F484921

General Info

Members Datasets Scaffolds Average Seq Length
893 306 762 246

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0118228|Ga0495597_0118228_56_934
Length 292
Sequence VAKPIDKPGVTLTIFSLSVHTAATETGPNSARLRSQEHLTDQGTAMVSTTARPASRPLNFWVCLGVPAVAAIILVLLELTSVDMDLARMFYDPAAGDFIGRHSYFLENILHDRAKQVVIAFSVLAIFGFIGAFFIGRLKPFKRELGCLVLSLGLATSFVTPVKAVTAVQCPWSLEQFGGHETYSELLSPRPPTEKPGRCWPGGHAATGFTLFALFFVLRDRRPRLARKALVFAFALGTVFSIGRMLQGAHFFSHNVWTAIFCWLICLGSYYYILYRPALKADRVTKAEPVGA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231012 Pseudomonas sp. GM33 Isolate Nodule
7 2511231014 Pseudomonas sp. GM48 Isolate Nodule
8 2511231015 Pseudomonas sp. GM49 Isolate Nodule
9 2511231016 Pseudomonas sp. GM50 Isolate Nodule
10 2511231017 Pseudomonas sp. GM55 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231020 Pseudomonas sp. GM74 Isolate Nodule
14 2511231021 Pseudomonas sp. GM78 Isolate Nodule
15 2511231022 Pseudomonas sp. GM79 Isolate Nodule
16 2511231031 Pseudomonas sp. GM16 Isolate Nodule
17 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
18 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
19 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
20 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
21 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
22 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
23 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
24 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
25 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
26 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
27 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
28 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
29 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
30 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
31 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
32 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
33 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
34 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
35 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
36 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
37 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
38 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
39 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
40 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
41 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
42 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
43 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
44 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
45 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
46 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
47 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
48 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
49 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
50 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
51 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
52 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
53 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
54 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
55 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
56 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
57 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
58 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
59 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
60 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
61 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
62 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
63 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
64 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
65 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
66 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
67 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
68 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
69 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
70 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
71 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
72 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
73 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
74 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
75 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
76 2773857670 Pseudomonas sp. 478 Isolate Unclassified
77 2784132072 Pseudomonas sp. 460 Isolate Unclassified
78 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
79 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
80 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
81 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
82 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
83 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
84 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
85 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
86 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
87 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
88 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
89 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
90 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
91 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
92 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
93 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
94 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
95 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
96 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
97 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
98 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
99 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
100 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
101 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
102 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
103 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
104 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
105 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
106 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
107 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
108 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
109 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
110 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
111 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
112 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
113 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
114 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
115 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
116 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
117 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
118 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
119 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
120 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
121 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
122 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
123 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
124 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
125 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
126 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
127 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
128 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
134 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
137 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
150 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
151 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
163 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
173 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
174 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
177 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
178 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
179 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
180 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
181 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
182 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
183 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
184 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
185 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
186 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
187 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
188 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
264 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
265 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
288 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
294 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
295 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
296 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
297 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
298 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
299 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
300 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
301 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
302 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
303 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
304 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
305 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
306 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.33
Metatranscriptomes 0
Isolates 14.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 2.46
Rhizoplane 4.7
Rhizosphere 81.75
Stem 0
Stem Tuber 0
Unclassified 8.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6772 2124908027 Bacteria 5870
2 Ga0055536_1000960 3300003781 Bacteria 18460
3 Ga0055536_1001207 3300003781 Bacteria 16051
4 Ga0055530_10001329 3300003791 Bacteria 18502
5 Ga0055530_10001466 3300003791 Bacteria 17185
6 Ga0055540_1000973 3300003792 Bacteria 18502
7 Ga0055540_1001042 3300003792 Bacteria 17694
8 Ga0055531_10000306 3300003794 Bacteria 48429
9 Ga0065714_10093695 3300005288 Bacteria 1829
10 Ga0065712_10000146 3300005290 Bacteria 63767
11 Ga0065712_10005016 3300005290 Bacteria 8267
12 Ga0065715_10000740 3300005293 Bacteria 8677
13 Ga0070669_100003291 3300005353 Bacteria 11611
14 Ga0075364_10209571 3300006051 Bacteria 1321
15 Ga0075364_10272050 3300006051 Bacteria 1152
16 Ga0075432_10000973 3300006058 Bacteria 9056
17 Ga0075432_10006156 3300006058 Bacteria 4081
18 Ga0075362_10081236 3300006177 Bacteria 1494
19 Ga0075436_100144212 3300006914 Bacteria 1674
20 Ga0075436_100200424 3300006914 Bacteria 1413
21 Ga0079104_1000202 3300006946 Bacteria 83431
22 Ga0079104_1001055 3300006946 Bacteria 20897
23 Ga0099826_10010237 3300006948 Bacteria 7022
24 Ga0105251_10000030 3300009011 Bacteria 124407
25 Ga0105251_10000635 3300009011 Bacteria 32233
26 Ga0105251_10008759 3300009011 Bacteria 6066
27 Ga0105251_10021524 3300009011 Bacteria 3364
28 Ga0105251_10029249 3300009011 Bacteria 2776
29 Ga0105251_10031851 3300009011 Bacteria 2633
30 Ga0105251_10108727 3300009011 Bacteria 1264
31 Ga0105244_10001778 3300009036 Bacteria 16918
32 Ga0105244_10003010 3300009036 Bacteria 12361
33 Ga0105244_10030448 3300009036 Bacteria 2872
34 Ga0105244_10032158 3300009036 Bacteria 2780
35 Ga0105244_10058966 3300009036 Bacteria 1936
36 Ga0105244_10112320 3300009036 Bacteria 1324
37 Ga0105244_10170792 3300009036 Bacteria 1035
38 Ga0105250_10001943 3300009092 Bacteria 10714
39 Ga0105250_10001976 3300009092 Bacteria 10614
40 Ga0105250_10002032 3300009092 Bacteria 10438
41 Ga0105250_10003298 3300009092 Bacteria 7683
42 Ga0105250_10050863 3300009092 Bacteria 1663
43 Ga0105250_10060055 3300009092 Bacteria 1527
44 Ga0105250_10141510 3300009092 Bacteria 997
45 Ga0105250_10141597 3300009092 Bacteria 997
46 Ga0105243_10000383 3300009148 Bacteria 47537
47 Ga0105243_10133735 3300009148 Bacteria 2107
48 Ga0105243_10827181 3300009148 Bacteria 915
49 Ga0105246_10001503 3300011119 Bacteria 13825
50 Ga0105246_10195991 3300011119 Bacteria 1567
51 Ga0157345_1000199 3300012498 Bacteria 9279
52 Ga0157373_10004528 3300013100 Bacteria 10454
53 Ga0157373_10025541 3300013100 Bacteria 4271
54 Ga0157373_10145676 3300013100 Bacteria 1666
55 Ga0157371_10002919 3300013102 Bacteria 15967
56 Ga0157370_10011460 3300013104 Bacteria 9269
57 Ga0157370_10041762 3300013104 Bacteria 4422
58 Ga0157370_10231427 3300013104 Bacteria 1710
59 Ga0157370_10275116 3300013104 Bacteria 1556
60 Ga0157370_10366554 3300013104 Bacteria 1328
61 Ga0157370_10596002 3300013104 Bacteria 1012
62 Ga0157369_10022969 3300013105 Bacteria 6955
63 Ga0157369_10027415 3300013105 Bacteria 6315
64 Ga0157369_10528970 3300013105 Bacteria 1219
65 Ga0163162_10013597 3300013306 Bacteria 7952
66 Ga0163162_10087354 3300013306 Bacteria 3197
67 Ga0163162_10221852 3300013306 Bacteria 2020
68 Ga0163162_10608936 3300013306 Bacteria 1218
69 Ga0157372_10030668 3300013307 Bacteria 5883
70 Ga0157375_10249515 3300013308 Bacteria 1936
71 Ga0182008_10013720 3300014497 Bacteria 4256
72 Ga0182006_1002939 3300015261 Bacteria 9018
73 Ga0182006_1010929 3300015261 Bacteria 4014
74 Ga0182006_1029385 3300015261 Bacteria 2227
75 Ga0182006_1052876 3300015261 Bacteria 1559
76 Ga0182007_10011362 3300015262 Bacteria 3469
77 Ga0182007_10035780 3300015262 Bacteria 1673
78 Ga0182005_1005466 3300015265 Bacteria 3966
79 Ga0182005_1012758 3300015265 Bacteria 2368
80 Ga0182005_1028085 3300015265 Bacteria 1534
81 Ga0163161_10004825 3300017792 Bacteria 9394
82 Ga0163161_10008092 3300017792 Bacteria 7272
83 Ga0163161_10058980 3300017792 Bacteria 2790
84 Ga0163161_10063798 3300017792 Bacteria 2686
85 Ga0163161_10377106 3300017792 Bacteria 1133
86 Ga0209676_1000006 3300025292 Bacteria 1039588
87 Ga0209676_1000010 3300025292 Bacteria 954025
88 Ga0209676_1000834 3300025292 Bacteria 39941
89 Ga0209050_1000019 3300025298 Bacteria 608757
90 Ga0209050_1000065 3300025298 Bacteria 313668
91 Ga0209050_1002317 3300025298 Bacteria 16752
92 Ga0209051_1000138 3300025303 Bacteria 137073
93 Ga0209051_1000189 3300025303 Bacteria 109144
94 Ga0209051_1006605 3300025303 Bacteria 6504
95 Ga0209257_1000119 3300025304 Bacteria 225893
96 Ga0207696_1000054 3300025711 Bacteria 266962
97 Ga0207696_1000262 3300025711 Bacteria 67626
98 Ga0207696_1001124 3300025711 Bacteria 15543
99 Ga0207696_1006571 3300025711 Bacteria 4668
100 Ga0207696_1010846 3300025711 Bacteria 3319
101 Ga0207696_1011704 3300025711 Bacteria 3143
102 Ga0207696_1038261 3300025711 Bacteria 1417
103 Ga0207696_1046875 3300025711 Bacteria 1246
104 Ga0207655_1000717 3300025728 Bacteria 37625
105 Ga0207655_1000732 3300025728 Bacteria 37041
106 Ga0207655_1001535 3300025728 Bacteria 20922
107 Ga0207655_1003020 3300025728 Bacteria 12874
108 Ga0207655_1005755 3300025728 Bacteria 8348
109 Ga0207655_1008932 3300025728 Bacteria 6288
110 Ga0207655_1020511 3300025728 Bacteria 3393
111 Ga0207655_1021503 3300025728 Bacteria 3272
112 Ga0207655_1039182 3300025728 Bacteria 2063
113 Ga0207655_1053407 3300025728 Bacteria 1616
114 Ga0207655_1091840 3300025728 Bacteria 1066
115 Ga0207713_1000013 3300025735 Bacteria 475751
116 Ga0207713_1000068 3300025735 Bacteria 192415
117 Ga0207713_1001333 3300025735 Bacteria 20240
118 Ga0207713_1001372 3300025735 Bacteria 19806
119 Ga0207713_1003472 3300025735 Bacteria 10732
120 Ga0207713_1006811 3300025735 Bacteria 6893
121 Ga0207713_1010339 3300025735 Bacteria 5174
122 Ga0207713_1022941 3300025735 Bacteria 2950
123 Ga0207713_1036588 3300025735 Bacteria 2104
124 Ga0207713_1043769 3300025735 Bacteria 1847
125 Ga0207681_10080745 3300025923 Bacteria 2294
126 Ga0207709_10000013 3300025935 Bacteria 531977
127 Ga0209281_1000010 3300027111 Bacteria 726106
128 Ga0209281_1000049 3300027111 Bacteria 322274
129 Ga0209281_1005237 3300027111 Bacteria 3647
130 Ga0209282_1011173 3300027666 Bacteria 5692
131 Ga0207428_10095216 3300027907 Bacteria 2307
132 Ga0207428_10126838 3300027907 Bacteria 1954
133 Ga0268266_10048169 3300028379 Bacteria 3652
134 Ga0307408_100195644 3300031548 Bacteria 1632
135 Ga0307405_10003042 3300031731 Bacteria 7598
136 Ga0307412_10004116 3300031911 Bacteria 8108
137 Ga0307412_10133987 3300031911 Bacteria 1804
138 Ga0307412_10378431 3300031911 Bacteria 1145
139 Ga0307416_100431155 3300032002 Bacteria 1365
140 Ga0307414_10815796 3300032004 Bacteria 851
141 Ga0307510_10043502 3300033180 Bacteria 4880
142 Ga0237819_01512 3300038705 Bacteria 5924
143 Ga0439438_001992 3300041405 Bacteria 8928
144 Ga0439438_002757 3300041405 Bacteria 7367
145 Ga0439438_004017 3300041405 Bacteria 5777
146 Ga0439438_005749 3300041405 Bacteria 4506
147 Ga0439438_048483 3300041405 Bacteria 1086
148 Ga0439447_006849 3300041407 Bacteria 3660
149 Ga0439447_021899 3300041407 Bacteria 1679
150 Ga0439466_0002237 3300041411 Bacteria 7584
151 Ga0439466_0003622 3300041411 Bacteria 5967
152 Ga0439466_0008301 3300041411 Bacteria 3914
153 Ga0439451_003387 3300042009 Bacteria 3227
154 Ga0439451_020673 3300042009 Bacteria 1326
155 Ga0439452_000638 3300042010 Bacteria 17666
156 Ga0439452_016838 3300042010 Bacteria 1977
157 Ga0439452_026788 3300042010 Bacteria 1452
158 Ga0439456_002456 3300042013 Bacteria 3741
159 Ga0439456_038469 3300042013 Bacteria 1034
160 Ga0439456_049866 3300042013 Bacteria 914
161 Ga0439463_001065 3300042016 Bacteria 7404
162 Ga0439463_001559 3300042016 Bacteria 6050
163 Ga0439463_032121 3300042016 Bacteria 1326
164 Ga0450911_005846 3300042115 Bacteria 1875
165 Ga0450911_008992 3300042115 Bacteria 1410
166 Ga0450920_012685 3300042122 Bacteria 1582
167 Ga0450921_001655 3300042123 Bacteria 1385
168 Ga0450922_001855 3300042124 Bacteria 2040
169 Ga0450902_023188 3300042137 Bacteria 1030
170 Ga0450903_000933 3300042138 Bacteria 5607
171 Ga0450903_006674 3300042138 Bacteria 1911
172 Ga0450905_009671 3300042142 Bacteria 1328
173 Ga0450906_002896 3300042145 Bacteria 3729
174 Ga0450907_000325 3300042146 Bacteria 15464
175 Ga0450908_002424 3300042184 Bacteria 3650
176 Ga0450908_005137 3300042184 Bacteria 2510
177 Ga0450908_017674 3300042184 Bacteria 1265
178 Ga0450909_000454 3300042185 Bacteria 5290
179 Ga0439434_0002478 3300042435 Bacteria 5372
180 Ga0439460_0001511 3300042461 Bacteria 5475
181 Ga0451577_0237311 3300042876 Bacteria 1649
182 Ga0439440_0014497 3300042993 Bacteria 1702
183 Ga0439440_0016703 3300042993 Bacteria 1610
184 Ga0439440_0037981 3300042993 Bacteria 1164
185 Ga0495617_002793 3300046452 Bacteria 6736
186 Ga0495617_011163 3300046452 Bacteria 3070
187 Ga0495617_021172 3300046452 Bacteria 2197
188 Ga0495617_030954 3300046452 Bacteria 1798
189 Ga0495617_048563 3300046452 Bacteria 1412
190 Ga0495617_062780 3300046452 Bacteria 1227
191 Ga0495617_074023 3300046452 Bacteria 1118
192 Ga0495617_077491 3300046452 Bacteria 1090
193 Ga0495617_107844 3300046452 Bacteria 902
194 Ga0495627_001916 3300046453 Bacteria 10862
195 Ga0495627_001965 3300046453 Bacteria 10632
196 Ga0495627_002427 3300046453 Bacteria 8995
197 Ga0495627_003464 3300046453 Bacteria 6962
198 Ga0495627_004220 3300046453 Bacteria 6077
199 Ga0495627_030489 3300046453 Bacteria 1709
200 Ga0495603_0050979 3300046455 Bacteria 2460
201 Ga0495603_0154618 3300046455 Bacteria 1331
202 Ga0495603_0178633 3300046455 Bacteria 1228
203 Ga0495590_0001520 3300046457 Bacteria 9979
204 Ga0495590_0003210 3300046457 Bacteria 6682
205 Ga0495590_0006548 3300046457 Bacteria 4541
206 Ga0495590_0028505 3300046457 Bacteria 1958
207 Ga0495590_0044254 3300046457 Bacteria 1552
208 Ga0495591_000243 3300046458 Bacteria 52402
209 Ga0495591_000823 3300046458 Bacteria 21995
210 Ga0495591_003838 3300046458 Bacteria 7595
211 Ga0495591_004916 3300046458 Bacteria 6346
212 Ga0495591_005719 3300046458 Bacteria 5674
213 Ga0495591_008317 3300046458 Bacteria 4269
214 Ga0495591_023692 3300046458 Bacteria 1961
215 Ga0495591_025094 3300046458 Bacteria 1875
216 Ga0495591_027119 3300046458 Bacteria 1770
217 Ga0495591_027519 3300046458 Bacteria 1752
218 Ga0495591_029374 3300046458 Bacteria 1670
219 Ga0495591_037570 3300046458 Bacteria 1400
220 Ga0495591_055606 3300046458 Bacteria 1066
221 Ga0495629_0316508 3300046459 Bacteria 1067
222 Ga0495638_0009223 3300046460 Bacteria 6936
223 Ga0495638_0010052 3300046460 Bacteria 6596
224 Ga0495638_0011824 3300046460 Bacteria 6005
225 Ga0495638_0016148 3300046460 Bacteria 5003
226 Ga0495638_0021994 3300046460 Bacteria 4191
227 Ga0495638_0034035 3300046460 Bacteria 3254
228 Ga0495638_0035798 3300046460 Bacteria 3163
229 Ga0495638_0066794 3300046460 Bacteria 2209
230 Ga0495638_0122555 3300046460 Bacteria 1535
231 Ga0495638_0127509 3300046460 Bacteria 1498
232 Ga0495638_0155298 3300046460 Bacteria 1324
233 Ga0495653_0022555 3300046463 Bacteria 5091
234 Ga0495653_0038792 3300046463 Bacteria 3737
235 Ga0495650_0040914 3300046471 Bacteria 1985
236 Ga0495650_0042104 3300046471 Bacteria 1947
237 Ga0495650_0043304 3300046471 Bacteria 1911
238 Ga0495650_0053872 3300046471 Bacteria 1644
239 Ga0495650_0062131 3300046471 Bacteria 1493
240 Ga0495650_0066582 3300046471 Bacteria 1425
241 Ga0495650_0156876 3300046471 Bacteria 814
242 Ga0495605_0000016 3300046474 Bacteria 289508
243 Ga0495605_0000299 3300046474 Bacteria 53270
244 Ga0495605_0004377 3300046474 Bacteria 8312
245 Ga0495605_0020938 3300046474 Bacteria 3470
246 Ga0495605_0029776 3300046474 Bacteria 2805
247 Ga0495605_0040477 3300046474 Bacteria 2326
248 Ga0495605_0055453 3300046474 Bacteria 1915
249 Ga0495605_0071971 3300046474 Bacteria 1631
250 Ga0495605_0081814 3300046474 Bacteria 1509
251 Ga0495605_0127698 3300046474 Bacteria 1148
252 Ga0495639_0002146 3300046475 Bacteria 8699
253 Ga0495639_0115282 3300046475 Bacteria 1278
254 Ga0495639_0275231 3300046475 Bacteria 836
255 Ga0495584_0012018 3300046491 Bacteria 4426
256 Ga0495584_0021169 3300046491 Bacteria 3302
257 Ga0495584_0133536 3300046491 Bacteria 1259
258 Ga0495584_0157913 3300046491 Bacteria 1152
259 Ga0495584_0261664 3300046491 Bacteria 879
260 Ga0495584_0262140 3300046491 Bacteria 878
261 Ga0495585_0000818 3300046492 Bacteria 26884
262 Ga0495585_0004146 3300046492 Bacteria 9483
263 Ga0495585_0005457 3300046492 Bacteria 8016
264 Ga0495585_0006394 3300046492 Bacteria 7315
265 Ga0495585_0008829 3300046492 Bacteria 6082
266 Ga0495585_0010852 3300046492 Bacteria 5412
267 Ga0495585_0020534 3300046492 Bacteria 3798
268 Ga0495585_0078937 3300046492 Bacteria 1785
269 Ga0495585_0098297 3300046492 Bacteria 1568
270 Ga0495585_0101793 3300046492 Bacteria 1535
271 Ga0495585_0117769 3300046492 Bacteria 1407
272 Ga0495585_0123745 3300046492 Bacteria 1366
273 Ga0495585_0130622 3300046492 Bacteria 1322
274 Ga0495585_0192222 3300046492 Bacteria 1043
275 Ga0495594_0001938 3300046499 Bacteria 10795
276 Ga0495594_0017458 3300046499 Bacteria 3792
277 Ga0495594_0046137 3300046499 Bacteria 2392
278 Ga0495594_0060717 3300046499 Bacteria 2091
279 Ga0495594_0383592 3300046499 Bacteria 800
280 Ga0495596_0000803 3300046500 Bacteria 19026
281 Ga0495596_0005778 3300046500 Bacteria 5798
282 Ga0495596_0007475 3300046500 Bacteria 4926
283 Ga0495607_0000216 3300046501 Bacteria 61507
284 Ga0495607_0003264 3300046501 Bacteria 12479
285 Ga0495607_0006299 3300046501 Bacteria 8365
286 Ga0495607_0007554 3300046501 Bacteria 7503
287 Ga0495607_0010318 3300046501 Bacteria 6282
288 Ga0495607_0015041 3300046501 Bacteria 5025
289 Ga0495607_0015584 3300046501 Bacteria 4924
290 Ga0495607_0018931 3300046501 Bacteria 4379
291 Ga0495607_0022155 3300046501 Bacteria 3994
292 Ga0495607_0023891 3300046501 Bacteria 3818
293 Ga0495607_0044365 3300046501 Bacteria 2622
294 Ga0495607_0074302 3300046501 Bacteria 1887
295 Ga0495607_0075331 3300046501 Bacteria 1870
296 Ga0495607_0077573 3300046501 Bacteria 1835
297 Ga0495607_0079753 3300046501 Bacteria 1802
298 Ga0495607_0092184 3300046501 Bacteria 1639
299 Ga0495607_0110149 3300046501 Bacteria 1461
300 Ga0495607_0144548 3300046501 Bacteria 1223
301 Ga0495607_0164090 3300046501 Bacteria 1126
302 Ga0495583_0000041 3300046506 Bacteria 234707
303 Ga0495583_0002133 3300046506 Bacteria 17702
304 Ga0495583_0003693 3300046506 Bacteria 11393
305 Ga0495583_0005221 3300046506 Bacteria 8920
306 Ga0495583_0006524 3300046506 Bacteria 7611
307 Ga0495583_0010699 3300046506 Bacteria 5328
308 Ga0495583_0023117 3300046506 Bacteria 3151
309 Ga0495583_0045877 3300046506 Bacteria 2018
310 Ga0495583_0101271 3300046506 Bacteria 1229
311 Ga0495606_0000055 3300046507 Bacteria 199348
312 Ga0495606_0000695 3300046507 Bacteria 52206
313 Ga0495606_0010766 3300046507 Bacteria 7538
314 Ga0495606_0036273 3300046507 Bacteria 3359
315 Ga0495606_0038714 3300046507 Bacteria 3222
316 Ga0495606_0069669 3300046507 Bacteria 2220
317 Ga0495606_0099057 3300046507 Bacteria 1777
318 Ga0495606_0190331 3300046507 Bacteria 1176
319 Ga0495606_0196159 3300046507 Bacteria 1154
320 Ga0495606_0239194 3300046507 Bacteria 1013
321 Ga0495610_0006987 3300046512 Bacteria 7635
322 Ga0495610_0008069 3300046512 Bacteria 6887
323 Ga0495610_0009591 3300046512 Bacteria 6104
324 Ga0495610_0010333 3300046512 Bacteria 5812
325 Ga0495610_0029122 3300046512 Bacteria 2912
326 Ga0495610_0044936 3300046512 Bacteria 2188
327 Ga0495610_0057120 3300046512 Bacteria 1873
328 Ga0495610_0111878 3300046512 Bacteria 1208
329 Ga0495610_0126793 3300046512 Bacteria 1112
330 Ga0495616_0009349 3300046513 Bacteria 5745
331 Ga0495616_0019674 3300046513 Bacteria 3681
332 Ga0495616_0029448 3300046513 Bacteria 2899
333 Ga0495616_0044584 3300046513 Bacteria 2248
334 Ga0495616_0057385 3300046513 Bacteria 1920
335 Ga0495616_0066296 3300046513 Bacteria 1756
336 Ga0495616_0086420 3300046513 Bacteria 1491
337 Ga0495616_0205530 3300046513 Bacteria 863
338 Ga0495620_0002626 3300046515 Bacteria 10389
339 Ga0495620_0003715 3300046515 Bacteria 8715
340 Ga0495620_0008220 3300046515 Bacteria 5611
341 Ga0495620_0014838 3300046515 Bacteria 3949
342 Ga0495620_0022112 3300046515 Bacteria 3071
343 Ga0495620_0030421 3300046515 Bacteria 2485
344 Ga0495620_0031159 3300046515 Bacteria 2446
345 Ga0495620_0069165 3300046515 Bacteria 1448
346 Ga0495620_0085112 3300046515 Bacteria 1274
347 Ga0495620_0090326 3300046515 Bacteria 1229
348 Ga0495620_0118290 3300046515 Bacteria 1046
349 Ga0495630_0101156 3300046517 Bacteria 2180
350 Ga0495630_0129847 3300046517 Bacteria 1913
351 Ga0495630_0325339 3300046517 Bacteria 1175
352 Ga0495631_0000832 3300046518 Bacteria 19641
353 Ga0495631_0001817 3300046518 Bacteria 12609
354 Ga0495631_0002480 3300046518 Bacteria 10385
355 Ga0495631_0002614 3300046518 Bacteria 10056
356 Ga0495631_0049924 3300046518 Bacteria 1830
357 Ga0495631_0060172 3300046518 Bacteria 1648
358 Ga0495631_0070129 3300046518 Bacteria 1515
359 Ga0495631_0096204 3300046518 Bacteria 1274
360 Ga0495631_0110800 3300046518 Bacteria 1180
361 Ga0495632_0003261 3300046519 Bacteria 11612
362 Ga0495632_0006728 3300046519 Bacteria 7349
363 Ga0495632_0006793 3300046519 Bacteria 7304
364 Ga0495632_0009991 3300046519 Bacteria 5660
365 Ga0495632_0014173 3300046519 Bacteria 4520
366 Ga0495632_0029924 3300046519 Bacteria 2830
367 Ga0495632_0063058 3300046519 Bacteria 1795
368 Ga0495632_0089054 3300046519 Bacteria 1465
369 Ga0495632_0089439 3300046519 Bacteria 1461
370 Ga0495632_0091721 3300046519 Bacteria 1439
371 Ga0495632_0108494 3300046519 Bacteria 1304
372 Ga0495632_0109103 3300046519 Bacteria 1300
373 Ga0495632_0111279 3300046519 Bacteria 1285
374 Ga0495632_0111801 3300046519 Bacteria 1282
375 Ga0495632_0171483 3300046519 Bacteria 996
376 Ga0495632_0206515 3300046519 Bacteria 892
377 Ga0495637_0000312 3300046520 Bacteria 37814
378 Ga0495637_0000542 3300046520 Bacteria 27172
379 Ga0495637_0000800 3300046520 Bacteria 20912
380 Ga0495637_0005063 3300046520 Bacteria 6769
381 Ga0495637_0005295 3300046520 Bacteria 6595
382 Ga0495637_0007361 3300046520 Bacteria 5463
383 Ga0495637_0008093 3300046520 Bacteria 5175
384 Ga0495637_0009686 3300046520 Bacteria 4691
385 Ga0495637_0018548 3300046520 Bacteria 3225
386 Ga0495637_0018736 3300046520 Bacteria 3207
387 Ga0495637_0025906 3300046520 Bacteria 2639
388 Ga0495637_0026975 3300046520 Bacteria 2573
389 Ga0495637_0047072 3300046520 Bacteria 1822
390 Ga0495637_0052040 3300046520 Bacteria 1711
391 Ga0495637_0053835 3300046520 Bacteria 1673
392 Ga0495637_0059651 3300046520 Bacteria 1569
393 Ga0495637_0098747 3300046520 Bacteria 1143
394 Ga0495637_0110395 3300046520 Bacteria 1066
395 Ga0495643_0006458 3300046522 Bacteria 7724
396 Ga0495643_0023441 3300046522 Bacteria 3509
397 Ga0495643_0027217 3300046522 Bacteria 3216
398 Ga0495643_0039227 3300046522 Bacteria 2590
399 Ga0495643_0093266 3300046522 Bacteria 1551
400 Ga0495643_0141203 3300046522 Bacteria 1201
401 Ga0495643_0172641 3300046522 Bacteria 1056
402 Ga0495643_0237564 3300046522 Bacteria 856
403 Ga0495644_0001295 3300046523 Bacteria 10257
404 Ga0495644_0003557 3300046523 Bacteria 6153
405 Ga0495644_0004792 3300046523 Bacteria 5315
406 Ga0495644_0010818 3300046523 Bacteria 3515
407 Ga0495644_0011318 3300046523 Bacteria 3435
408 Ga0495644_0047566 3300046523 Bacteria 1611
409 Ga0495644_0058076 3300046523 Bacteria 1454
410 Ga0495644_0108957 3300046523 Bacteria 1050
411 Ga0495644_0142871 3300046523 Bacteria 914
412 Ga0495648_0002206 3300046524 Bacteria 18232
413 Ga0495648_0007908 3300046524 Bacteria 8440
414 Ga0495648_0008330 3300046524 Bacteria 8173
415 Ga0495648_0016740 3300046524 Bacteria 5274
416 Ga0495648_0019143 3300046524 Bacteria 4825
417 Ga0495648_0019291 3300046524 Bacteria 4800
418 Ga0495648_0037358 3300046524 Bacteria 3121
419 Ga0495648_0083220 3300046524 Bacteria 1813
420 Ga0495648_0090364 3300046524 Bacteria 1716
421 Ga0495648_0153746 3300046524 Bacteria 1197
422 Ga0495648_0222947 3300046524 Bacteria 928
423 Ga0495666_0007285 3300046526 Bacteria 5549
424 Ga0495666_0051056 3300046526 Bacteria 1987
425 Ga0495666_0143822 3300046526 Bacteria 1110
426 Ga0495666_0158747 3300046526 Bacteria 1049
427 Ga0495642_0000644 3300046528 Bacteria 17524
428 Ga0495642_0001839 3300046528 Bacteria 9078
429 Ga0495654_0004242 3300046530 Bacteria 8567
430 Ga0495654_0004478 3300046530 Bacteria 8280
431 Ga0495654_0006111 3300046530 Bacteria 6900
432 Ga0495654_0009155 3300046530 Bacteria 5429
433 Ga0495654_0010407 3300046530 Bacteria 5062
434 Ga0495654_0013833 3300046530 Bacteria 4307
435 Ga0495654_0017468 3300046530 Bacteria 3773
436 Ga0495654_0020333 3300046530 Bacteria 3460
437 Ga0495654_0021407 3300046530 Bacteria 3363
438 Ga0495654_0022379 3300046530 Bacteria 3282
439 Ga0495654_0028533 3300046530 Bacteria 2853
440 Ga0495654_0028832 3300046530 Bacteria 2835
441 Ga0495654_0054006 3300046530 Bacteria 1950
442 Ga0495654_0068049 3300046530 Bacteria 1693
443 Ga0495654_0077699 3300046530 Bacteria 1561
444 Ga0495654_0116077 3300046530 Bacteria 1216
445 Ga0495654_0136344 3300046530 Bacteria 1097
446 Ga0495654_0172909 3300046530 Bacteria 940
447 Ga0495587_0007608 3300046536 Bacteria 7010
448 Ga0495609_0000015 3300046538 Bacteria 322474
449 Ga0495609_0000424 3300046538 Bacteria 35256
450 Ga0495609_0003111 3300046538 Bacteria 9713
451 Ga0495609_0004998 3300046538 Bacteria 7092
452 Ga0495609_0014856 3300046538 Bacteria 3653
453 Ga0495609_0038442 3300046538 Bacteria 2157
454 Ga0495609_0102484 3300046538 Bacteria 1239
455 Ga0495597_0003143 3300046542 Bacteria 9889
456 Ga0495597_0005471 3300046542 Bacteria 6717
457 Ga0495597_0005662 3300046542 Bacteria 6580
458 Ga0495597_0011509 3300046542 Bacteria 4288
459 Ga0495597_0034086 3300046542 Bacteria 2301
460 Ga0495597_0052718 3300046542 Bacteria 1790
461 Ga0495597_0053224 3300046542 Bacteria 1780
462 Ga0495597_0076685 3300046542 Bacteria 1433
463 Ga0495597_0080720 3300046542 Bacteria 1391
464 Ga0495597_0118228 3300046542 Bacteria 1106
465 Ga0495645_0180399 3300046543 Bacteria 1447
466 Ga0495622_0002743 3300046557 Bacteria 8430
467 Ga0495622_0004312 3300046557 Bacteria 6623
468 Ga0495622_0007333 3300046557 Bacteria 5120
469 Ga0495622_0016451 3300046557 Bacteria 3444
470 Ga0495622_0037108 3300046557 Bacteria 2270
471 Ga0495622_0065584 3300046557 Bacteria 1678
472 Ga0495633_0000363 3300046558 Bacteria 48912
473 Ga0495633_0035680 3300046558 Bacteria 2387
474 Ga0495633_0047352 3300046558 Bacteria 2031
475 Ga0495633_0086779 3300046558 Bacteria 1455
476 Ga0495656_0067617 3300046615 Bacteria 1577
477 Ga0495668_0002744 3300046616 Bacteria 14099
478 Ga0495668_0051084 3300046616 Bacteria 2289
479 Ga0495668_0114866 3300046616 Bacteria 1472
480 Ga0495668_0132291 3300046616 Bacteria 1365
481 Ga0495668_0157417 3300046616 Bacteria 1244
482 Ga0495634_0003534 3300046642 Bacteria 12511
483 Ga0495611_0000710 3300046648 Bacteria 18846
484 Ga0495611_0002224 3300046648 Bacteria 9022
485 Ga0495611_0006834 3300046648 Bacteria 4848
486 Ga0495611_0052734 3300046648 Bacteria 1835
487 Ga0495611_0114644 3300046648 Bacteria 1255
488 Ga0495611_0133952 3300046648 Bacteria 1156
489 Ga0495625_0000055 3300046660 Bacteria 186381
490 Ga0495625_0014734 3300046660 Bacteria 6224
491 Ga0495625_0025249 3300046660 Bacteria 4508
492 Ga0495625_0032078 3300046660 Bacteria 3900
493 Ga0495625_0039384 3300046660 Bacteria 3451
494 Ga0495625_0091124 3300046660 Bacteria 2107
495 Ga0495625_0113272 3300046660 Bacteria 1852
496 Ga0495625_0126415 3300046660 Bacteria 1735
497 Ga0495625_0143630 3300046660 Bacteria 1608
498 Ga0495625_0285225 3300046660 Bacteria 1061
499 Ga0495635_0004213 3300046663 Bacteria 9976
500 Ga0495659_0001401 3300046664 Bacteria 8214
501 Ga0495659_0025691 3300046664 Bacteria 2017
502 Ga0495659_0082330 3300046664 Bacteria 1223
503 Ga0495661_0000105 3300046665 Bacteria 101167
504 Ga0495661_0000419 3300046665 Bacteria 44795
505 Ga0495661_0005540 3300046665 Bacteria 8960
506 Ga0495661_0023400 3300046665 Bacteria 4011
507 Ga0495661_0052100 3300046665 Bacteria 2467
508 Ga0495661_0059060 3300046665 Bacteria 2284
509 Ga0495661_0081304 3300046665 Bacteria 1867
510 Ga0495661_0113677 3300046665 Bacteria 1505
511 Ga0495661_0114646 3300046665 Bacteria 1497
512 Ga0495661_0119367 3300046665 Bacteria 1458
513 Ga0495661_0164283 3300046665 Bacteria 1189
514 Ga0495661_0169369 3300046665 Bacteria 1166
515 Ga0495661_0220671 3300046665 Bacteria 982
516 Ga0495661_0236080 3300046665 Bacteria 940
517 Ga0495588_0089761 3300046674 Bacteria 1609
518 Ga0495657_0084558 3300046675 Bacteria 2046
519 Ga0495623_0004501 3300046679 Bacteria 9156
520 Ga0495623_0007845 3300046679 Bacteria 6943
521 Ga0495646_0070394 3300046680 Bacteria 2060
522 Ga0495669_0040795 3300046684 Bacteria 2059
523 Ga0495669_0110323 3300046684 Bacteria 1284
524 Ga0495613_0245662 3300046689 Bacteria 1250
525 Ga0495613_0345650 3300046689 Bacteria 1022
526 Ga0495670_0002890 3300046691 Bacteria 8465
527 Ga0495670_0003758 3300046691 Bacteria 7464
528 Ga0495670_0026648 3300046691 Bacteria 2861
529 Ga0495670_0035278 3300046691 Bacteria 2492
530 Ga0495670_0054355 3300046691 Bacteria 2006
531 Ga0495670_0070267 3300046691 Bacteria 1771
532 Ga0495670_0099078 3300046691 Bacteria 1499
533 Ga0495670_0123629 3300046691 Bacteria 1345
534 Ga0495670_0135091 3300046691 Bacteria 1287
535 Ga0495670_0186116 3300046691 Bacteria 1097
536 Ga0495671_0003657 3300046692 Bacteria 9364
537 Ga0495671_0004344 3300046692 Bacteria 8508
538 Ga0495671_0007147 3300046692 Bacteria 6390
539 Ga0495671_0014187 3300046692 Bacteria 4294
540 Ga0495671_0016663 3300046692 Bacteria 3920
541 Ga0495671_0017384 3300046692 Bacteria 3829
542 Ga0495671_0020907 3300046692 Bacteria 3444
543 Ga0495671_0025903 3300046692 Bacteria 3044
544 Ga0495671_0030490 3300046692 Bacteria 2761
545 Ga0495671_0031774 3300046692 Bacteria 2697
546 Ga0495671_0038445 3300046692 Bacteria 2418
547 Ga0495671_0067742 3300046692 Bacteria 1755
548 Ga0495671_0069612 3300046692 Bacteria 1729
549 Ga0495671_0106434 3300046692 Bacteria 1369
550 Ga0495649_0005105 3300046694 Bacteria 8423
551 Ga0495649_0005515 3300046694 Bacteria 8020
552 Ga0495649_0006501 3300046694 Bacteria 7273
553 Ga0495649_0012449 3300046694 Bacteria 4945
554 Ga0495649_0015590 3300046694 Bacteria 4321
555 Ga0495649_0016712 3300046694 Bacteria 4155
556 Ga0495649_0025707 3300046694 Bacteria 3278
557 Ga0495649_0047687 3300046694 Bacteria 2329
558 Ga0495649_0048595 3300046694 Bacteria 2305
559 Ga0495649_0095953 3300046694 Bacteria 1578
560 Ga0495649_0123144 3300046694 Bacteria 1370
561 Ga0495649_0159154 3300046694 Bacteria 1184
562 Ga0495589_0006199 3300046794 Bacteria 6314
563 Ga0495589_0006345 3300046794 Bacteria 6244
564 Ga0495589_0006467 3300046794 Bacteria 6177
565 Ga0495589_0009443 3300046794 Bacteria 5073
566 Ga0495589_0017106 3300046794 Bacteria 3724
567 Ga0495589_0034253 3300046794 Bacteria 2550
568 Ga0495589_0085121 3300046794 Bacteria 1536
569 Ga0495589_0092569 3300046794 Bacteria 1467
570 Ga0495600_0040554 3300046809 Bacteria 3033
571 Ga0495660_0002389 3300046810 Bacteria 11981
572 Ga0495660_0007169 3300046810 Bacteria 6566
573 Ga0495660_0008652 3300046810 Bacteria 5955
574 Ga0495660_0016519 3300046810 Bacteria 4255
575 Ga0495660_0028507 3300046810 Bacteria 3154
576 Ga0495660_0074608 3300046810 Bacteria 1791
577 Ga0495660_0075582 3300046810 Bacteria 1776
578 Ga0495660_0090364 3300046810 Bacteria 1592
579 Ga0495660_0115241 3300046810 Bacteria 1366
580 Ga0495660_0116899 3300046810 Bacteria 1354
581 Ga0495660_0120908 3300046810 Bacteria 1325
582 Ga0495660_0121236 3300046810 Bacteria 1323
583 Ga0495660_0135694 3300046810 Bacteria 1229
584 Ga0495660_0153374 3300046810 Bacteria 1135
585 Ga0495660_0173973 3300046810 Bacteria 1046
586 Ga0495660_0178117 3300046810 Bacteria 1030
587 Ga0495581_0059077 3300047315 Bacteria 2215
588 Ga0495604_0092412 3300047317 Bacteria 2241
589 Ga0495604_0096356 3300047317 Bacteria 2183
590 Ga0495636_0012334 3300047318 Bacteria 3383
591 Ga0495674_0008554 3300047319 Bacteria 9740
592 Ga0495672_0008378 3300047320 Bacteria 7640
593 Ga0495672_0008651 3300047320 Bacteria 7483
594 Ga0495672_0018577 3300047320 Bacteria 4610
595 Ga0495672_0028751 3300047320 Bacteria 3510
596 Ga0495672_0039480 3300047320 Bacteria 2869
597 Ga0495672_0041534 3300047320 Bacteria 2780
598 Ga0495672_0057850 3300047320 Bacteria 2250
599 Ga0495672_0065569 3300047320 Bacteria 2075
600 Ga0495672_0075039 3300047320 Bacteria 1902
601 Ga0495672_0077536 3300047320 Bacteria 1862
602 Ga0495672_0078815 3300047320 Bacteria 1841
603 Ga0495672_0100430 3300047320 Bacteria 1570
604 Ga0495672_0103957 3300047320 Bacteria 1535
605 Ga0495672_0113469 3300047320 Bacteria 1451
606 Ga0495672_0146837 3300047320 Bacteria 1226
607 Ga0495676_0000013 3300047321 Bacteria 213031
608 Ga0495676_0006758 3300047321 Bacteria 10547
609 Ga0495680_0030462 3300047322 Bacteria 4405
610 Ga0495680_0050297 3300047322 Bacteria 3259
611 Ga0495680_0160049 3300047322 Bacteria 1635
612 Ga0495683_0000219 3300047323 Bacteria 53978
613 Ga0495683_0001414 3300047323 Bacteria 15832
614 Ga0495683_0001717 3300047323 Bacteria 13887
615 Ga0495683_0009109 3300047323 Bacteria 5288
616 Ga0495683_0028237 3300047323 Bacteria 2869
617 Ga0495683_0060233 3300047323 Bacteria 1882
618 Ga0495683_0064564 3300047323 Bacteria 1807
619 Ga0495683_0069950 3300047323 Bacteria 1724
620 Ga0495683_0073971 3300047323 Bacteria 1670
621 Ga0495683_0096688 3300047323 Bacteria 1424
622 Ga0495683_0214865 3300047323 Bacteria 860
623 Ga0495687_005518 3300047443 Bacteria 8031
624 Ga0495675_0121091 3300047444 Bacteria 1629
625 Ga0495677_0001626 3300047445 Bacteria 9028
626 Ga0495679_000423 3300047446 Bacteria 31271
627 Ga0495679_000829 3300047446 Bacteria 19685
628 Ga0495679_006001 3300047446 Bacteria 5307
629 Ga0495679_006070 3300047446 Bacteria 5272
630 Ga0495679_006716 3300047446 Bacteria 4909
631 Ga0495679_042666 3300047446 Bacteria 1398
632 Ga0495679_081913 3300047446 Bacteria 915
633 Ga0495673_0002859 3300047469 Bacteria 11741
634 Ga0495673_0004018 3300047469 Bacteria 9389
635 Ga0495673_0004986 3300047469 Bacteria 8159
636 Ga0495673_0006539 3300047469 Bacteria 6835
637 Ga0495673_0007694 3300047469 Bacteria 6155
638 Ga0495673_0017536 3300047469 Bacteria 3630
639 Ga0495673_0017702 3300047469 Bacteria 3608
640 Ga0495673_0019674 3300047469 Bacteria 3379
641 Ga0495673_0028180 3300047469 Bacteria 2662
642 Ga0495673_0035563 3300047469 Bacteria 2293
643 Ga0495673_0045233 3300047469 Bacteria 1958
644 Ga0495673_0073358 3300047469 Bacteria 1434
645 Ga0495673_0078014 3300047469 Bacteria 1378
646 Ga0495673_0090347 3300047469 Bacteria 1252
647 Ga0495673_0111750 3300047469 Bacteria 1091
648 Ga0495673_0118179 3300047469 Bacteria 1052
649 Ga0495681_0001323 3300047470 Bacteria 18753
650 Ga0495681_0006057 3300047470 Bacteria 7994
651 Ga0495681_0006371 3300047470 Bacteria 7767
652 Ga0495681_0006681 3300047470 Bacteria 7530
653 Ga0495681_0009122 3300047470 Bacteria 6142
654 Ga0495681_0012743 3300047470 Bacteria 4922
655 Ga0495681_0013339 3300047470 Bacteria 4773
656 Ga0495681_0015390 3300047470 Bacteria 4329
657 Ga0495681_0016743 3300047470 Bacteria 4095
658 Ga0495681_0020158 3300047470 Bacteria 3622
659 Ga0495681_0021563 3300047470 Bacteria 3467
660 Ga0495681_0036431 3300047470 Bacteria 2432
661 Ga0495681_0046988 3300047470 Bacteria 2055
662 Ga0495681_0047257 3300047470 Bacteria 2048
663 Ga0495681_0054526 3300047470 Bacteria 1867
664 Ga0495681_0055864 3300047470 Bacteria 1839
665 Ga0495681_0097270 3300047470 Bacteria 1291
666 Ga0495684_0107425 3300047471 Bacteria 2108
667 Ga0495686_0007975 3300047472 Bacteria 7854
668 Ga0495686_0015422 3300047472 Bacteria 5218
669 Ga0495686_0020082 3300047472 Bacteria 4457
670 Ga0495686_0036998 3300047472 Bacteria 3129
671 Ga0495686_0109003 3300047472 Bacteria 1662
672 Ga0495686_0116418 3300047472 Bacteria 1597
673 Ga0495686_0119760 3300047472 Bacteria 1570
674 Ga0495686_0224996 3300047472 Bacteria 1065
675 Ga0495593_0006269 3300047673 Bacteria 6981
676 Ga0495593_0067976 3300047673 Bacteria 1854
677 Ga0495593_0156986 3300047673 Bacteria 1149
678 Ga0495626_0000252 3300048091 Bacteria 61398
679 Ga0495626_0001441 3300048091 Bacteria 18915
680 Ga0495626_0001821 3300048091 Bacteria 16077
681 Ga0495626_0001825 3300048091 Bacteria 16049
682 Ga0495626_0004164 3300048091 Bacteria 8977
683 Ga0495626_0007377 3300048091 Bacteria 6125
684 Ga0495626_0012334 3300048091 Bacteria 4485
685 Ga0495626_0013535 3300048091 Bacteria 4236
686 Ga0495626_0121012 3300048091 Bacteria 1125
687 Ga0496102_0005661 3300048905 Bacteria 10606
688 Ga0496103_0156146 3300048906 Bacteria 1462
689 Ga0496106_0151030 3300048909 Bacteria 1832
690 Ga0496110_0192979 3300048913 Bacteria 1849
691 Ga0496110_0406255 3300048913 Bacteria 1242
692 Ga0496111_0256257 3300048914 Bacteria 1298
693 Ga0496112_0443708 3300048915 Bacteria 1236
694 Ga0496113_0211228 3300048916 Bacteria 1545
695 Ga0496115_0127872 3300048918 Bacteria 2093
696 Ga0496116_0007152 3300048919 Bacteria 9978
697 Ga0496116_0018273 3300048919 Bacteria 5411
698 Ga0496116_0107863 3300048919 Bacteria 1645
699 Ga0496117_0015679 3300048920 Bacteria 6438
700 Ga0496117_0125269 3300048920 Bacteria 1569
701 Ga0496117_0158666 3300048920 Bacteria 1328
702 Ga0496117_0161246 3300048920 Bacteria 1313
703 Ga0496117_0192158 3300048920 Bacteria 1161
704 Ga0496118_0084707 3300048921 Bacteria 2210
705 Ga0496118_0129543 3300048921 Bacteria 1624
706 Ga0496118_0137353 3300048921 Bacteria 1557
707 Ga0496118_0160634 3300048921 Bacteria 1390
708 Ga0496121_0001347 3300048924 Bacteria 41983
709 Ga0496121_0005663 3300048924 Bacteria 15890
710 Ga0496121_0021130 3300048924 Bacteria 6392
711 Ga0496121_0131136 3300048924 Bacteria 1875
712 Ga0496121_0166381 3300048924 Bacteria 1606
713 Ga0496121_0300164 3300048924 Bacteria 1090
714 Ga0496122_0000122 3300048925 Bacteria 181491
715 Ga0496122_0013387 3300048925 Bacteria 8032
716 Ga0496122_0088579 3300048925 Bacteria 2120
717 Ga0496122_0134936 3300048925 Bacteria 1558
718 Ga0496122_0140524 3300048925 Bacteria 1511
719 Ga0496123_0000173 3300048926 Bacteria 130586
720 Ga0496123_0003471 3300048926 Bacteria 17617
721 Ga0496123_0106867 3300048926 Bacteria 1611
722 Ga0496123_0147638 3300048926 Bacteria 1274
723 Ga0496124_0013401 3300048927 Bacteria 8003
724 Ga0496124_0016684 3300048927 Bacteria 6968
725 Ga0496124_0042813 3300048927 Bacteria 3895
726 Ga0496124_0156804 3300048927 Bacteria 1779
727 Ga0496124_0243608 3300048927 Bacteria 1335
728 Ga0496124_0310799 3300048927 Bacteria 1133
729 Ga0496125_0014045 3300048928 Bacteria 7828
730 Ga0496125_0189152 3300048928 Bacteria 1361
731 Ga0496126_0015765 3300048929 Bacteria 7593
732 Ga0496126_0163718 3300048929 Bacteria 1899
733 Ga0495678_000039 3300049459 Bacteria 191665
734 Ga0495678_001294 3300049459 Bacteria 20211
735 Ga0495678_003295 3300049459 Bacteria 10082
736 Ga0495678_003847 3300049459 Bacteria 9028
737 Ga0495678_005870 3300049459 Bacteria 6647
738 Ga0495678_010650 3300049459 Bacteria 4452
739 Ga0495678_010839 3300049459 Bacteria 4400
740 Ga0495678_013646 3300049459 Bacteria 3804
741 Ga0495678_017179 3300049459 Bacteria 3286
742 Ga0495678_042245 3300049459 Bacteria 1818
743 Ga0495678_045297 3300049459 Bacteria 1735
744 Ga0495678_072239 3300049459 Bacteria 1261
745 Ga0495678_081697 3300049459 Bacteria 1158
746 Ga0495678_089856 3300049459 Bacteria 1084
747 Ga0495682_0000939 3300049460 Bacteria 17669
748 Ga0495682_0001976 3300049460 Bacteria 10142
749 Ga0495682_0033251 3300049460 Bacteria 1903
750 Ga0495682_0036673 3300049460 Bacteria 1804
751 Ga0495682_0040160 3300049460 Bacteria 1716
752 Ga0495682_0049165 3300049460 Bacteria 1536
753 Ga0495682_0077167 3300049460 Bacteria 1198
754 Ga0495682_0083716 3300049460 Bacteria 1146
755 Ga0501034_0440559 3300049571 Bacteria 1221
756 Ga0501241_000622 3300049758 Bacteria 7604
757 nmdc:mga00v17_211889_c1 3300050491 Bacteria 1254
758 nmdc:mga00v17_62949_c1 3300050491 Bacteria 2283
759 nmdc:mga08x19_194913_c1 3300050514 Bacteria 1387
760 nmdc:mga08x19_437015_c1 3300050514 Bacteria 920
761 Ga0500572_003754 3300053111 Bacteria 3447
762 Ga0500621_111250 3300053126 Bacteria 1069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006946 Ga0079104_1000202 Ga0079104_100020249 233
2 3300006948 Ga0099826_10010237 Ga0099826_100102373 233
3 3300027111 Ga0209281_1000010 Ga0209281_1000010368 233
4 3300027666 Ga0209282_1011173 Ga0209282_10111736 233
5 3300009092 Ga0105250_10002032 Ga0105250_100020329 234
6 3300009092 Ga0105250_10050863 Ga0105250_100508632 234
7 3300025711 Ga0207696_1000262 Ga0207696_100026237 234
8 3300048925 Ga0496122_0140524 Ga0496122_0140524_107_826 234
9 3300048929 Ga0496126_0015765 Ga0496126_0015765_281_1000 234
10 3300009092 Ga0105250_10001943 Ga0105250_100019439 235
11 3300046452 Ga0495617_074023 Ga0495617_074023_42_749 235
12 3300046453 Ga0495627_001916 Ga0495627_001916_979_1686 235
13 3300046458 Ga0495591_003838 Ga0495591_003838_1050_1757 235
14 3300046471 Ga0495650_0066582 Ga0495650_0066582_321_1028 235
15 3300046491 Ga0495584_0021169 Ga0495584_0021169_2335_3042 235
16 3300046491 Ga0495584_0261664 Ga0495584_0261664_77_784 235
17 3300046499 Ga0495594_0383592 Ga0495594_0383592_78_785 235
18 3300046501 Ga0495607_0144548 Ga0495607_0144548_32_739 235
19 3300046507 Ga0495606_0036273 Ga0495606_0036273_2067_2774 235
20 3300046507 Ga0495606_0099057 Ga0495606_0099057_1057_1764 235
21 3300046513 Ga0495616_0044584 Ga0495616_0044584_514_1221 235
22 3300046515 Ga0495620_0022112 Ga0495620_0022112_1015_1722 235
23 3300046515 Ga0495620_0030421 Ga0495620_0030421_429_1136 235
24 3300046518 Ga0495631_0000832 Ga0495631_0000832_415_1122 235
25 3300046518 Ga0495631_0110800 Ga0495631_0110800_101_808 235
26 3300046520 Ga0495637_0018736 Ga0495637_0018736_1811_2518 235
27 3300046520 Ga0495637_0052040 Ga0495637_0052040_113_820 235
28 3300046520 Ga0495637_0053835 Ga0495637_0053835_564_1271 235
29 3300046522 Ga0495643_0027217 Ga0495643_0027217_2344_3051 235
30 3300046522 Ga0495643_0141203 Ga0495643_0141203_294_1001 235
31 3300046524 Ga0495648_0037358 Ga0495648_0037358_348_1055 235
32 3300046530 Ga0495654_0013833 Ga0495654_0013833_1010_1717 235
33 3300046530 Ga0495654_0054006 Ga0495654_0054006_64_771 235
34 3300046538 Ga0495609_0003111 Ga0495609_0003111_385_1092 235
35 3300046542 Ga0495597_0003143 Ga0495597_0003143_8790_9497 235
36 3300046543 Ga0495645_0180399 Ga0495645_0180399_182_889 235
37 3300046557 Ga0495622_0004312 Ga0495622_0004312_1065_1772 235
38 3300046558 Ga0495633_0047352 Ga0495633_0047352_660_1367 235
39 3300046616 Ga0495668_0132291 Ga0495668_0132291_342_1049 235
40 3300046648 Ga0495611_0114644 Ga0495611_0114644_251_958 235
41 3300046665 Ga0495661_0220671 Ga0495661_0220671_61_768 235
42 3300046694 Ga0495649_0012449 Ga0495649_0012449_3820_4527 235
43 3300046794 Ga0495589_0006467 Ga0495589_0006467_700_1407 235
44 3300046810 Ga0495660_0028507 Ga0495660_0028507_409_1116 235
45 3300047323 Ga0495683_0214865 Ga0495683_0214865_55_825 235
46 3300047469 Ga0495673_0007694 Ga0495673_0007694_410_1117 235
47 3300047470 Ga0495681_0021563 Ga0495681_0021563_2366_3073 235
48 3300047470 Ga0495681_0097270 Ga0495681_0097270_131_838 235
49 3300047472 Ga0495686_0015422 Ga0495686_0015422_4225_4932 235
50 3300048919 Ga0496116_0007152 Ga0496116_0007152_8927_9634 235
51 3300049459 Ga0495678_013646 Ga0495678_013646_1064_1771 235
52 3300049459 Ga0495678_017179 Ga0495678_017179_546_1253 235
53 3300049460 Ga0495682_0001976 Ga0495682_0001976_401_1108 235
54 3300053111 Ga0500572_003754 Ga0500572_003754_2357_3064 235
55 3300053126 Ga0500621_111250 Ga0500621_111250_320_1027 235
56 iso_pu_bacteria 2599185288 2599881941 235
57 iso_pu_bacteria 2619619299 2621297786 235
58 iso_pu_bacteria 2738541294 2738811277 235
59 iso_pu_bacteria 2738541309 2738898637 235
60 iso_pu_bacteria 2816332298 2817493080 235
61 3300025711 Ga0207696_1011704 Ga0207696_10117042 236
62 3300046501 Ga0495607_0022155 Ga0495607_0022155_790_1500 236
63 3300046519 Ga0495632_0006793 Ga0495632_0006793_4191_4901 236
64 3300047470 Ga0495681_0013339 Ga0495681_0013339_3374_4084 236
65 iso_pu_bacteria 2939651529 2939652569 236
66 3300049758 Ga0501241_000622 Ga0501241_000622_645_1388 237
67 iso_pu_bacteria 2597489889 2597871564 237
68 3300006058 Ga0075432_10000973 Ga0075432_100009737 238
69 3300006914 Ga0075436_100200424 Ga0075436_1002004242 238
70 3300013306 Ga0163162_10013597 Ga0163162_100135973 238
71 3300025728 Ga0207655_1003020 Ga0207655_10030209 238
72 3300025728 Ga0207655_1008932 Ga0207655_10089327 238
73 3300027907 Ga0207428_10126838 Ga0207428_101268382 238
74 3300046452 Ga0495617_021172 Ga0495617_021172_869_1612 238
75 3300046453 Ga0495627_004220 Ga0495627_004220_162_905 238
76 3300046460 Ga0495638_0011824 Ga0495638_0011824_46_789 238
77 3300046492 Ga0495585_0098297 Ga0495585_0098297_306_1049 238
78 3300046492 Ga0495585_0117769 Ga0495585_0117769_233_976 238
79 3300046513 Ga0495616_0009349 Ga0495616_0009349_4411_5154 238
80 3300046519 Ga0495632_0206515 Ga0495632_0206515_88_804 238
81 3300046520 Ga0495637_0005295 Ga0495637_0005295_474_1217 238
82 3300046523 Ga0495644_0004792 Ga0495644_0004792_585_1328 238
83 3300046524 Ga0495648_0090364 Ga0495648_0090364_147_890 238
84 3300046530 Ga0495654_0028533 Ga0495654_0028533_1323_2066 238
85 3300046542 Ga0495597_0005471 Ga0495597_0005471_5571_6314 238
86 3300046615 Ga0495656_0067617 Ga0495656_0067617_390_1133 238
87 3300046648 Ga0495611_0133952 Ga0495611_0133952_348_1091 238
88 3300046660 Ga0495625_0091124 Ga0495625_0091124_775_1518 238
89 3300046691 Ga0495670_0035278 Ga0495670_0035278_1149_1892 238
90 3300046810 Ga0495660_0007169 Ga0495660_0007169_5237_5980 238
91 3300047320 Ga0495672_0028751 Ga0495672_0028751_586_1329 238
92 3300047323 Ga0495683_0064564 Ga0495683_0064564_589_1332 238
93 3300047470 Ga0495681_0001323 Ga0495681_0001323_17484_18227 238
94 3300050514 nmdc:mga08x19_194913_c1 nmdc:mga08x19_194913_c1_396_1139 238
95 iso_pu_bacteria 2826581358 2826585580 238
96 iso_pu_bacteria 2842815866 2842818438 238
97 iso_pu_bacteria 2842849001 2842853138 238
98 3300013306 Ga0163162_10221852 Ga0163162_102218522 239
99 3300025735 Ga0207713_1003472 Ga0207713_10034729 239
100 3300031731 Ga0307405_10003042 Ga0307405_100030422 239
101 3300046460 Ga0495638_0034035 Ga0495638_0034035_286_1029 239
102 3300046501 Ga0495607_0007554 Ga0495607_0007554_956_1699 239
103 3300046518 Ga0495631_0070129 Ga0495631_0070129_377_1120 239
104 3300046519 Ga0495632_0029924 Ga0495632_0029924_65_808 239
105 3300046530 Ga0495654_0022379 Ga0495654_0022379_1792_2535 239
106 3300046542 Ga0495597_0053224 Ga0495597_0053224_694_1437 239
107 3300046660 Ga0495625_0032078 Ga0495625_0032078_482_1225 239
108 3300046691 Ga0495670_0099078 Ga0495670_0099078_368_1111 239
109 3300046694 Ga0495649_0123144 Ga0495649_0123144_506_1249 239
110 3300047446 Ga0495679_006716 Ga0495679_006716_289_1032 239
111 3300047470 Ga0495681_0015390 Ga0495681_0015390_2873_3616 239
112 3300048091 Ga0495626_0001825 Ga0495626_0001825_969_1712 239
113 3300049459 Ga0495678_081697 Ga0495678_081697_364_1107 239
114 3300006051 Ga0075364_10272050 Ga0075364_102720502 240
115 3300013105 Ga0157369_10027415 Ga0157369_100274152 240
116 3300031911 Ga0307412_10004116 Ga0307412_100041168 241
117 3300046458 Ga0495591_027519 Ga0495591_027519_836_1561 241
118 iso_pu_bacteria 3007619802 3007623323 241
119 iso_pu_bacteria 8055878733 8055883822 241
120 3300005290 Ga0065712_10000146 Ga0065712_1000014613 242
121 3300047320 Ga0495672_0008651 Ga0495672_0008651_272_1000 242
122 iso_pu_bacteria 2599185188 2599503495 242
123 iso_pu_bacteria 2599185300 2599929830 242
124 iso_pu_bacteria 2728369097 2729145010 242
125 iso_pu_bacteria 2791355520 2794595806 242
126 3300009011 Ga0105251_10008759 Ga0105251_100087592 243
127 3300046453 Ga0495627_001965 Ga0495627_001965_2599_3333 243
128 3300046471 Ga0495650_0042104 Ga0495650_0042104_505_1239 243
129 3300046474 Ga0495605_0000016 Ga0495605_0000016_48358_49092 243
130 3300046499 Ga0495594_0001938 Ga0495594_0001938_8359_9093 243
131 3300046501 Ga0495607_0074302 Ga0495607_0074302_389_1123 243
132 3300046506 Ga0495583_0000041 Ga0495583_0000041_185538_186272 243
133 3300046512 Ga0495610_0044936 Ga0495610_0044936_549_1283 243
134 3300046518 Ga0495631_0060172 Ga0495631_0060172_368_1102 243
135 3300046519 Ga0495632_0111801 Ga0495632_0111801_348_1079 243
136 3300046520 Ga0495637_0098747 Ga0495637_0098747_38_769 243
137 3300046530 Ga0495654_0004242 Ga0495654_0004242_789_1523 243
138 3300046538 Ga0495609_0000015 Ga0495609_0000015_136052_136786 243
139 3300046542 Ga0495597_0005662 Ga0495597_0005662_1029_1763 243
140 3300046558 Ga0495633_0000363 Ga0495633_0000363_16459_17190 243
141 3300046648 Ga0495611_0000710 Ga0495611_0000710_8679_9413 243
142 3300046691 Ga0495670_0186116 Ga0495670_0186116_262_996 243
143 3300046794 Ga0495589_0006345 Ga0495589_0006345_4699_5433 243
144 3300046810 Ga0495660_0002389 Ga0495660_0002389_392_1126 243
145 3300047323 Ga0495683_0000219 Ga0495683_0000219_31159_31890 243
146 3300047446 Ga0495679_000423 Ga0495679_000423_13885_14619 243
147 3300047470 Ga0495681_0046988 Ga0495681_0046988_1059_1793 243
148 3300048925 Ga0496122_0088579 Ga0496122_0088579_765_1499 243
149 3300048926 Ga0496123_0003471 Ga0496123_0003471_14732_15466 243
150 3300049459 Ga0495678_000039 Ga0495678_000039_1357_2091 243
151 iso_pu_bacteria 2511231006 2511269016 243
152 iso_pu_bacteria 2511231007 2511272216 243
153 iso_pu_bacteria 2511231008 2511280241 243
154 iso_pu_bacteria 2511231010 2511289248 243
155 iso_pu_bacteria 2511231012 2511303859 243
156 iso_pu_bacteria 2511231014 2511313472 243
157 iso_pu_bacteria 2511231015 2511317716 243
158 iso_pu_bacteria 2511231016 2511326096 243
159 iso_pu_bacteria 2511231017 2511332328 243
160 iso_pu_bacteria 2511231018 2511339918 243
161 iso_pu_bacteria 2511231019 2511342074 243
162 iso_pu_bacteria 2511231020 2511352813 243
163 iso_pu_bacteria 2511231021 2511355630 243
164 iso_pu_bacteria 2511231022 2511361813 243
165 iso_pu_bacteria 2511231031 2511414741 243
166 iso_pu_bacteria 2511231156 2511826539 243
167 iso_pu_bacteria 2582580891 2583794263 243
168 iso_pu_bacteria 2597489887 2597859851 243
169 iso_pu_bacteria 2599185185 2599482681 243
170 iso_pu_bacteria 2599185212 2599613360 243
171 iso_pu_bacteria 2599185248 2599771033 243
172 iso_pu_bacteria 2599185257 2599803597 243
173 iso_pu_bacteria 2599185289 2599886181 243
174 iso_pu_bacteria 2599185291 2599897896 243
175 iso_pu_bacteria 2599185302 2599945969 243
176 iso_pu_bacteria 2599185304 2599956869 243
177 iso_pu_bacteria 2599185305 2599960210 243
178 iso_pu_bacteria 2599185307 2599974806 243
179 iso_pu_bacteria 2599185309 2599983579 243
180 iso_pu_bacteria 2599185310 2599989986 243
181 iso_pu_bacteria 2599185311 2599995823 243
182 iso_pu_bacteria 2599185312 2600000464 243
183 iso_pu_bacteria 2599185313 2600005140 243
184 iso_pu_bacteria 2599185315 2600017710 243
185 iso_pu_bacteria 2599185318 2600033689 243
186 iso_pu_bacteria 2599185319 2600040019 243
187 iso_pu_bacteria 2599185320 2600047704 243
188 iso_pu_bacteria 2599185321 2600053559 243
189 iso_pu_bacteria 2599185322 2600058988 243
190 iso_pu_bacteria 2599185323 2600068231 243
191 iso_pu_bacteria 2599185324 2600070218 243
192 iso_pu_bacteria 2600254931 2600365137 243
193 iso_pu_bacteria 2600255283 2601625867 243
194 iso_pu_bacteria 2600255318 2601796775 243
195 iso_pu_bacteria 2603880185 2606073925 243
196 iso_pu_bacteria 2603880199 2606126430 243
197 iso_pu_bacteria 2623620443 2624482473 243
198 iso_pu_bacteria 2623620446 2624490496 243
199 iso_pu_bacteria 2643221565 2643841476 243
200 iso_pu_bacteria 2643221589 2643955278 243
201 iso_pu_bacteria 2643221602 2644023630 243
202 iso_pu_bacteria 2643221633 2644187075 243
203 iso_pu_bacteria 2651869719 2652544981 243
204 iso_pu_bacteria 2667528170 2671089989 243
205 iso_pu_bacteria 2671180172 2671770835 243
206 iso_pu_bacteria 2675903515 2678264880 243
207 iso_pu_bacteria 2713897148 2715750467 243
208 iso_pu_bacteria 2713897149 2715755133 243
209 iso_pu_bacteria 2718217725 2718635676 243
210 iso_pu_bacteria 2738541271 2738689610 243
211 iso_pu_bacteria 2738543004 2739196628 243
212 iso_pu_bacteria 2738543015 2739257608 243
213 iso_pu_bacteria 2738543016 2739265384 243
214 iso_pu_bacteria 2738543025 2739313534 243
215 iso_pu_bacteria 2740892503 2743739393 243
216 iso_pu_bacteria 2744054620 2745005336 243
217 iso_pu_bacteria 2773857670 2774122956 243
218 iso_pu_bacteria 2784132072 2784315314 243
219 iso_pu_bacteria 2808606361 2808854682 243
220 iso_pu_bacteria 2808606376 2808921675 243
221 iso_pu_bacteria 2808606377 2808930496 243
222 iso_pu_bacteria 2808606378 2808934790 243
223 iso_pu_bacteria 2808606380 2808943796 243
224 iso_pu_bacteria 2808606381 2808952618 243
225 iso_pu_bacteria 2808606382 2808961516 243
226 iso_pu_bacteria 2808606383 2808963187 243
227 iso_pu_bacteria 2808606389 2808998075 243
228 iso_pu_bacteria 2842832357 2842837328 243
229 iso_pu_bacteria 2842843487 2842845120 243
230 iso_pu_bacteria 2842854478 2842856625 243
231 iso_pu_bacteria 2860339153 2860341324 243
232 iso_pu_bacteria 2878029506 2878034401 243
233 iso_pu_bacteria 2904550169 2904555746 243
234 iso_pu_bacteria 2913036834 2913041481 243
235 iso_pu_bacteria 2919063839 2919066539 243
236 iso_pu_bacteria 2919385768 2919388473 243
237 iso_pu_bacteria 2919456309 2919459424 243
238 iso_pu_bacteria 2919481497 2919484414 243
239 iso_pu_bacteria 2919487758 2919490208 243
240 iso_pu_bacteria 2919697872 2919701691 243
241 iso_pu_bacteria 2923153595 2923158478 243
242 iso_pu_bacteria 2929144301 2929148819 243
243 iso_pu_bacteria 2931396565 2931397062 243
244 iso_pu_bacteria 2939636861 2939637094 243
245 iso_pu_bacteria 2945961074 2945965665 243
246 iso_pu_bacteria 2969304461 2969309177 243
247 iso_pu_bacteria 2974289157 2974289454 243
248 iso_pu_bacteria 2984286254 2984287692 243
249 iso_pu_bacteria 2988728565 2988730397 243
250 iso_pu_bacteria 2998139840 2998144461 243
251 iso_pu_bacteria 3007395558 3007398097 243
252 iso_pu_bacteria 3007511990 3007516253 243
253 iso_pu_bacteria 3007861166 3007865916 243
254 iso_pu_bacteria 3007866637 3007867835 243
255 iso_pu_bacteria 8015687852 8015692567 243
256 iso_pu_bacteria 8019775933 8019780823 243
257 iso_pu_bacteria 8029995093 8029996419 243
258 iso_pu_bacteria 8055770955 8055775799 243
259 iso_pu_bacteria 8056125926 8056130749 243
260 iso_pu_bacteria 8056143049 8056144579 243
261 iso_pu_bacteria 8056155041 8056155440 243
262 iso_pu_bacteria 8056166840 8056172112 243
263 iso_pu_bacteria 8056172158 8056172785 243
264 iso_pu_bacteria 8056177738 8056183363 243
265 iso_pu_bacteria 8056569372 8056572541 243
266 3300009011 Ga0105251_10000030 Ga0105251_1000003086 244
267 3300009092 Ga0105250_10001976 Ga0105250_100019764 244
268 3300025711 Ga0207696_1000054 Ga0207696_1000054109 244
269 3300025735 Ga0207713_1000013 Ga0207713_1000013404 244
270 3300042876 Ga0451577_0237311 Ga0451577_0237311_221_973 245
271 3300046458 Ga0495591_037570 Ga0495591_037570_126_863 245
272 3300046501 Ga0495607_0075331 Ga0495607_0075331_391_1128 245
273 3300046515 Ga0495620_0118290 Ga0495620_0118290_17_754 245
274 3300046522 Ga0495643_0093266 Ga0495643_0093266_446_1183 245
275 3300046542 Ga0495597_0052718 Ga0495597_0052718_987_1724 245
276 3300046665 Ga0495661_0114646 Ga0495661_0114646_682_1419 245
277 3300046694 Ga0495649_0095953 Ga0495649_0095953_484_1221 245
278 3300046810 Ga0495660_0153374 Ga0495660_0153374_299_1036 245
279 3300047320 Ga0495672_0113469 Ga0495672_0113469_535_1272 245
280 3300047470 Ga0495681_0055864 Ga0495681_0055864_853_1590 245
281 3300047472 Ga0495686_0116418 Ga0495686_0116418_808_1545 245
282 3300049459 Ga0495678_010839 Ga0495678_010839_104_841 245
283 3300049571 Ga0501034_0440559 Ga0501034_0440559_239_988 245
284 3300013307 Ga0157372_10030668 Ga0157372_100306682 246
285 3300025728 Ga0207655_1000732 Ga0207655_10007329 246
286 3300041405 Ga0439438_001992 Ga0439438_001992_3964_4713 246
287 2124908027 MRS2a_Contig_6772 MRS2a_00629420 247
288 3300003781 Ga0055536_1000960 Ga0055536_10009602 247
289 3300003781 Ga0055536_1001207 Ga0055536_100120713 247
290 3300003791 Ga0055530_10001329 Ga0055530_1000132914 247
291 3300003791 Ga0055530_10001466 Ga0055530_100014662 247
292 3300003792 Ga0055540_1000973 Ga0055540_10009732 247
293 3300003792 Ga0055540_1001042 Ga0055540_100104214 247
294 3300003794 Ga0055531_10000306 Ga0055531_100003069 247
295 3300005288 Ga0065714_10093695 Ga0065714_100936952 247
296 3300005290 Ga0065712_10005016 Ga0065712_100050162 247
297 3300005293 Ga0065715_10000740 Ga0065715_100007407 247
298 3300005353 Ga0070669_100003291 Ga0070669_1000032912 247
299 3300006051 Ga0075364_10209571 Ga0075364_102095712 247
300 3300006058 Ga0075432_10006156 Ga0075432_100061562 247
301 3300006177 Ga0075362_10081236 Ga0075362_100812362 247
302 3300006914 Ga0075436_100144212 Ga0075436_1001442122 247
303 3300006946 Ga0079104_1001055 Ga0079104_100105517 247
304 3300009011 Ga0105251_10000635 Ga0105251_1000063527 247
305 3300009011 Ga0105251_10021524 Ga0105251_100215242 247
306 3300009011 Ga0105251_10029249 Ga0105251_100292492 247
307 3300009011 Ga0105251_10031851 Ga0105251_100318512 247
308 3300009011 Ga0105251_10108727 Ga0105251_101087272 247
309 3300009036 Ga0105244_10001778 Ga0105244_1000177814 247
310 3300009036 Ga0105244_10003010 Ga0105244_1000301010 247
311 3300009036 Ga0105244_10030448 Ga0105244_100304482 247
312 3300009036 Ga0105244_10032158 Ga0105244_100321582 247
313 3300009036 Ga0105244_10058966 Ga0105244_100589662 247
314 3300009036 Ga0105244_10112320 Ga0105244_101123201 247
315 3300009036 Ga0105244_10170792 Ga0105244_101707922 247
316 3300009092 Ga0105250_10003298 Ga0105250_100032982 247
317 3300009092 Ga0105250_10060055 Ga0105250_100600552 247
318 3300009092 Ga0105250_10141510 Ga0105250_101415101 247
319 3300009092 Ga0105250_10141597 Ga0105250_101415972 247
320 3300009148 Ga0105243_10000383 Ga0105243_1000038343 247
321 3300009148 Ga0105243_10133735 Ga0105243_101337351 247
322 3300009148 Ga0105243_10827181 Ga0105243_108271811 247
323 3300011119 Ga0105246_10001503 Ga0105246_100015032 247
324 3300011119 Ga0105246_10195991 Ga0105246_101959911 247
325 3300012498 Ga0157345_1000199 Ga0157345_10001993 247
326 3300013100 Ga0157373_10004528 Ga0157373_100045282 247
327 3300013100 Ga0157373_10025541 Ga0157373_100255412 247
328 3300013100 Ga0157373_10145676 Ga0157373_101456762 247
329 3300013102 Ga0157371_10002919 Ga0157371_100029192 247
330 3300013104 Ga0157370_10011460 Ga0157370_100114607 247
331 3300013104 Ga0157370_10041762 Ga0157370_100417624 247
332 3300013104 Ga0157370_10231427 Ga0157370_102314272 247
333 3300013104 Ga0157370_10275116 Ga0157370_102751162 247
334 3300013104 Ga0157370_10366554 Ga0157370_103665542 247
335 3300013104 Ga0157370_10596002 Ga0157370_105960021 247
336 3300013105 Ga0157369_10022969 Ga0157369_100229692 247
337 3300013105 Ga0157369_10528970 Ga0157369_105289702 247
338 3300013306 Ga0163162_10087354 Ga0163162_100873542 247
339 3300013306 Ga0163162_10608936 Ga0163162_106089361 247
340 3300013308 Ga0157375_10249515 Ga0157375_102495152 247
341 3300014497 Ga0182008_10013720 Ga0182008_100137205 247
342 3300015261 Ga0182006_1002939 Ga0182006_10029392 247
343 3300015261 Ga0182006_1010929 Ga0182006_10109294 247
344 3300015261 Ga0182006_1029385 Ga0182006_10293851 247
345 3300015261 Ga0182006_1052876 Ga0182006_10528762 247
346 3300015262 Ga0182007_10011362 Ga0182007_100113622 247
347 3300015262 Ga0182007_10035780 Ga0182007_100357801 247
348 3300015265 Ga0182005_1005466 Ga0182005_10054664 247
349 3300015265 Ga0182005_1012758 Ga0182005_10127581 247
350 3300015265 Ga0182005_1028085 Ga0182005_10280852 247
351 3300017792 Ga0163161_10004825 Ga0163161_100048252 247
352 3300017792 Ga0163161_10008092 Ga0163161_100080922 247
353 3300017792 Ga0163161_10058980 Ga0163161_100589802 247
354 3300017792 Ga0163161_10063798 Ga0163161_100637981 247
355 3300017792 Ga0163161_10377106 Ga0163161_103771062 247
356 3300025292 Ga0209676_1000006 Ga0209676_1000006604 247
357 3300025292 Ga0209676_1000010 Ga0209676_1000010606 247
358 3300025292 Ga0209676_1000834 Ga0209676_100083434 247
359 3300025298 Ga0209050_1000019 Ga0209050_1000019256 247
360 3300025298 Ga0209050_1000065 Ga0209050_100006586 247
361 3300025298 Ga0209050_1002317 Ga0209050_10023172 247
362 3300025303 Ga0209051_1000138 Ga0209051_100013899 247
363 3300025303 Ga0209051_1000189 Ga0209051_100018986 247
364 3300025303 Ga0209051_1006605 Ga0209051_10066052 247
365 3300025304 Ga0209257_1000119 Ga0209257_100011911 247
366 3300025711 Ga0207696_1001124 Ga0207696_100112412 247
367 3300025711 Ga0207696_1006571 Ga0207696_10065714 247
368 3300025711 Ga0207696_1010846 Ga0207696_10108462 247
369 3300025711 Ga0207696_1038261 Ga0207696_10382612 247
370 3300025711 Ga0207696_1046875 Ga0207696_10468752 247
371 3300025728 Ga0207655_1000717 Ga0207655_100071714 247
372 3300025728 Ga0207655_1001535 Ga0207655_100153516 247
373 3300025728 Ga0207655_1005755 Ga0207655_10057552 247
374 3300025728 Ga0207655_1020511 Ga0207655_10205111 247
375 3300025728 Ga0207655_1021503 Ga0207655_10215033 247
376 3300025728 Ga0207655_1039182 Ga0207655_10391822 247
377 3300025728 Ga0207655_1053407 Ga0207655_10534072 247
378 3300025728 Ga0207655_1091840 Ga0207655_10918401 247
379 3300025735 Ga0207713_1000068 Ga0207713_100006827 247
380 3300025735 Ga0207713_1001333 Ga0207713_10013332 247
381 3300025735 Ga0207713_1001372 Ga0207713_100137214 247
382 3300025735 Ga0207713_1006811 Ga0207713_10068117 247
383 3300025735 Ga0207713_1010339 Ga0207713_10103394 247
384 3300025735 Ga0207713_1022941 Ga0207713_10229413 247
385 3300025735 Ga0207713_1036588 Ga0207713_10365882 247
386 3300025735 Ga0207713_1043769 Ga0207713_10437693 247
387 3300025923 Ga0207681_10080745 Ga0207681_100807452 247
388 3300025935 Ga0207709_10000013 Ga0207709_10000013340 247
389 3300027111 Ga0209281_1000049 Ga0209281_1000049196 247
390 3300027111 Ga0209281_1005237 Ga0209281_10052372 247
391 3300027907 Ga0207428_10095216 Ga0207428_100952161 247
392 3300028379 Ga0268266_10048169 Ga0268266_100481693 247
393 3300031548 Ga0307408_100195644 Ga0307408_1001956442 247
394 3300031911 Ga0307412_10133987 Ga0307412_101339871 247
395 3300031911 Ga0307412_10378431 Ga0307412_103784311 247
396 3300032002 Ga0307416_100431155 Ga0307416_1004311551 247
397 3300032004 Ga0307414_10815796 Ga0307414_108157961 247
398 3300033180 Ga0307510_10043502 Ga0307510_100435022 247
399 3300038705 Ga0237819_01512 Ga0237819_01512_209_952 247
400 3300041405 Ga0439438_002757 Ga0439438_002757_5933_6676 247
401 3300041405 Ga0439438_004017 Ga0439438_004017_4537_5280 247
402 3300041405 Ga0439438_005749 Ga0439438_005749_443_1186 247
403 3300041405 Ga0439438_048483 Ga0439438_048483_94_837 247
404 3300041407 Ga0439447_006849 Ga0439447_006849_374_1117 247
405 3300041407 Ga0439447_021899 Ga0439447_021899_585_1328 247
406 3300041411 Ga0439466_0002237 Ga0439466_0002237_942_1685 247
407 3300041411 Ga0439466_0003622 Ga0439466_0003622_226_969 247
408 3300041411 Ga0439466_0008301 Ga0439466_0008301_2902_3645 247
409 3300042009 Ga0439451_003387 Ga0439451_003387_47_790 247
410 3300042009 Ga0439451_020673 Ga0439451_020673_289_1032 247
411 3300042010 Ga0439452_000638 Ga0439452_000638_946_1689 247
412 3300042010 Ga0439452_016838 Ga0439452_016838_272_1015 247
413 3300042010 Ga0439452_026788 Ga0439452_026788_301_1044 247
414 3300042013 Ga0439456_002456 Ga0439456_002456_247_1002 247
415 3300042013 Ga0439456_038469 Ga0439456_038469_184_927 247
416 3300042013 Ga0439456_049866 Ga0439456_049866_97_840 247
417 3300042016 Ga0439463_001065 Ga0439463_001065_5659_6402 247
418 3300042016 Ga0439463_001559 Ga0439463_001559_2161_2904 247
419 3300042016 Ga0439463_032121 Ga0439463_032121_100_843 247
420 3300042115 Ga0450911_005846 Ga0450911_005846_755_1498 247
421 3300042115 Ga0450911_008992 Ga0450911_008992_590_1333 247
422 3300042122 Ga0450920_012685 Ga0450920_012685_472_1215 247
423 3300042123 Ga0450921_001655 Ga0450921_001655_63_806 247
424 3300042124 Ga0450922_001855 Ga0450922_001855_919_1662 247
425 3300042137 Ga0450902_023188 Ga0450902_023188_12_755 247
426 3300042138 Ga0450903_000933 Ga0450903_000933_282_1025 247
427 3300042138 Ga0450903_006674 Ga0450903_006674_374_1129 247
428 3300042142 Ga0450905_009671 Ga0450905_009671_408_1151 247
429 3300042145 Ga0450906_002896 Ga0450906_002896_235_990 247
430 3300042146 Ga0450907_000325 Ga0450907_000325_224_967 247
431 3300042184 Ga0450908_002424 Ga0450908_002424_2701_3456 247
432 3300042184 Ga0450908_005137 Ga0450908_005137_387_1130 247
433 3300042184 Ga0450908_017674 Ga0450908_017674_346_1089 247
434 3300042185 Ga0450909_000454 Ga0450909_000454_172_915 247
435 3300042435 Ga0439434_0002478 Ga0439434_0002478_194_937 247
436 3300042461 Ga0439460_0001511 Ga0439460_0001511_4506_5249 247
437 3300042993 Ga0439440_0014497 Ga0439440_0014497_452_1195 247
438 3300042993 Ga0439440_0016703 Ga0439440_0016703_644_1387 247
439 3300042993 Ga0439440_0037981 Ga0439440_0037981_292_1035 247
440 3300046452 Ga0495617_002793 Ga0495617_002793_5877_6620 247
441 3300046452 Ga0495617_011163 Ga0495617_011163_1622_2365 247
442 3300046452 Ga0495617_030954 Ga0495617_030954_717_1460 247
443 3300046452 Ga0495617_048563 Ga0495617_048563_26_769 247
444 3300046452 Ga0495617_062780 Ga0495617_062780_306_1058 247
445 3300046452 Ga0495617_077491 Ga0495617_077491_247_990 247
446 3300046452 Ga0495617_107844 Ga0495617_107844_41_784 247
447 3300046453 Ga0495627_002427 Ga0495627_002427_7048_7791 247
448 3300046453 Ga0495627_003464 Ga0495627_003464_359_1108 247
449 3300046453 Ga0495627_030489 Ga0495627_030489_412_1155 247
450 3300046455 Ga0495603_0050979 Ga0495603_0050979_44_787 247
451 3300046455 Ga0495603_0154618 Ga0495603_0154618_192_935 247
452 3300046455 Ga0495603_0178633 Ga0495603_0178633_132_875 247
453 3300046457 Ga0495590_0001520 Ga0495590_0001520_8889_9632 247
454 3300046457 Ga0495590_0003210 Ga0495590_0003210_5886_6629 247
455 3300046457 Ga0495590_0006548 Ga0495590_0006548_209_952 247
456 3300046457 Ga0495590_0028505 Ga0495590_0028505_390_1133 247
457 3300046457 Ga0495590_0044254 Ga0495590_0044254_494_1237 247
458 3300046458 Ga0495591_000243 Ga0495591_000243_50689_51432 247
459 3300046458 Ga0495591_000823 Ga0495591_000823_20396_21139 247
460 3300046458 Ga0495591_004916 Ga0495591_004916_4288_5031 247
461 3300046458 Ga0495591_005719 Ga0495591_005719_250_993 247
462 3300046458 Ga0495591_008317 Ga0495591_008317_399_1142 247
463 3300046458 Ga0495591_023692 Ga0495591_023692_338_1081 247
464 3300046458 Ga0495591_025094 Ga0495591_025094_1109_1852 247
465 3300046458 Ga0495591_027119 Ga0495591_027119_411_1154 247
466 3300046458 Ga0495591_029374 Ga0495591_029374_247_990 247
467 3300046458 Ga0495591_055606 Ga0495591_055606_40_783 247
468 3300046459 Ga0495629_0316508 Ga0495629_0316508_82_825 247
469 3300046460 Ga0495638_0009223 Ga0495638_0009223_557_1300 247
470 3300046460 Ga0495638_0010052 Ga0495638_0010052_380_1123 247
471 3300046460 Ga0495638_0016148 Ga0495638_0016148_17_760 247
472 3300046460 Ga0495638_0021994 Ga0495638_0021994_241_984 247
473 3300046460 Ga0495638_0035798 Ga0495638_0035798_2044_2787 247
474 3300046460 Ga0495638_0066794 Ga0495638_0066794_705_1448 247
475 3300046460 Ga0495638_0122555 Ga0495638_0122555_668_1411 247
476 3300046460 Ga0495638_0127509 Ga0495638_0127509_414_1157 247
477 3300046460 Ga0495638_0155298 Ga0495638_0155298_339_1082 247
478 3300046463 Ga0495653_0022555 Ga0495653_0022555_310_1053 247
479 3300046463 Ga0495653_0038792 Ga0495653_0038792_602_1345 247
480 3300046471 Ga0495650_0040914 Ga0495650_0040914_121_864 247
481 3300046471 Ga0495650_0043304 Ga0495650_0043304_769_1512 247
482 3300046471 Ga0495650_0053872 Ga0495650_0053872_399_1142 247
483 3300046471 Ga0495650_0062131 Ga0495650_0062131_152_895 247
484 3300046471 Ga0495650_0156876 Ga0495650_0156876_41_784 247
485 3300046474 Ga0495605_0000299 Ga0495605_0000299_19350_20093 247
486 3300046474 Ga0495605_0004377 Ga0495605_0004377_645_1388 247
487 3300046474 Ga0495605_0020938 Ga0495605_0020938_2552_3295 247
488 3300046474 Ga0495605_0029776 Ga0495605_0029776_1869_2612 247
489 3300046474 Ga0495605_0040477 Ga0495605_0040477_347_1090 247
490 3300046474 Ga0495605_0055453 Ga0495605_0055453_886_1629 247
491 3300046474 Ga0495605_0071971 Ga0495605_0071971_722_1465 247
492 3300046474 Ga0495605_0081814 Ga0495605_0081814_675_1466 247
493 3300046474 Ga0495605_0127698 Ga0495605_0127698_302_1045 247
494 3300046475 Ga0495639_0002146 Ga0495639_0002146_7013_7756 247
495 3300046475 Ga0495639_0115282 Ga0495639_0115282_524_1267 247
496 3300046475 Ga0495639_0275231 Ga0495639_0275231_16_759 247
497 3300046491 Ga0495584_0012018 Ga0495584_0012018_177_920 247
498 3300046491 Ga0495584_0133536 Ga0495584_0133536_183_926 247
499 3300046491 Ga0495584_0157913 Ga0495584_0157913_304_1047 247
500 3300046491 Ga0495584_0262140 Ga0495584_0262140_85_828 247
501 3300046492 Ga0495585_0000818 Ga0495585_0000818_11158_11901 247
502 3300046492 Ga0495585_0004146 Ga0495585_0004146_590_1333 247
503 3300046492 Ga0495585_0005457 Ga0495585_0005457_352_1095 247
504 3300046492 Ga0495585_0006394 Ga0495585_0006394_941_1684 247
505 3300046492 Ga0495585_0008829 Ga0495585_0008829_4927_5670 247
506 3300046492 Ga0495585_0010852 Ga0495585_0010852_4422_5165 247
507 3300046492 Ga0495585_0020534 Ga0495585_0020534_2716_3459 247
508 3300046492 Ga0495585_0078937 Ga0495585_0078937_442_1185 247
509 3300046492 Ga0495585_0101793 Ga0495585_0101793_698_1441 247
510 3300046492 Ga0495585_0123745 Ga0495585_0123745_456_1199 247
511 3300046492 Ga0495585_0130622 Ga0495585_0130622_348_1091 247
512 3300046492 Ga0495585_0192222 Ga0495585_0192222_80_823 247
513 3300046499 Ga0495594_0017458 Ga0495594_0017458_2662_3405 247
514 3300046499 Ga0495594_0046137 Ga0495594_0046137_1366_2109 247
515 3300046499 Ga0495594_0060717 Ga0495594_0060717_392_1135 247
516 3300046500 Ga0495596_0000803 Ga0495596_0000803_295_1038 247
517 3300046500 Ga0495596_0005778 Ga0495596_0005778_4014_4757 247
518 3300046500 Ga0495596_0007475 Ga0495596_0007475_1690_2481 247
519 3300046501 Ga0495607_0000216 Ga0495607_0000216_15973_16716 247
520 3300046501 Ga0495607_0003264 Ga0495607_0003264_11366_12109 247
521 3300046501 Ga0495607_0006299 Ga0495607_0006299_343_1086 247
522 3300046501 Ga0495607_0010318 Ga0495607_0010318_3736_4479 247
523 3300046501 Ga0495607_0015041 Ga0495607_0015041_1423_2166 247
524 3300046501 Ga0495607_0015584 Ga0495607_0015584_3133_3876 247
525 3300046501 Ga0495607_0018931 Ga0495607_0018931_1651_2394 247
526 3300046501 Ga0495607_0023891 Ga0495607_0023891_2725_3468 247
527 3300046501 Ga0495607_0044365 Ga0495607_0044365_134_877 247
528 3300046501 Ga0495607_0077573 Ga0495607_0077573_968_1711 247
529 3300046501 Ga0495607_0079753 Ga0495607_0079753_391_1134 247
530 3300046501 Ga0495607_0092184 Ga0495607_0092184_686_1429 247
531 3300046501 Ga0495607_0110149 Ga0495607_0110149_445_1188 247
532 3300046501 Ga0495607_0164090 Ga0495607_0164090_297_1040 247
533 3300046506 Ga0495583_0002133 Ga0495583_0002133_16658_17401 247
534 3300046506 Ga0495583_0003693 Ga0495583_0003693_1569_2312 247
535 3300046506 Ga0495583_0005221 Ga0495583_0005221_358_1101 247
536 3300046506 Ga0495583_0006524 Ga0495583_0006524_991_1734 247
537 3300046506 Ga0495583_0010699 Ga0495583_0010699_251_994 247
538 3300046506 Ga0495583_0023117 Ga0495583_0023117_360_1103 247
539 3300046506 Ga0495583_0045877 Ga0495583_0045877_273_1016 247
540 3300046506 Ga0495583_0101271 Ga0495583_0101271_465_1208 247
541 3300046507 Ga0495606_0000055 Ga0495606_0000055_38264_39055 247
542 3300046507 Ga0495606_0000695 Ga0495606_0000695_49135_49878 247
543 3300046507 Ga0495606_0010766 Ga0495606_0010766_313_1056 247
544 3300046507 Ga0495606_0038714 Ga0495606_0038714_2115_2858 247
545 3300046507 Ga0495606_0069669 Ga0495606_0069669_794_1537 247
546 3300046507 Ga0495606_0190331 Ga0495606_0190331_288_1031 247
547 3300046507 Ga0495606_0196159 Ga0495606_0196159_199_942 247
548 3300046507 Ga0495606_0239194 Ga0495606_0239194_77_820 247
549 3300046512 Ga0495610_0006987 Ga0495610_0006987_67_810 247
550 3300046512 Ga0495610_0008069 Ga0495610_0008069_319_1062 247
551 3300046512 Ga0495610_0009591 Ga0495610_0009591_5133_5876 247
552 3300046512 Ga0495610_0010333 Ga0495610_0010333_3072_3815 247
553 3300046512 Ga0495610_0029122 Ga0495610_0029122_548_1291 247
554 3300046512 Ga0495610_0057120 Ga0495610_0057120_206_949 247
555 3300046512 Ga0495610_0111878 Ga0495610_0111878_238_1011 247
556 3300046512 Ga0495610_0126793 Ga0495610_0126793_324_1067 247
557 3300046513 Ga0495616_0019674 Ga0495616_0019674_496_1239 247
558 3300046513 Ga0495616_0029448 Ga0495616_0029448_2124_2867 247
559 3300046513 Ga0495616_0057385 Ga0495616_0057385_366_1109 247
560 3300046513 Ga0495616_0066296 Ga0495616_0066296_312_1055 247
561 3300046513 Ga0495616_0086420 Ga0495616_0086420_510_1253 247
562 3300046513 Ga0495616_0205530 Ga0495616_0205530_104_847 247
563 3300046515 Ga0495620_0002626 Ga0495620_0002626_7837_8580 247
564 3300046515 Ga0495620_0003715 Ga0495620_0003715_361_1104 247
565 3300046515 Ga0495620_0008220 Ga0495620_0008220_4605_5348 247
566 3300046515 Ga0495620_0014838 Ga0495620_0014838_230_973 247
567 3300046515 Ga0495620_0031159 Ga0495620_0031159_757_1548 247
568 3300046515 Ga0495620_0069165 Ga0495620_0069165_313_1056 247
569 3300046515 Ga0495620_0085112 Ga0495620_0085112_107_850 247
570 3300046515 Ga0495620_0090326 Ga0495620_0090326_316_1059 247
571 3300046517 Ga0495630_0101156 Ga0495630_0101156_305_1048 247
572 3300046517 Ga0495630_0129847 Ga0495630_0129847_862_1605 247
573 3300046517 Ga0495630_0325339 Ga0495630_0325339_178_921 247
574 3300046518 Ga0495631_0001817 Ga0495631_0001817_347_1090 247
575 3300046518 Ga0495631_0002480 Ga0495631_0002480_9382_10131 247
576 3300046518 Ga0495631_0002614 Ga0495631_0002614_6576_7319 247
577 3300046518 Ga0495631_0049924 Ga0495631_0049924_376_1119 247
578 3300046518 Ga0495631_0096204 Ga0495631_0096204_218_961 247
579 3300046519 Ga0495632_0003261 Ga0495632_0003261_10570_11313 247
580 3300046519 Ga0495632_0006728 Ga0495632_0006728_6236_6979 247
581 3300046519 Ga0495632_0009991 Ga0495632_0009991_4559_5302 247
582 3300046519 Ga0495632_0014173 Ga0495632_0014173_1053_1796 247
583 3300046519 Ga0495632_0063058 Ga0495632_0063058_610_1401 247
584 3300046519 Ga0495632_0089054 Ga0495632_0089054_92_835 247
585 3300046519 Ga0495632_0089439 Ga0495632_0089439_415_1164 247
586 3300046519 Ga0495632_0091721 Ga0495632_0091721_103_846 247
587 3300046519 Ga0495632_0108494 Ga0495632_0108494_215_967 247
588 3300046519 Ga0495632_0109103 Ga0495632_0109103_220_963 247
589 3300046519 Ga0495632_0111279 Ga0495632_0111279_314_1057 247
590 3300046519 Ga0495632_0171483 Ga0495632_0171483_207_950 247
591 3300046520 Ga0495637_0000312 Ga0495637_0000312_17728_18471 247
592 3300046520 Ga0495637_0000542 Ga0495637_0000542_17224_17967 247
593 3300046520 Ga0495637_0000800 Ga0495637_0000800_19233_19976 247
594 3300046520 Ga0495637_0005063 Ga0495637_0005063_5685_6428 247
595 3300046520 Ga0495637_0007361 Ga0495637_0007361_4397_5140 247
596 3300046520 Ga0495637_0008093 Ga0495637_0008093_511_1284 247
597 3300046520 Ga0495637_0009686 Ga0495637_0009686_2725_3468 247
598 3300046520 Ga0495637_0018548 Ga0495637_0018548_2163_2906 247
599 3300046520 Ga0495637_0025906 Ga0495637_0025906_544_1287 247
600 3300046520 Ga0495637_0026975 Ga0495637_0026975_500_1243 247
601 3300046520 Ga0495637_0047072 Ga0495637_0047072_717_1460 247
602 3300046520 Ga0495637_0059651 Ga0495637_0059651_222_965 247
603 3300046520 Ga0495637_0110395 Ga0495637_0110395_91_834 247
604 3300046522 Ga0495643_0006458 Ga0495643_0006458_299_1042 247
605 3300046522 Ga0495643_0023441 Ga0495643_0023441_2468_3211 247
606 3300046522 Ga0495643_0039227 Ga0495643_0039227_44_835 247
607 3300046522 Ga0495643_0172641 Ga0495643_0172641_289_1032 247
608 3300046522 Ga0495643_0237564 Ga0495643_0237564_87_830 247
609 3300046523 Ga0495644_0001295 Ga0495644_0001295_9105_9848 247
610 3300046523 Ga0495644_0003557 Ga0495644_0003557_300_1043 247
611 3300046523 Ga0495644_0010818 Ga0495644_0010818_74_817 247
612 3300046523 Ga0495644_0011318 Ga0495644_0011318_2357_3100 247
613 3300046523 Ga0495644_0047566 Ga0495644_0047566_206_949 247
614 3300046523 Ga0495644_0058076 Ga0495644_0058076_396_1139 247
615 3300046523 Ga0495644_0108957 Ga0495644_0108957_248_991 247
616 3300046523 Ga0495644_0142871 Ga0495644_0142871_156_899 247
617 3300046524 Ga0495648_0002206 Ga0495648_0002206_17202_17945 247
618 3300046524 Ga0495648_0007908 Ga0495648_0007908_267_1010 247
619 3300046524 Ga0495648_0008330 Ga0495648_0008330_6537_7322 247
620 3300046524 Ga0495648_0016740 Ga0495648_0016740_35_778 247
621 3300046524 Ga0495648_0019143 Ga0495648_0019143_3646_4389 247
622 3300046524 Ga0495648_0019291 Ga0495648_0019291_704_1447 247
623 3300046524 Ga0495648_0083220 Ga0495648_0083220_117_860 247
624 3300046524 Ga0495648_0153746 Ga0495648_0153746_144_887 247
625 3300046524 Ga0495648_0222947 Ga0495648_0222947_108_851 247
626 3300046526 Ga0495666_0007285 Ga0495666_0007285_463_1206 247
627 3300046526 Ga0495666_0051056 Ga0495666_0051056_312_1055 247
628 3300046526 Ga0495666_0143822 Ga0495666_0143822_66_809 247
629 3300046526 Ga0495666_0158747 Ga0495666_0158747_110_853 247
630 3300046528 Ga0495642_0000644 Ga0495642_0000644_16425_17168 247
631 3300046528 Ga0495642_0001839 Ga0495642_0001839_342_1085 247
632 3300046530 Ga0495654_0004478 Ga0495654_0004478_7000_7743 247
633 3300046530 Ga0495654_0006111 Ga0495654_0006111_5664_6407 247
634 3300046530 Ga0495654_0009155 Ga0495654_0009155_320_1069 247
635 3300046530 Ga0495654_0010407 Ga0495654_0010407_2380_3171 247
636 3300046530 Ga0495654_0017468 Ga0495654_0017468_2725_3468 247
637 3300046530 Ga0495654_0020333 Ga0495654_0020333_2415_3158 247
638 3300046530 Ga0495654_0021407 Ga0495654_0021407_319_1062 247
639 3300046530 Ga0495654_0028832 Ga0495654_0028832_1932_2675 247
640 3300046530 Ga0495654_0068049 Ga0495654_0068049_374_1117 247
641 3300046530 Ga0495654_0077699 Ga0495654_0077699_519_1262 247
642 3300046530 Ga0495654_0116077 Ga0495654_0116077_199_1014 247
643 3300046530 Ga0495654_0136344 Ga0495654_0136344_281_1024 247
644 3300046530 Ga0495654_0172909 Ga0495654_0172909_66_809 247
645 3300046536 Ga0495587_0007608 Ga0495587_0007608_299_1042 247
646 3300046538 Ga0495609_0000424 Ga0495609_0000424_33193_33936 247
647 3300046538 Ga0495609_0004998 Ga0495609_0004998_419_1162 247
648 3300046538 Ga0495609_0014856 Ga0495609_0014856_2539_3282 247
649 3300046538 Ga0495609_0038442 Ga0495609_0038442_291_1034 247
650 3300046538 Ga0495609_0102484 Ga0495609_0102484_158_901 247
651 3300046542 Ga0495597_0011509 Ga0495597_0011509_223_1038 247
652 3300046542 Ga0495597_0034086 Ga0495597_0034086_1260_2003 247
653 3300046542 Ga0495597_0076685 Ga0495597_0076685_226_969 247
654 3300046542 Ga0495597_0080720 Ga0495597_0080720_339_1082 247
655 3300046542 Ga0495597_0118228 Ga0495597_0118228_56_934 247
656 3300046557 Ga0495622_0002743 Ga0495622_0002743_334_1077 247
657 3300046557 Ga0495622_0007333 Ga0495622_0007333_341_1084 247
658 3300046557 Ga0495622_0016451 Ga0495622_0016451_180_971 247
659 3300046557 Ga0495622_0037108 Ga0495622_0037108_1180_1923 247
660 3300046557 Ga0495622_0065584 Ga0495622_0065584_208_951 247
661 3300046558 Ga0495633_0035680 Ga0495633_0035680_1581_2324 247
662 3300046558 Ga0495633_0086779 Ga0495633_0086779_428_1171 247
663 3300046616 Ga0495668_0002744 Ga0495668_0002744_300_1043 247
664 3300046616 Ga0495668_0051084 Ga0495668_0051084_742_1533 247
665 3300046616 Ga0495668_0114866 Ga0495668_0114866_461_1204 247
666 3300046616 Ga0495668_0157417 Ga0495668_0157417_178_921 247
667 3300046642 Ga0495634_0003534 Ga0495634_0003534_11465_12208 247
668 3300046648 Ga0495611_0002224 Ga0495611_0002224_7170_7913 247
669 3300046648 Ga0495611_0006834 Ga0495611_0006834_3095_3886 247
670 3300046648 Ga0495611_0052734 Ga0495611_0052734_984_1727 247
671 3300046660 Ga0495625_0000055 Ga0495625_0000055_38624_39415 247
672 3300046660 Ga0495625_0014734 Ga0495625_0014734_257_1000 247
673 3300046660 Ga0495625_0025249 Ga0495625_0025249_2725_3468 247
674 3300046660 Ga0495625_0039384 Ga0495625_0039384_144_887 247
675 3300046660 Ga0495625_0113272 Ga0495625_0113272_766_1509 247
676 3300046660 Ga0495625_0126415 Ga0495625_0126415_306_1049 247
677 3300046660 Ga0495625_0143630 Ga0495625_0143630_247_990 247
678 3300046660 Ga0495625_0285225 Ga0495625_0285225_240_983 247
679 3300046663 Ga0495635_0004213 Ga0495635_0004213_8925_9668 247
680 3300046664 Ga0495659_0001401 Ga0495659_0001401_291_1034 247
681 3300046664 Ga0495659_0025691 Ga0495659_0025691_319_1062 247
682 3300046664 Ga0495659_0082330 Ga0495659_0082330_429_1172 247
683 3300046665 Ga0495661_0000105 Ga0495661_0000105_78968_79711 247
684 3300046665 Ga0495661_0000419 Ga0495661_0000419_8057_8800 247
685 3300046665 Ga0495661_0005540 Ga0495661_0005540_719_1462 247
686 3300046665 Ga0495661_0023400 Ga0495661_0023400_3038_3781 247
687 3300046665 Ga0495661_0052100 Ga0495661_0052100_1530_2273 247
688 3300046665 Ga0495661_0059060 Ga0495661_0059060_774_1517 247
689 3300046665 Ga0495661_0081304 Ga0495661_0081304_317_1060 247
690 3300046665 Ga0495661_0113677 Ga0495661_0113677_508_1251 247
691 3300046665 Ga0495661_0119367 Ga0495661_0119367_147_890 247
692 3300046665 Ga0495661_0164283 Ga0495661_0164283_384_1127 247
693 3300046665 Ga0495661_0169369 Ga0495661_0169369_210_1025 247
694 3300046665 Ga0495661_0236080 Ga0495661_0236080_42_785 247
695 3300046674 Ga0495588_0089761 Ga0495588_0089761_727_1470 247
696 3300046675 Ga0495657_0084558 Ga0495657_0084558_287_1030 247
697 3300046679 Ga0495623_0004501 Ga0495623_0004501_277_1020 247
698 3300046679 Ga0495623_0007845 Ga0495623_0007845_450_1193 247
699 3300046680 Ga0495646_0070394 Ga0495646_0070394_1249_1992 247
700 3300046684 Ga0495669_0040795 Ga0495669_0040795_356_1099 247
701 3300046684 Ga0495669_0110323 Ga0495669_0110323_293_1036 247
702 3300046689 Ga0495613_0245662 Ga0495613_0245662_295_1038 247
703 3300046689 Ga0495613_0345650 Ga0495613_0345650_234_977 247
704 3300046691 Ga0495670_0002890 Ga0495670_0002890_1026_1769 247
705 3300046691 Ga0495670_0003758 Ga0495670_0003758_198_941 247
706 3300046691 Ga0495670_0026648 Ga0495670_0026648_1828_2607 247
707 3300046691 Ga0495670_0054355 Ga0495670_0054355_292_1035 247
708 3300046691 Ga0495670_0070267 Ga0495670_0070267_300_1043 247
709 3300046691 Ga0495670_0123629 Ga0495670_0123629_42_785 247
710 3300046691 Ga0495670_0135091 Ga0495670_0135091_414_1157 247
711 3300046692 Ga0495671_0003657 Ga0495671_0003657_8299_9042 247
712 3300046692 Ga0495671_0004344 Ga0495671_0004344_430_1173 247
713 3300046692 Ga0495671_0007147 Ga0495671_0007147_582_1325 247
714 3300046692 Ga0495671_0014187 Ga0495671_0014187_311_1054 247
715 3300046692 Ga0495671_0016663 Ga0495671_0016663_442_1194 247
716 3300046692 Ga0495671_0017384 Ga0495671_0017384_2671_3414 247
717 3300046692 Ga0495671_0020907 Ga0495671_0020907_265_1008 247
718 3300046692 Ga0495671_0025903 Ga0495671_0025903_498_1241 247
719 3300046692 Ga0495671_0030490 Ga0495671_0030490_458_1201 247
720 3300046692 Ga0495671_0031774 Ga0495671_0031774_931_1674 247
721 3300046692 Ga0495671_0038445 Ga0495671_0038445_1191_1934 247
722 3300046692 Ga0495671_0067742 Ga0495671_0067742_290_1033 247
723 3300046692 Ga0495671_0069612 Ga0495671_0069612_632_1375 247
724 3300046692 Ga0495671_0106434 Ga0495671_0106434_369_1112 247
725 3300046694 Ga0495649_0005105 Ga0495649_0005105_250_993 247
726 3300046694 Ga0495649_0005515 Ga0495649_0005515_283_1026 247
727 3300046694 Ga0495649_0006501 Ga0495649_0006501_5714_6457 247
728 3300046694 Ga0495649_0015590 Ga0495649_0015590_404_1147 247
729 3300046694 Ga0495649_0016712 Ga0495649_0016712_2804_3547 247
730 3300046694 Ga0495649_0025707 Ga0495649_0025707_1509_2252 247
731 3300046694 Ga0495649_0047687 Ga0495649_0047687_1345_2088 247
732 3300046694 Ga0495649_0048595 Ga0495649_0048595_17_760 247
733 3300046694 Ga0495649_0159154 Ga0495649_0159154_344_1087 247
734 3300046794 Ga0495589_0006199 Ga0495589_0006199_169_912 247
735 3300046794 Ga0495589_0009443 Ga0495589_0009443_377_1120 247
736 3300046794 Ga0495589_0017106 Ga0495589_0017106_2574_3317 247
737 3300046794 Ga0495589_0034253 Ga0495589_0034253_262_1005 247
738 3300046794 Ga0495589_0085121 Ga0495589_0085121_483_1226 247
739 3300046794 Ga0495589_0092569 Ga0495589_0092569_527_1270 247
740 3300046809 Ga0495600_0040554 Ga0495600_0040554_2010_2753 247
741 3300046810 Ga0495660_0008652 Ga0495660_0008652_185_928 247
742 3300046810 Ga0495660_0016519 Ga0495660_0016519_510_1253 247
743 3300046810 Ga0495660_0074608 Ga0495660_0074608_764_1543 247
744 3300046810 Ga0495660_0075582 Ga0495660_0075582_972_1715 247
745 3300046810 Ga0495660_0090364 Ga0495660_0090364_244_987 247
746 3300046810 Ga0495660_0115241 Ga0495660_0115241_416_1159 247
747 3300046810 Ga0495660_0116899 Ga0495660_0116899_478_1221 247
748 3300046810 Ga0495660_0120908 Ga0495660_0120908_247_990 247
749 3300046810 Ga0495660_0121236 Ga0495660_0121236_525_1268 247
750 3300046810 Ga0495660_0135694 Ga0495660_0135694_336_1079 247
751 3300046810 Ga0495660_0173973 Ga0495660_0173973_202_945 247
752 3300046810 Ga0495660_0178117 Ga0495660_0178117_67_810 247
753 3300047315 Ga0495581_0059077 Ga0495581_0059077_801_1544 247
754 3300047317 Ga0495604_0092412 Ga0495604_0092412_581_1324 247
755 3300047317 Ga0495604_0096356 Ga0495604_0096356_299_1042 247
756 3300047318 Ga0495636_0012334 Ga0495636_0012334_61_804 247
757 3300047319 Ga0495674_0008554 Ga0495674_0008554_8693_9436 247
758 3300047320 Ga0495672_0008378 Ga0495672_0008378_369_1112 247
759 3300047320 Ga0495672_0018577 Ga0495672_0018577_3452_4201 247
760 3300047320 Ga0495672_0039480 Ga0495672_0039480_714_1457 247
761 3300047320 Ga0495672_0041534 Ga0495672_0041534_1781_2524 247
762 3300047320 Ga0495672_0057850 Ga0495672_0057850_591_1334 247
763 3300047320 Ga0495672_0065569 Ga0495672_0065569_1179_1922 247
764 3300047320 Ga0495672_0075039 Ga0495672_0075039_1051_1794 247
765 3300047320 Ga0495672_0077536 Ga0495672_0077536_189_932 247
766 3300047320 Ga0495672_0078815 Ga0495672_0078815_673_1416 247
767 3300047320 Ga0495672_0100430 Ga0495672_0100430_489_1232 247
768 3300047320 Ga0495672_0103957 Ga0495672_0103957_329_1072 247
769 3300047320 Ga0495672_0146837 Ga0495672_0146837_183_926 247
770 3300047321 Ga0495676_0000013 Ga0495676_0000013_39452_40195 247
771 3300047321 Ga0495676_0006758 Ga0495676_0006758_1027_1770 247
772 3300047322 Ga0495680_0030462 Ga0495680_0030462_302_1045 247
773 3300047322 Ga0495680_0050297 Ga0495680_0050297_2326_3069 247
774 3300047322 Ga0495680_0160049 Ga0495680_0160049_617_1360 247
775 3300047323 Ga0495683_0001414 Ga0495683_0001414_364_1107 247
776 3300047323 Ga0495683_0001717 Ga0495683_0001717_228_971 247
777 3300047323 Ga0495683_0009109 Ga0495683_0009109_4363_5106 247
778 3300047323 Ga0495683_0028237 Ga0495683_0028237_2055_2798 247
779 3300047323 Ga0495683_0060233 Ga0495683_0060233_845_1588 247
780 3300047323 Ga0495683_0069950 Ga0495683_0069950_670_1413 247
781 3300047323 Ga0495683_0073971 Ga0495683_0073971_576_1319 247
782 3300047323 Ga0495683_0096688 Ga0495683_0096688_504_1247 247
783 3300047443 Ga0495687_005518 Ga0495687_005518_6998_7741 247
784 3300047444 Ga0495675_0121091 Ga0495675_0121091_106_849 247
785 3300047445 Ga0495677_0001626 Ga0495677_0001626_285_1028 247
786 3300047446 Ga0495679_000829 Ga0495679_000829_7261_8052 247
787 3300047446 Ga0495679_006001 Ga0495679_006001_219_962 247
788 3300047446 Ga0495679_006070 Ga0495679_006070_4212_4955 247
789 3300047446 Ga0495679_042666 Ga0495679_042666_526_1269 247
790 3300047446 Ga0495679_081913 Ga0495679_081913_92_835 247
791 3300047469 Ga0495673_0002859 Ga0495673_0002859_9721_10464 247
792 3300047469 Ga0495673_0004018 Ga0495673_0004018_178_960 247
793 3300047469 Ga0495673_0004986 Ga0495673_0004986_695_1438 247
794 3300047469 Ga0495673_0006539 Ga0495673_0006539_5788_6531 247
795 3300047469 Ga0495673_0017536 Ga0495673_0017536_2543_3286 247
796 3300047469 Ga0495673_0017702 Ga0495673_0017702_2232_2975 247
797 3300047469 Ga0495673_0019674 Ga0495673_0019674_2620_3363 247
798 3300047469 Ga0495673_0028180 Ga0495673_0028180_1072_1815 247
799 3300047469 Ga0495673_0035563 Ga0495673_0035563_894_1688 247
800 3300047469 Ga0495673_0045233 Ga0495673_0045233_299_1042 247
801 3300047469 Ga0495673_0073358 Ga0495673_0073358_518_1261 247
802 3300047469 Ga0495673_0078014 Ga0495673_0078014_558_1301 247
803 3300047469 Ga0495673_0090347 Ga0495673_0090347_452_1195 247
804 3300047469 Ga0495673_0111750 Ga0495673_0111750_117_860 247
805 3300047469 Ga0495673_0118179 Ga0495673_0118179_270_1013 247
806 3300047470 Ga0495681_0006057 Ga0495681_0006057_231_974 247
807 3300047470 Ga0495681_0006371 Ga0495681_0006371_6824_7702 247
808 3300047470 Ga0495681_0006681 Ga0495681_0006681_6494_7237 247
809 3300047470 Ga0495681_0009122 Ga0495681_0009122_5096_5839 247
810 3300047470 Ga0495681_0012743 Ga0495681_0012743_3744_4487 247
811 3300047470 Ga0495681_0016743 Ga0495681_0016743_1043_1786 247
812 3300047470 Ga0495681_0020158 Ga0495681_0020158_372_1115 247
813 3300047470 Ga0495681_0036431 Ga0495681_0036431_585_1358 247
814 3300047470 Ga0495681_0047257 Ga0495681_0047257_193_936 247
815 3300047470 Ga0495681_0054526 Ga0495681_0054526_843_1586 247
816 3300047471 Ga0495684_0107425 Ga0495684_0107425_602_1345 247
817 3300047472 Ga0495686_0007975 Ga0495686_0007975_6904_7647 247
818 3300047472 Ga0495686_0020082 Ga0495686_0020082_272_1015 247
819 3300047472 Ga0495686_0036998 Ga0495686_0036998_186_929 247
820 3300047472 Ga0495686_0109003 Ga0495686_0109003_634_1377 247
821 3300047472 Ga0495686_0119760 Ga0495686_0119760_139_930 247
822 3300047472 Ga0495686_0224996 Ga0495686_0224996_25_768 247
823 3300047673 Ga0495593_0006269 Ga0495593_0006269_824_1567 247
824 3300047673 Ga0495593_0067976 Ga0495593_0067976_305_1048 247
825 3300047673 Ga0495593_0156986 Ga0495593_0156986_103_846 247
826 3300048091 Ga0495626_0000252 Ga0495626_0000252_38751_39542 247
827 3300048091 Ga0495626_0001441 Ga0495626_0001441_302_1045 247
828 3300048091 Ga0495626_0001821 Ga0495626_0001821_15053_15796 247
829 3300048091 Ga0495626_0004164 Ga0495626_0004164_7245_7988 247
830 3300048091 Ga0495626_0007377 Ga0495626_0007377_5037_5780 247
831 3300048091 Ga0495626_0012334 Ga0495626_0012334_3717_4460 247
832 3300048091 Ga0495626_0013535 Ga0495626_0013535_319_1062 247
833 3300048091 Ga0495626_0121012 Ga0495626_0121012_361_1104 247
834 3300048905 Ga0496102_0005661 Ga0496102_0005661_260_1003 247
835 3300048906 Ga0496103_0156146 Ga0496103_0156146_708_1451 247
836 3300048909 Ga0496106_0151030 Ga0496106_0151030_919_1662 247
837 3300048913 Ga0496110_0192979 Ga0496110_0192979_816_1559 247
838 3300048913 Ga0496110_0406255 Ga0496110_0406255_400_1143 247
839 3300048914 Ga0496111_0256257 Ga0496111_0256257_248_991 247
840 3300048915 Ga0496112_0443708 Ga0496112_0443708_93_836 247
841 3300048916 Ga0496113_0211228 Ga0496113_0211228_755_1498 247
842 3300048918 Ga0496115_0127872 Ga0496115_0127872_1277_2020 247
843 3300048919 Ga0496116_0018273 Ga0496116_0018273_4378_5121 247
844 3300048919 Ga0496116_0107863 Ga0496116_0107863_252_995 247
845 3300048920 Ga0496117_0015679 Ga0496117_0015679_5631_6374 247
846 3300048920 Ga0496117_0125269 Ga0496117_0125269_516_1298 247
847 3300048920 Ga0496117_0158666 Ga0496117_0158666_82_825 247
848 3300048920 Ga0496117_0161246 Ga0496117_0161246_265_1047 247
849 3300048920 Ga0496117_0192158 Ga0496117_0192158_130_873 247
850 3300048921 Ga0496118_0084707 Ga0496118_0084707_1444_2187 247
851 3300048921 Ga0496118_0129543 Ga0496118_0129543_521_1303 247
852 3300048921 Ga0496118_0137353 Ga0496118_0137353_131_874 247
853 3300048921 Ga0496118_0160634 Ga0496118_0160634_242_985 247
854 3300048924 Ga0496121_0001347 Ga0496121_0001347_40606_41349 247
855 3300048924 Ga0496121_0005663 Ga0496121_0005663_599_1342 247
856 3300048924 Ga0496121_0021130 Ga0496121_0021130_291_1034 247
857 3300048924 Ga0496121_0131136 Ga0496121_0131136_889_1668 247
858 3300048924 Ga0496121_0166381 Ga0496121_0166381_558_1340 247
859 3300048924 Ga0496121_0300164 Ga0496121_0300164_258_1001 247
860 3300048925 Ga0496122_0000122 Ga0496122_0000122_29914_30657 247
861 3300048925 Ga0496122_0013387 Ga0496122_0013387_263_1006 247
862 3300048925 Ga0496122_0134936 Ga0496122_0134936_302_1045 247
863 3300048926 Ga0496123_0000173 Ga0496123_0000173_1395_2138 247
864 3300048926 Ga0496123_0106867 Ga0496123_0106867_387_1130 247
865 3300048926 Ga0496123_0147638 Ga0496123_0147638_258_1001 247
866 3300048927 Ga0496124_0013401 Ga0496124_0013401_5684_6427 247
867 3300048927 Ga0496124_0016684 Ga0496124_0016684_309_1052 247
868 3300048927 Ga0496124_0042813 Ga0496124_0042813_343_1086 247
869 3300048927 Ga0496124_0156804 Ga0496124_0156804_67_810 247
870 3300048927 Ga0496124_0243608 Ga0496124_0243608_330_1073 247
871 3300048927 Ga0496124_0310799 Ga0496124_0310799_319_1062 247
872 3300048928 Ga0496125_0014045 Ga0496125_0014045_6746_7489 247
873 3300048928 Ga0496125_0189152 Ga0496125_0189152_202_945 247
874 3300048929 Ga0496126_0163718 Ga0496126_0163718_912_1655 247
875 3300049459 Ga0495678_001294 Ga0495678_001294_17862_18605 247
876 3300049459 Ga0495678_003295 Ga0495678_003295_335_1078 247
877 3300049459 Ga0495678_003847 Ga0495678_003847_342_1085 247
878 3300049459 Ga0495678_005870 Ga0495678_005870_981_1724 247
879 3300049459 Ga0495678_010650 Ga0495678_010650_3062_3805 247
880 3300049459 Ga0495678_042245 Ga0495678_042245_372_1115 247
881 3300049459 Ga0495678_045297 Ga0495678_045297_699_1442 247
882 3300049459 Ga0495678_072239 Ga0495678_072239_288_1031 247
883 3300049459 Ga0495678_089856 Ga0495678_089856_71_814 247
884 3300049460 Ga0495682_0000939 Ga0495682_0000939_15188_15931 247
885 3300049460 Ga0495682_0033251 Ga0495682_0033251_548_1291 247
886 3300049460 Ga0495682_0036673 Ga0495682_0036673_707_1450 247
887 3300049460 Ga0495682_0040160 Ga0495682_0040160_921_1664 247
888 3300049460 Ga0495682_0049165 Ga0495682_0049165_287_1030 247
889 3300049460 Ga0495682_0077167 Ga0495682_0077167_217_960 247
890 3300049460 Ga0495682_0083716 Ga0495682_0083716_298_1041 247
891 3300050491 nmdc:mga00v17_211889_c1 nmdc:mga00v17_211889_c1_147_890 247
892 3300050491 nmdc:mga00v17_62949_c1 nmdc:mga00v17_62949_c1_219_962 247
893 3300050514 nmdc:mga08x19_437015_c1 nmdc:mga08x19_437015_c1_140_883 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01569

PAP2

PAP2 superfamily

144

278

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jki-assembly1.cif.gz_A crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis 0.6579 22 227
5jki-assembly1.cif.gz_A crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis 0.624 22 227
2akc-assembly1.cif.gz_B crystal structure of tungstate complex of the phon protein from s. typhimurium 0.557 91 240
8bm3-assembly4.cif.gz_D h207a mutant of e. coli pgpb, a pap2 type phosphatidyl glycerol phosphate and c55-pp phosphatase, in complex with farnesyl pyrophosphate 0.5234 25 232
7f18-assembly3.cif.gz_C crystal structure of a mutant of acid phosphatase from pseudomonas aeruginosa (q57h/w58p/d135r) 0.5113 81 228
ID Description Score Start End Superfamily
af_Q66H88_95_284_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6437 27 237 1.20.144.10
af_A0A2R8Q2K8_118_304_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6371 91 246 1.20.144.10
af_Q8VCY8_104_300_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6348 89 235 1.20.144.10
af_Q66H88_95_284_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6294 27 237 1.20.144.10
af_A4HYG7_136_301_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6294 98 227 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A427QB80-F1-model_v4 deleted 0.9746 8 230
AF-F6AC26-F1-model_v4 Phosphoesterase PA-phosphatase related protein 0.959 5 235 GO:0016020
AF-A0A345V1Q8-F1-model_v4 Phosphoesterase 0.9559 1 247 GO:0016020
AF-A0A839T891-F1-model_v4 Membrane-associated PAP2 superfamily phosphatase 0.9467 6 247 GO:0016020
AF-A0A1B4V5D6-F1-model_v4 Phosphoesterase 0.9438 15 235 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.04 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map