | |||
| 1222 | Ga0105248_10002632 | |||
| 1223 | Ga0105248_10004875 | |||
| 1224 | Ga0105248_10007047 | |||
| 1225 | Ga0105248_10012800 | |||
| 1226 | Ga0105248_10040749 | |||
| 1227 | Ga0105248_10143142 | |||
| 1228 | Ga0105248_10146199 | |||
| 1229 | Ga0105248_10298063 | |||
| 1230 | Ga0105248_10351924 | |||
| 1231 | Ga0105248_10377190 | |||
| 1232 | Ga0105248_10399245 | |||
| 1233 | Ga0105237_10001090 | |||
| 1234 | Ga0105237_10001318 | |||
| 1235 | Ga0105237_10001791 | |||
| 1236 | Ga0105237_10008309 | |||
| 1237 | Ga0105237_10016782 | |||
| 1238 | Ga0105237_10057211 | |||
| 1239 | Ga0105237_10084974 | |||
| 1240 | Ga0105237_10101674 | |||
| 1241 | Ga0105238_10003080 | |||
| 1242 | Ga0105238_10011625 | |||
| 1243 | Ga0105238_10012285 | |||
| 1244 | Ga0105238_10013612 | |||
| 1245 | Ga0105238_10035869 | |||
| 1246 | Ga0105238_10037255 | |||
| 1247 | Ga0105238_10075773 | |||
| 1248 | Ga0105238_10114224 | |||
| 1249 | Ga0105238_10500286 | |||
| 1250 | Ga0105249_10077028 | |||
| 1251 | Ga0105249_10090127 | |||
| 1252 | Ga0105249_10122325 | |||
| 1253 | Ga0099796_10004924 | |||
| 1254 | Ga0105239_10002592 | |||
| 1255 | Ga0105239_10009694 | |||
| 1256 | Ga0105239_10010882 | |||
| 1257 | Ga0105239_10017658 | |||
| 1258 | Ga0105239_10026819 | |||
| 1259 | Ga0105239_10037748 | |||
| 1260 | Ga0105239_10048082 | |||
| 1261 | Ga0105239_10399189 | |||
| 1262 | Ga0105239_10400132 | |||
| 1263 | Ga0105246_10031235 | |||
| 1264 | Ga0105246_10110539 | |||
| 1265 | Ga0157371_10097378 | |||
| 1266 | Ga0157370_10012939 | |||
| 1267 | Ga0157370_10019301 | |||
| 1268 | Ga0157370_10127944 | |||
| 1269 | Ga0157370_10175980 | |||
| 1270 | Ga0157370_10181600 | |||
| 1271 | Ga0157370_10184516 | |||
| 1272 | Ga0157369_10001514 | |||
| 1273 | Ga0157369_10007349 | |||
| 1274 | Ga0157369_10051325 | |||
| 1275 | Ga0157369_10057221 | |||
| 1276 | Ga0157369_10103491 | |||
| 1277 | Ga0157369_10147214 | |||
| 1278 | Ga0157369_10193209 | |||
| 1279 | Ga0157369_10343598 | |||
| 1280 | Ga0157369_10846882 | |||
| 1281 | Ga0157374_10022622 | |||
| 1282 | Ga0157374_10046263 | |||
| 1283 | Ga0157374_10132699 | |||
| 1284 | Ga0157374_10171035 | |||
| 1285 | Ga0157374_10340963 | |||
| 1286 | Ga0157374_10397119 | |||
| 1287 | Ga0157374_10416395 | |||
| 1288 | Ga0157378_10000066 | |||
| 1289 | Ga0157378_10003953 | |||
| 1290 | Ga0157378_10023380 | |||
| 1291 | Ga0157378_10031313 | |||
| 1292 | Ga0157378_10051095 | |||
| 1293 | Ga0157378_10085046 | |||
| 1294 | Ga0157378_10154947 | |||
| 1295 | Ga0157378_10362445 | |||
| 1296 | Ga0157378_10684849 | |||
| 1297 | Ga0163162_10000945 | |||
| 1298 | Ga0163162_10024661 | |||
| 1299 | Ga0163162_10040484 | |||
| 1300 | Ga0163162_10121564 | |||
| 1301 | Ga0163162_10126467 | |||
| 1302 | Ga0163162_10180498 | |||
| 1303 | Ga0163162_10263824 | |||
| 1304 | Ga0163162_10322815 | |||
| 1305 | Ga0157372_10004812 | |||
| 1306 | Ga0157372_10013185 | |||
| 1307 | Ga0157372_10027675 | |||
| 1308 | Ga0157372_10085024 | |||
| 1309 | Ga0157372_10211925 | |||
| 1310 | Ga0157372_10409767 | |||
| 1311 | Ga0157372_10575215 | |||
| 1312 | Ga0157375_10000096 | |||
| 1313 | Ga0157375_10005989 | |||
| 1314 | Ga0157375_10043968 | |||
| 1315 | Ga0157375_10060652 | |||
| 1316 | Ga0157375_10126450 | |||
| 1317 | Ga0157375_10776789 | |||
| 1318 | Ga0163163_10001971 | |||
| 1319 | Ga0163163_10002245 | |||
| 1320 | Ga0163163_10003104 | |||
| 1321 | Ga0163163_10008926 | |||
| 1322 | Ga0163163_10013616 | |||
| 1323 | Ga0163163_10016721 | |||
| 1324 | Ga0163163_10037643 | |||
| 1325 | Ga0163163_10048272 | |||
| 1326 | Ga0163163_10061598 | |||
| 1327 | Ga0163163_10067233 | |||
| 1328 | Ga0163163_10170348 | |||
| 1329 | Ga0163163_10282896 | |||
| 1330 | Ga0163163_10306625 | |||
| 1331 | Ga0157380_10134921 | |||
| 1332 | Ga0157379_10000048 | |||
| 1333 | Ga0157379_10006936 | |||
| 1334 | Ga0157379_10007071 | |||
| 1335 | Ga0157379_10106546 | |||
| 1336 | Ga0157376_10000014 | |||
| 1337 | Ga0157376_10000158 | |||
| 1338 | Ga0157376_10020791 | |||
| 1339 | Ga0157376_10093372 | |||
| 1340 | Ga0157376_10213167 | |||
| 1341 | Ga0157376_10234762 | |||
| 1342 | Ga0157376_10481650 | |||
| 1343 | Ga0213876_10091042 | |||
| 1344 | Ga0213875_10084777 | |||
| 1345 | Ga0207692_10057659 | |||
| 1346 | Ga0207710_10077993 | |||
| 1347 | Ga0207680_10012636 | |||
| 1348 | Ga0207680_10058232 | |||
| 1349 | Ga0207680_10141994 | |||
| 1350 | Ga0207685_10052725 | |||
| 1351 | Ga0207699_10053510 | |||
| 1352 | Ga0207699_10066192 | |||
| 1353 | Ga0207699_10202857 | |||
| 1354 | Ga0207705_10072274 | |||
| 1355 | Ga0207705_10099713 | |||
| 1356 | Ga0207684_10026650 | |||
| 1357 | Ga0207684_10237641 | |||
| 1358 | Ga0207654_10002783 | |||
| 1359 | Ga0207654_10011639 | |||
| 1360 | Ga0207654_10033945 | |||
| 1361 | Ga0207654_10047482 | |||
| 1362 | Ga0207654_10109254 | |||
| 1363 | Ga0207654_10416068 | |||
| 1364 | Ga0207707_10002258 | |||
| 1365 | Ga0207707_10007218 | |||
| 1366 | Ga0207707_10013893 | |||
| 1367 | Ga0207707_10019841 | |||
| 1368 | Ga0207707_10065483 | |||
| 1369 | Ga0207707_10228373 | |||
| 1370 | Ga0207695_10000470 | |||
| 1371 | Ga0207695_10002146 | |||
| 1372 | Ga0207695_10002387 | |||
| 1373 | Ga0207695_10006140 | |||
| 1374 | Ga0207695_10012000 | |||
| 1375 | Ga0207695_10012068 | |||
| 1376 | Ga0207695_10021525 | |||
| 1377 | Ga0207695_10043389 | |||
| 1378 | Ga0207695_10058904 | |||
| 1379 | Ga0207695_10077372 | |||
| 1380 | Ga0207695_10119822 | |||
| 1381 | Ga0207671_10018063 | |||
| 1382 | Ga0207671_10021284 | |||
| 1383 | Ga0207671_10024949 | |||
| 1384 | Ga0207671_10038256 | |||
| 1385 | Ga0207671_10198521 | |||
| 1386 | Ga0207693_10035670 | |||
| 1387 | Ga0207693_10122096 | |||
| 1388 | Ga0207693_10325986 | |||
| 1389 | Ga0207663_10012104 | |||
| 1390 | Ga0207663_10044414 | |||
| 1391 | Ga0207663_10176876 | |||
| 1392 | Ga0207660_10022362 | |||
| 1393 | Ga0207662_10119047 | |||
| 1394 | Ga0207657_10272435 | |||
| 1395 | Ga0207657_10380593 | |||
| 1396 | Ga0207649_10091158 | |||
| 1397 | Ga0207649_10097054 | |||
| 1398 | Ga0207652_10041528 | |||
| 1399 | Ga0207652_10067295 | |||
| 1400 | Ga0207646_10001594 | |||
| 1401 | Ga0207646_10040355 | |||
| 1402 | Ga0207646_10067849 | |||
| 1403 | Ga0207646_10251741 | |||
| 1404 | Ga0207681_10110697 | |||
| 1405 | Ga0207681_10180794 | |||
| 1406 | Ga0207681_10452508 | |||
| 1407 | Ga0207681_10486065 | |||
| 1408 | Ga0207694_10000818 | |||
| 1409 | Ga0207694_10010381 | |||
| 1410 | Ga0207694_10016689 | |||
| 1411 | Ga0207694_10018272 | |||
| 1412 | Ga0207694_10023498 | |||
| 1413 | Ga0207694_10031937 | |||
| 1414 | Ga0207694_10114030 | |||
| 1415 | Ga0207694_10147884 | |||
| 1416 | Ga0207694_10193928 | |||
| 1417 | Ga0207650_10000527 | |||
| 1418 | Ga0207650_10277832 | |||
| 1419 | Ga0207659_10001273 | |||
| 1420 | Ga0207659_10001861 | |||
| 1421 | Ga0207659_10097328 | |||
| 1422 | Ga0207687_10021179 | |||
| 1423 | Ga0207687_10042910 | |||
| 1424 | Ga0207687_10164740 | |||
| 1425 | Ga0207687_10204769 | |||
| 1426 | Ga0207687_10309016 | |||
| 1427 | Ga0207687_10358537 | |||
| 1428 | Ga0207700_10005188 | |||
| 1429 | Ga0207700_10008715 | |||
| 1430 | Ga0207700_10024811 | |||
| 1431 | Ga0207700_10032163 | |||
| 1432 | Ga0207700_10138221 | |||
| 1433 | Ga0207700_10211967 | |||
| 1434 | Ga0207700_10297711 | |||
| 1435 | Ga0207700_10373911 | |||
| 1436 | Ga0207700_10558054 | |||
| 1437 | Ga0207664_10234828 | |||
| 1438 | Ga0207644_10020256 | |||
| 1439 | Ga0207644_10032200 | |||
| 1440 | Ga0207644_10089511 | |||
| 1441 | Ga0207644_10106157 | |||
| 1442 | Ga0207706_10034377 | |||
| 1443 | Ga0207686_10041865 | |||
| 1444 | Ga0207686_10059551 | |||
| 1445 | Ga0207686_10067097 | |||
| 1446 | Ga0207686_10095796 | |||
| 1447 | Ga0207686_10200939 | |||
| 1448 | Ga0207686_10242090 | |||
| 1449 | Ga0207709_10022981 | |||
| 1450 | Ga0207670_10030524 | |||
| 1451 | Ga0207670_10266409 | |||
| 1452 | Ga0207669_10220203 | |||
| 1453 | Ga0207704_10018391 | |||
| 1454 | Ga0207704_10021044 | |||
| 1455 | Ga0207704_10025185 | |||
| 1456 | Ga0207704_10120861 | |||
| 1457 | Ga0207665_10000028 | |||
| 1458 | Ga0207665_10015114 | |||
| 1459 | Ga0207665_10020973 | |||
| 1460 | Ga0207665_10030036 | |||
| 1461 | Ga0207665_10192407 | |||
| 1462 | Ga0207691_10006640 | |||
| 1463 | Ga0207691_10121715 | |||
| 1464 | Ga0207711_10000640 | |||
| 1465 | Ga0207711_10010200 | |||
| 1466 | Ga0207711_10010568 | |||
| 1467 | Ga0207711_10020435 | |||
| 1468 | Ga0207711_10220136 | |||
| 1469 | Ga0207711_10663189 | |||
| 1470 | Ga0207689_10068443 | |||
| 1471 | Ga0207689_10108730 | |||
| 1472 | Ga0207689_10178926 | |||
| 1473 | Ga0207689_10344472 | |||
| 1474 | Ga0207661_10001072 | |||
| 1475 | Ga0207661_10015296 | |||
| 1476 | Ga0207661_10046854 | |||
| 1477 | Ga0207661_10122177 | |||
| 1478 | Ga0207661_10422096 | |||
| 1479 | Ga0207661_10455226 | |||
| 1480 | Ga0207679_10005576 | |||
| 1481 | Ga0207679_10007986 | |||
| 1482 | Ga0207679_10380711 | |||
| 1483 | Ga0207667_10000145 | |||
| 1484 | Ga0207667_10000290 | |||
| 1485 | Ga0207667_10008202 | |||
| 1486 | Ga0207667_10021667 | |||
| 1487 | Ga0207667_10034554 | |||
| 1488 | Ga0207651_10007860 | |||
| 1489 | Ga0207651_10143861 | |||
| 1490 | Ga0207712_10131010 | |||
| 1491 | Ga0207640_10172792 | |||
| 1492 | Ga0207658_10003089 | |||
| 1493 | Ga0207658_10004420 | |||
| 1494 | Ga0207658_10262863 | |||
| 1495 | Ga0207658_10471920 | |||
| 1496 | Ga0207677_10001702 | |||
| 1497 | Ga0207677_10002443 | |||
| 1498 | Ga0207677_10022485 | |||
| 1499 | Ga0207677_10412031 | |||
| 1500 | Ga0207703_10006989 | |||
| 1501 | Ga0207703_10026365 | |||
| 1502 | Ga0207703_10180316 | |||
| 1503 | Ga0207703_10212012 | |||
| 1504 | Ga0207703_10225491 | |||
| 1505 | Ga0207703_10328813 | |||
| 1506 | Ga0207639_10025075 | |||
| 1507 | Ga0207639_10237817 | |||
| 1508 | Ga0207639_10323109 | |||
| 1509 | Ga0207678_10312558 | |||
| 1510 | Ga0207702_10051271 | |||
| 1511 | Ga0207702_10057386 | |||
| 1512 | Ga0207702_10060374 | |||
| 1513 | Ga0207702_10180028 | |||
| 1514 | Ga0207702_10687161 | |||
| 1515 | Ga0207641_10004072 | |||
| 1516 | Ga0207641_10012039 | |||
| 1517 | Ga0207641_10026890 | |||
| 1518 | Ga0207641_10154996 | |||
| 1519 | Ga0207641_10214189 | |||
| 1520 | Ga0207641_10257294 | |||
| 1521 | Ga0207648_10014775 | |||
| 1522 | Ga0207648_10082637 | |||
| 1523 | Ga0207648_10242005 | |||
| 1524 | Ga0207676_10003103 | |||
| 1525 | Ga0207676_10281555 | |||
| 1526 | Ga0207674_10000264 | |||
| 1527 | Ga0207674_10001670 | |||
| 1528 | Ga0207674_10003178 | |||
| 1529 | Ga0207674_10011784 | |||
| 1530 | Ga0207674_10047969 | |||
| 1531 | Ga0207674_10391832 | |||
| 1532 | Ga0207698_10001006 | |||
| 1533 | Ga0207698_10036501 | |||
| 1534 | Ga0207698_10108410 | |||
| 1535 | Ga0207698_10116086 | |||
| 1536 | Ga0209179_1020983 | |||
| 1537 | Ga0209588_1016671 | |||
| 1538 | Ga0209588_1018828 | |||
| 1539 | Ga0209588_1033512 | |||
| 1540 | Ga0209588_1037250 | |||
| 1541 | Ga0209588_1059399 | |||
| 1542 | Ga0207428_10046337 | |||
| 1543 | Ga0268266_10000072 | |||
| 1544 | Ga0268266_10007146 | |||
| 1545 | Ga0268266_10051727 | |||
| 1546 | Ga0268266_10414093 | |||
| 1547 | Ga0268265_10342313 | |||
| 1548 | Ga0268264_10005574 | |||
| 1549 | Ga0268264_10008566 | |||
| 1550 | Ga0268264_10014228 | |||
| 1551 | Ga0268264_10103298 | |||
| 1552 | Ga0268264_10310788 | |||
| 1553 | Ga0265323_10001824 | |||
| 1554 | Ga0265336_10011577 | |||
| 1555 | Ga0265338_10057022 | |||
| 1556 | Ga0265324_10007051 | |||
| 1557 | Ga0265330_10049959 | |||
| 1558 | Ga0265330_10090028 | |||
| 1559 | Ga0265320_10000164 | |||
| 1560 | Ga0265325_10034314 | |||
| 1561 | Ga0265325_10039185 | |||
| 1562 | Ga0265325_10067762 | |||
| 1563 | Ga0265325_10120453 | |||
| 1564 | Ga0265329_10014906 | |||
| 1565 | Ga0265331_10000594 | |||
| 1566 | Ga0265316_10001101 | |||
| 1567 | Ga0265316_10001923 | |||
| 1568 | Ga0265316_10003154 | |||
| 1569 | Ga0265316_10055804 | |||
| 1570 | Ga0265316_10105686 | |||
| 1571 | Ga0265316_10178127 | |||
| 1572 | Ga0265316_10196801 | |||
| 1573 | Ga0265316_10215617 | |||
| 1574 | Ga0265316_10296281 | |||
| 1575 | Ga0265313_10003281 | |||
| 1576 | Ga0265314_10001266 | |||
| 1577 | Ga0265314_10005327 | |||
| 1578 | Ga0265314_10008616 | |||
| 1579 | Ga0265314_10018082 | |||
| 1580 | Ga0265314_10111170 | |||
| 1581 | Ga0265342_10021316 | |||
| 1582 | Ga0265342_10266066 | |||
| 1583 | Ga0307510_10074621 | |||
| 1584 | Ga0373934_0003027 | |||
| 1585 | Ga0373940_0006103 | |||
| 1586 | Ga0373923_0055010 | |||
| 1587 | Ga0373936_0064057 | |||
| 1588 | Ga0373953_0001899 | |||
| 1589 | Ga0373953_0053522 | |||
| 1590 | Ga0373954_0001617 | |||
| 1591 | Ga0373954_0017771 | |||
| 1592 | Ga0373954_0033868 | |||
| 1593 | Ga0373954_0108445 | |||
| 1594 | Ga0373956_0003458 | |||
| 1595 | Ga0373957_0003790 | |||
| 1596 | Ga0373943_0198130 | |||
| 1597 | Ga0373943_0198713 | |||
| 1598 | Ga0373946_0054921 | |||
| 1599 | Ga0373955_0001915 | |||
| 1600 | Ga0373955_0023421 | |||
| 1601 | Ga0373955_0032074 | |||
| 1602 | Ga0373955_0187404 | |||
| 1603 | Ga0373955_0315839 | |||
| 1604 | Ga0373935_0010194 | |||
| 1605 | Ga0373935_0036583 | |||
| 1606 | Ga0373935_0229795 | |||
| 1607 | Ga0373927_0000114 | |||
| 1608 | Ga0373927_0000738 | |||
| 1609 | Ga0373927_0001078 | |||
| 1610 | Ga0373927_0001327 | |||
| 1611 | Ga0373927_0022705 | |||
| 1612 | Ga0373927_0201438 | |||
| 1613 | Ga0373933_0000693 | |||
| 1614 | Ga0373933_0037183 | |||
| 1615 | Ga0373933_0086429 | |||
| 1616 | Ga0373933_0088564 | |||
| 1617 | Ga0373947_0000597 | |||
| 1618 | Ga0373947_0005282 | |||
| 1619 | Ga0373947_0037007 | |||
| 1620 | Ga0373947_0048104 | |||
| 1621 | Ga0373937_0001689 | |||
| 1622 | Ga0373937_0007146 | |||
| 1623 | Ga0373937_0007683 | |||
| 1624 | Ga0373937_0009122 | |||
| 1625 | Ga0373937_0013688 | |||
| 1626 | Ga0373937_0025287 | |||
| 1627 | Ga0373937_0041183 | |||
| 1628 | Ga0373937_0096441 | |||
| 1629 | Ga0373937_0143143 | |||
| 1630 | Ga0373937_0144769 | |||
| 1631 | Ga0373937_0147451 | |||
| 1632 | Ga0373937_0218258 | |||
| 1633 | Ga0373937_0318404 | |||
| 1634 | Ga0373937_0460545 | |||
| 1635 | Ga0373937_0731828 | |||
| 1636 | Ga0373925_0000115 | |||
| 1637 | Ga0373925_0000147 | |||
| 1638 | Ga0373925_0006711 | |||
| 1639 | Ga0373925_0077416 | |||
| 1640 | Ga0373925_0080532 | |||
| 1641 | Ga0373925_0096980 | |||
| 1642 | Ga0373925_0272399 | |||
| 1643 | Ga0395900_0656826 | |||
| 1644 | Ga0436364_0781733 | |||
| 1645 | Ga0436365_0256021 | |||
| 1646 | Ga0436365_0645428 | |||
| 1647 | Ga0436362_0543372 | |||
| 1648 | Ga0451577_0102207 | |||
| 1649 | Ga0451576_0115075 | |||
| 1650 | Ga0451576_0350086 | |||
| 1651 | Ga0466958_0065425 | |||
| 1652 | Ga0495592_0036311 | |||
| 1653 | Ga0495592_0046124 | |||
| 1654 | Ga0495592_0046439 | |||
| 1655 | Ga0495592_0088576 | |||
| 1656 | Ga0495603_0008797 | |||
| 1657 | Ga0495603_0112687 | |||
| 1658 | Ga0495629_0090256 | |||
| 1659 | Ga0495641_0031442 | |||
| 1660 | Ga0495651_0023207 | |||
| 1661 | Ga0495651_0213737 | |||
| 1662 | Ga0495653_0074786 | |||
| 1663 | Ga0495580_0000388 | |||
| 1664 | Ga0495580_0000800 | |||
| 1665 | Ga0495580_0007663 | |||
| 1666 | Ga0495580_0014363 | |||
| 1667 | Ga0495580_0040911 | |||
| 1668 | Ga0495580_0051285 | |||
| 1669 | Ga0495580_0065664 | |||
| 1670 | Ga0495580_0071375 | |||
| 1671 | Ga0495580_0211411 | |||
| 1672 | Ga0495580_0309047 | |||
| 1673 | Ga0495582_0004522 | |||
| 1674 | Ga0495582_0008694 | |||
| 1675 | Ga0495582_0014003 | |||
| 1676 | Ga0495582_0274907 | |||
| 1677 | Ga0495639_0124156 | |||
| 1678 | Ga0495662_0008262 | |||
| 1679 | Ga0495662_0029319 | |||
| 1680 | Ga0495664_0004398 | |||
| 1681 | Ga0495664_0287333 | |||
| 1682 | Ga0495594_0097089 | |||
| 1683 | Ga0495594_0156496 | |||
| 1684 | Ga0495618_0211646 | |||
| 1685 | Ga0495628_0025093 | |||
| 1686 | Ga0495628_0083859 | |||
| 1687 | Ga0495628_0232337 | |||
| 1688 | Ga0495628_0446418 | |||
| 1689 | Ga0495630_0004578 | |||
| 1690 | Ga0495630_0058431 | |||
| 1691 | Ga0495666_0146648 | |||
| 1692 | Ga0495666_0148253 | |||
| 1693 | Ga0495666_0155470 | |||
| 1694 | Ga0495652_0212158 | |||
| 1695 | Ga0495652_0290741 | |||
| 1696 | Ga0495652_0297309 | |||
| 1697 | Ga0495665_0030972 | |||
| 1698 | Ga0495665_0047456 | |||
| 1699 | Ga0495665_0173972 | |||
| 1700 | Ga0495640_0025931 | |||
| 1701 | Ga0495587_0000640 | |||
| 1702 | Ga0495587_0003625 | |||
| 1703 | Ga0495587_0005232 | |||
| 1704 | Ga0495587_0218557 | |||
| 1705 | Ga0495621_0083896 | |||
| 1706 | Ga0495645_0014862 | |||
| 1707 | Ga0495645_0045374 | |||
| 1708 | Ga0495645_0081411 | |||
| 1709 | Ga0495667_0000368 | |||
| 1710 | Ga0495667_0047143 | |||
| 1711 | Ga0495667_0076477 | |||
| 1712 | Ga0495667_0077738 | |||
| 1713 | Ga0495667_0088978 | |||
| 1714 | Ga0495634_0018358 | |||
| 1715 | Ga0495634_0023967 | |||
| 1716 | Ga0495635_0106022 | |||
| 1717 | Ga0495657_0001274 | |||
| 1718 | Ga0495599_0004509 | |||
| 1719 | Ga0495599_0041771 | |||
| 1720 | Ga0495599_0139457 | |||
| 1721 | Ga0495599_0159501 | |||
| 1722 | Ga0495599_0309692 | |||
| 1723 | Ga0495623_0012210 | |||
| 1724 | Ga0495623_0092010 | |||
| 1725 | Ga0495646_0136845 | |||
| 1726 | Ga0495647_0067409 | |||
| 1727 | Ga0495658_0023170 | |||
| 1728 | Ga0495658_0099577 | |||
| 1729 | Ga0495658_0106612 | |||
| 1730 | Ga0495658_0110324 | |||
| 1731 | Ga0495658_0190406 | |||
| 1732 | Ga0495613_0021781 | |||
| 1733 | Ga0495613_0089609 | |||
| 1734 | Ga0495613_0106500 | |||
| 1735 | Ga0495613_0204975 | |||
| 1736 | Ga0495624_0042107 | |||
| 1737 | Ga0495624_0053882 | |||
| 1738 | Ga0495581_0012629 | |||
| 1739 | Ga0495604_0038986 | |||
| 1740 | Ga0495604_0085304 | |||
| 1741 | Ga0495604_0122261 | |||
| 1742 | Ga0495604_0255057 | |||
| 1743 | Ga0495674_0026515 | |||
| 1744 | Ga0495674_0037329 | |||
| 1745 | Ga0495674_0068931 | |||
| 1746 | Ga0495674_0085545 | |||
| 1747 | Ga0495674_0148569 | |||
| 1748 | Ga0495674_0177844 | |||
| 1749 | Ga0495674_0185824 | |||
| 1750 | Ga0495676_0011431 | |||
| 1751 | Ga0495680_0033478 | |||
| 1752 | Ga0495680_0046323 | |||
| 1753 | Ga0495675_0047069 | |||
| 1754 | Ga0495675_0066796 | |||
| 1755 | Ga0495675_0137472 | |||
| 1756 | Ga0495684_0009445 | |||
| 1757 | Ga0495684_0045885 | |||
| 1758 | Ga0495684_0074333 | |||
| 1759 | Ga0495684_0128593 | |||
| 1760 | Ga0495684_0162297 | |||
| 1761 | Ga0495684_0162324 | |||
| 1762 | Ga0495684_0254545 | |||
| 1763 | Ga0495593_0201586 | |||
| 1764 | Ga0495602_0007373 | |||
| 1765 | Ga0495602_0012714 | |||
| 1766 | Ga0495602_0227204 | |||
| 1767 | Ga0495614_0083508 | |||
| 1768 | Ga0496102_0003262 | |||
| 1769 | Ga0496104_0187071 | |||
| 1770 | Ga0496104_0529846 | |||
| 1771 | Ga0496104_0546347 | |||
| 1772 | Ga0496105_0040092 | |||
| 1773 | Ga0496105_0124838 | |||
| 1774 | Ga0496106_0047796 | |||
| 1775 | Ga0496106_0105172 | |||
| 1776 | Ga0496112_0076683 | |||
| 1777 | Ga0496112_0574865 | |||
| 1778 | Ga0496114_0084575 | |||
| 1779 | Ga0496115_0013162 | |||
| 1780 | Ga0496115_0030708 | |||
| 1781 | Ga0496115_0377678 | |||
| 1782 | Ga0501034_0148196 | |||
| 1783 | Ga0501040_0494889 | |||
| 1784 | Ga0501047_0585681 | |||
| 1785 | Ga0501257_030100 | |||
| 1786 | Ga0501083_0155085 | |||
| 1787 | nmdc:mga05p37_374426_c1 | |||
| 1788 | nmdc:mga06r32_18770_c1 | |||
| 1789 | nmdc:mga06r32_3006_c1 | |||
| 1790 | nmdc:mga08y16_7533_c1 | |||
| 1791 | nmdc:mga0n895_147823_c1 | |||
| 1792 | nmdc:mga0n895_27628_c1 | |||
| 1793 | nmdc:mga0n895_37419_c1 | |||
| 1794 | nmdc:mga0rr50_144380_c1 | |||
| 1795 | nmdc:mga0rr50_146360_c1 | |||
| 1796 | nmdc:mga0rr50_69829_c1 | |||
| 1797 | nmdc:mga0rr50_90421_c1 | |||
| 1798 | nmdc:mga08x19_119315_c1 | |||
| 1799 | nmdc:mga08x19_1487_c1 | |||
| 1800 | nmdc:mga08x19_19216_c1 | |||
| 1801 | nmdc:mga08x19_35195_c1 | |||
| 1802 | nmdc:mga08x19_663_c1 | |||
| 1803 | nmdc:mga0a205_391124_c1 | |||
| 1804 | Ga0495612_0047102 | |||
| 1805 | Ga0495619_0062666 | |||
| 1806 | Ga0495619_0063711 | |||
| 1807 | Ga0500568_0006476 | |||
| 1808 | Ga0501082_0006860 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j6e-assembly1.cif.gz_A-2 | structure of lpxi d225a mutant | 0.8826 | 4 | 268 |
| 4j6e-assembly1.cif.gz_A-2 | structure of lpxi d225a mutant | 0.8644 | 4 | 268 |
| 2w6p-assembly2.cif.gz_B | crystal structure of biotin carboxylase from e. coli in complex with 5-methyl-6-phenyl-quinazoline-2,4-diamine | 0.7569 | 3 | 71 |
| 7csg-assembly1.cif.gz_A | atprr2 in apo form | 0.7543 | 2 | 72 |
| 7cs3-assembly3.cif.gz_E | iiplr1 with nadp+ | 0.7459 | 2 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4j6eA02 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;LpxI C-terminal catalytic domain | 0.9118 | 131 | 268 | 3.40.140.80 |
| 4j6eA02 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;LpxI C-terminal catalytic domain | 0.8696 | 131 | 268 | 3.40.140.80 |
| 4j6eA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8583 | 4 | 128 | 3.40.50.20 |
| 4ggmX01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8398 | 1 | 126 | 3.40.50.20 |
| 4ggmX01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8337 | 1 | 126 | 3.40.50.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9V5H8-F1-model_v4 | DUF1009 domain-containing protein | 0.9805 | 2 | 128 |
|
| AF-A0A3N5ICF4-F1-model_v4 | DUF1009 domain-containing protein | 0.9747 | 2 | 77 |
|
| AF-A0A2M7Z1T5-F1-model_v4 | DUF1009 domain-containing protein | 0.9711 | 2 | 71 |
|
| AF-A0A3N5PBY0-F1-model_v4 | DUF1009 domain-containing protein | 0.9645 | 2 | 75 |
|
| AF-A0A7V5T5W3-F1-model_v4 | DUF1009 domain-containing protein | 0.9624 | 28 | 125 |
|