F484587
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 883 | 382 | 1766 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10062189|Ga0182008_100621892 |
| Length | 96 |
| Sequence | MLKLAFFVPASHVDGVKSAVFAAGGGRIGAYDHCSWQVLGQGQFRPLDGSQPFIGEVEWKVELVVADELIVAVVAALKLSHPYETPAYEVWRLEDY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 30 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 31 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 32 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 33 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 34 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 35 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 36 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 45 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 46 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 94 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 99 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 100 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 103 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 106 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 113 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 114 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 115 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 116 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 118 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 119 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 120 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 121 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 122 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 123 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 124 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 125 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 126 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 127 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 128 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 129 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 130 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 131 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 132 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 133 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 134 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 135 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 136 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 137 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 138 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 139 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 140 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 141 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 142 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 206 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 207 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 208 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 209 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 210 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 211 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 212 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 213 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 214 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 215 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 216 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 217 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 225 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 226 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 227 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 228 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 230 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 232 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 233 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 234 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 235 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 236 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 237 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 238 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 239 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 240 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 241 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 242 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 243 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 244 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 245 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 246 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 247 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 248 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 249 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 250 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 251 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 252 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 253 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 254 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 255 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 256 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 257 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 258 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 259 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 260 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 261 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 262 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 263 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 264 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 265 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 266 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 267 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 268 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 269 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 270 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 271 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 272 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 273 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 274 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 275 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 276 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 277 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 278 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 279 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 280 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 281 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 282 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 283 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 284 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 285 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 286 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 287 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 288 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 289 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 290 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 291 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 292 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 293 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 294 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 295 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 296 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 297 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 298 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 299 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 300 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 301 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 302 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 303 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 304 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 305 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 306 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 307 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 308 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 309 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 310 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 311 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 312 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 313 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 314 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 315 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 316 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 317 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 318 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 319 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 320 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 321 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 322 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 323 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 324 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 325 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 326 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 327 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 328 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 329 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 330 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 331 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 332 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 333 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 334 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 335 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 336 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 337 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 338 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 339 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 340 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 341 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 342 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 343 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 344 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 345 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 346 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 347 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 348 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 349 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 350 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 351 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 352 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 353 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 354 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 355 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 356 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 357 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 358 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 359 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 360 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 361 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 362 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 363 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 364 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 365 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 366 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 367 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 368 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 369 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 370 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 371 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 372 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 373 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 374 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 375 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 376 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 377 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 378 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 379 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 380 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 381 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 382 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.24 |
| Metatranscriptomes | 0 |
| Isolates | 16.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.76 |
| Nodule | 1.25 |
| Rhizoplane | 5.1 |
| Rhizosphere | 72.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182008_10062189 | 3300014497 | Bacteria | 1840 |
| 2 | SwRhRL2b_contig_1442390 | 2162886007 | Bacteria | 3681 |
| 3 | JGI25163J39215_1004342 | 3300002771 | Bacteria | 1007 |
| 4 | JGI25163J39215_1004908 | 3300002771 | Bacteria | 891 |
| 5 | JGI25164J39214_1000703 | 3300002772 | Bacteria | 12960 |
| 6 | JGI25165J46597_1001416 | 3300003214 | Bacteria | 12960 |
| 7 | Ga0055539_1000037 | 3300003752 | Bacteria | 215806 |
| 8 | Ga0055533_1000047 | 3300003756 | Bacteria | 215806 |
| 9 | Ga0055532_1000129 | 3300003758 | Bacteria | 74882 |
| 10 | Ga0055525_1000271 | 3300003759 | Bacteria | 48390 |
| 11 | Ga0055536_1000723 | 3300003781 | Bacteria | 22136 |
| 12 | Ga0055534_1036827 | 3300003784 | Bacteria | 734 |
| 13 | Ga0055530_10001304 | 3300003791 | Bacteria | 18756 |
| 14 | Ga0055530_10002470 | 3300003791 | Bacteria | 11858 |
| 15 | Ga0055540_1000806 | 3300003792 | Bacteria | 21215 |
| 16 | Ga0055541_1000025 | 3300003841 | Bacteria | 215806 |
| 17 | Ga0065714_10065440 | 3300005288 | Bacteria | 10054 |
| 18 | Ga0065714_10347748 | 3300005288 | Bacteria | 638 |
| 19 | Ga0065714_10477409 | 3300005288 | Bacteria | 531 |
| 20 | Ga0065704_10015268 | 3300005289 | Bacteria | 2137 |
| 21 | Ga0065704_10018014 | 3300005289 | Bacteria | 1753 |
| 22 | Ga0065704_10046174 | 3300005289 | Bacteria | 829 |
| 23 | Ga0065704_10095455 | 3300005289 | Bacteria | 2487 |
| 24 | Ga0065704_10114970 | 3300005289 | Bacteria | 1881 |
| 25 | Ga0065704_10233039 | 3300005289 | Bacteria | 1037 |
| 26 | Ga0065712_10068567 | 3300005290 | Bacteria | 9871 |
| 27 | Ga0070670_100002907 | 3300005331 | Bacteria | 14177 |
| 28 | Ga0070670_100028293 | 3300005331 | Bacteria | 4824 |
| 29 | Ga0070661_100000022 | 3300005344 | Bacteria | 127714 |
| 30 | Ga0070674_102234697 | 3300005356 | Bacteria | 500 |
| 31 | Ga0070659_100917259 | 3300005366 | Bacteria | 766 |
| 32 | Ga0070663_101323870 | 3300005455 | Bacteria | 636 |
| 33 | Ga0070662_100000041 | 3300005457 | Bacteria | 72879 |
| 34 | Ga0070662_100127964 | 3300005457 | Bacteria | 1954 |
| 35 | Ga0068853_100009803 | 3300005539 | Bacteria | 7730 |
| 36 | Ga0070665_100008895 | 3300005548 | Bacteria | 10172 |
| 37 | Ga0070665_100328593 | 3300005548 | Bacteria | 1533 |
| 38 | Ga0070665_101349354 | 3300005548 | Bacteria | 723 |
| 39 | Ga0070665_101807467 | 3300005548 | Bacteria | 618 |
| 40 | Ga0070664_100000088 | 3300005564 | Bacteria | 58607 |
| 41 | Ga0068854_100013980 | 3300005578 | Bacteria | 5281 |
| 42 | Ga0068851_10000044 | 3300005834 | Bacteria | 83228 |
| 43 | Ga0075364_10104773 | 3300006051 | Bacteria | 1885 |
| 44 | Ga0075364_10287067 | 3300006051 | Bacteria | 1120 |
| 45 | Ga0075432_10110299 | 3300006058 | Bacteria | 1025 |
| 46 | Ga0075432_10292168 | 3300006058 | Bacteria | 674 |
| 47 | Ga0075362_10395373 | 3300006177 | Bacteria | 696 |
| 48 | Ga0075369_10447936 | 3300006186 | Bacteria | 611 |
| 49 | Ga0075436_100192079 | 3300006914 | Bacteria | 1445 |
| 50 | Ga0075436_100205541 | 3300006914 | Bacteria | 1395 |
| 51 | Ga0075436_100417703 | 3300006914 | Bacteria | 973 |
| 52 | Ga0099823_1000052 | 3300006944 | Bacteria | 56662 |
| 53 | Ga0079104_1047468 | 3300006946 | Bacteria | 971 |
| 54 | Ga0105251_10000151 | 3300009011 | Bacteria | 70872 |
| 55 | Ga0105251_10000156 | 3300009011 | Bacteria | 69639 |
| 56 | Ga0105251_10002615 | 3300009011 | Bacteria | 13924 |
| 57 | Ga0105251_10005925 | 3300009011 | Bacteria | 7900 |
| 58 | Ga0105251_10008174 | 3300009011 | Bacteria | 6327 |
| 59 | Ga0105251_10024252 | 3300009011 | Bacteria | 3117 |
| 60 | Ga0105251_10031154 | 3300009011 | Bacteria | 2671 |
| 61 | Ga0105251_10041365 | 3300009011 | Bacteria | 2243 |
| 62 | Ga0105251_10052601 | 3300009011 | Bacteria | 1938 |
| 63 | Ga0105251_10057026 | 3300009011 | Bacteria | 1847 |
| 64 | Ga0105251_10063879 | 3300009011 | Bacteria | 1727 |
| 65 | Ga0105251_10117510 | 3300009011 | Bacteria | 1209 |
| 66 | Ga0105251_10164436 | 3300009011 | Bacteria | 1000 |
| 67 | Ga0105251_10188254 | 3300009011 | Bacteria | 929 |
| 68 | Ga0105251_10209749 | 3300009011 | Bacteria | 877 |
| 69 | Ga0105251_10217369 | 3300009011 | Bacteria | 860 |
| 70 | Ga0105251_10302966 | 3300009011 | Bacteria | 725 |
| 71 | Ga0105244_10000074 | 3300009036 | Bacteria | 113999 |
| 72 | Ga0105244_10000724 | 3300009036 | Bacteria | 28465 |
| 73 | Ga0105244_10003567 | 3300009036 | Bacteria | 11054 |
| 74 | Ga0105244_10005787 | 3300009036 | Bacteria | 8140 |
| 75 | Ga0105244_10014340 | 3300009036 | Bacteria | 4585 |
| 76 | Ga0105244_10018455 | 3300009036 | Bacteria | 3914 |
| 77 | Ga0105244_10023141 | 3300009036 | Bacteria | 3411 |
| 78 | Ga0105244_10027560 | 3300009036 | Bacteria | 3059 |
| 79 | Ga0105244_10032297 | 3300009036 | Bacteria | 2772 |
| 80 | Ga0105244_10055931 | 3300009036 | Bacteria | 1998 |
| 81 | Ga0105244_10083518 | 3300009036 | Bacteria | 1578 |
| 82 | Ga0105244_10098306 | 3300009036 | Bacteria | 1434 |
| 83 | Ga0105244_10101998 | 3300009036 | Bacteria | 1403 |
| 84 | Ga0105244_10123021 | 3300009036 | Bacteria | 1255 |
| 85 | Ga0105244_10222041 | 3300009036 | Bacteria | 886 |
| 86 | Ga0105244_10225462 | 3300009036 | Bacteria | 878 |
| 87 | Ga0105244_10240968 | 3300009036 | Bacteria | 845 |
| 88 | Ga0105244_10267915 | 3300009036 | Bacteria | 794 |
| 89 | Ga0105244_10339495 | 3300009036 | Bacteria | 693 |
| 90 | Ga0105250_10000427 | 3300009092 | Bacteria | 30787 |
| 91 | Ga0105250_10000446 | 3300009092 | Bacteria | 29848 |
| 92 | Ga0105250_10005700 | 3300009092 | Bacteria | 5557 |
| 93 | Ga0105250_10009794 | 3300009092 | Bacteria | 4024 |
| 94 | Ga0105250_10045205 | 3300009092 | Bacteria | 1765 |
| 95 | Ga0105250_10098877 | 3300009092 | Bacteria | 1190 |
| 96 | Ga0105250_10118902 | 3300009092 | Bacteria | 1085 |
| 97 | Ga0105250_10122498 | 3300009092 | Bacteria | 1070 |
| 98 | Ga0105250_10132506 | 3300009092 | Bacteria | 1029 |
| 99 | Ga0105250_10148069 | 3300009092 | Bacteria | 976 |
| 100 | Ga0105250_10195089 | 3300009092 | Bacteria | 853 |
| 101 | Ga0105250_10270659 | 3300009092 | Bacteria | 729 |
| 102 | Ga0105243_10001292 | 3300009148 | Bacteria | 22446 |
| 103 | Ga0105243_10001345 | 3300009148 | Bacteria | 21894 |
| 104 | Ga0105243_10011029 | 3300009148 | Bacteria | 6834 |
| 105 | Ga0105243_10039461 | 3300009148 | Bacteria | 3680 |
| 106 | Ga0105243_10049266 | 3300009148 | Bacteria | 3322 |
| 107 | Ga0105243_10118381 | 3300009148 | Bacteria | 2229 |
| 108 | Ga0105242_10134779 | 3300009176 | Bacteria | 2136 |
| 109 | Ga0105237_10001113 | 3300009545 | Bacteria | 35975 |
| 110 | Ga0105249_10093764 | 3300009553 | Bacteria | 2813 |
| 111 | Ga0105246_10000856 | 3300011119 | Bacteria | 17401 |
| 112 | Ga0105246_10003908 | 3300011119 | Bacteria | 9027 |
| 113 | Ga0105246_10125609 | 3300011119 | Bacteria | 1908 |
| 114 | Ga0157336_1010472 | 3300012477 | Bacteria | 707 |
| 115 | Ga0157345_1000706 | 3300012498 | Bacteria | 2694 |
| 116 | Ga0157347_1013960 | 3300012502 | Bacteria | 882 |
| 117 | Ga0157373_10014045 | 3300013100 | Bacteria | 5872 |
| 118 | Ga0157373_10016307 | 3300013100 | Bacteria | 5421 |
| 119 | Ga0157373_10018124 | 3300013100 | Bacteria | 5126 |
| 120 | Ga0157373_10164053 | 3300013100 | Bacteria | 1563 |
| 121 | Ga0157373_10217843 | 3300013100 | Bacteria | 1346 |
| 122 | Ga0157373_10425881 | 3300013100 | Bacteria | 953 |
| 123 | Ga0157373_10976798 | 3300013100 | Bacteria | 631 |
| 124 | Ga0157371_10002116 | 3300013102 | Bacteria | 19330 |
| 125 | Ga0157371_10002403 | 3300013102 | Bacteria | 17919 |
| 126 | Ga0157371_10006388 | 3300013102 | Bacteria | 9738 |
| 127 | Ga0157370_10080216 | 3300013104 | Bacteria | 3072 |
| 128 | Ga0157370_10142756 | 3300013104 | Bacteria | 2231 |
| 129 | Ga0157370_10534922 | 3300013104 | Bacteria | 1075 |
| 130 | Ga0157370_10545025 | 3300013104 | Bacteria | 1064 |
| 131 | Ga0157370_11060627 | 3300013104 | Bacteria | 733 |
| 132 | Ga0157369_10015853 | 3300013105 | Bacteria | 8487 |
| 133 | Ga0157369_10259708 | 3300013105 | Bacteria | 1811 |
| 134 | Ga0157369_10544127 | 3300013105 | Bacteria | 1200 |
| 135 | Ga0157369_11142078 | 3300013105 | Bacteria | 796 |
| 136 | Ga0157369_11238255 | 3300013105 | Bacteria | 761 |
| 137 | Ga0163162_10003878 | 3300013306 | Bacteria | 14357 |
| 138 | Ga0163162_10015992 | 3300013306 | Bacteria | 7334 |
| 139 | Ga0163162_10020659 | 3300013306 | Bacteria | 6472 |
| 140 | Ga0163162_12246387 | 3300013306 | Bacteria | 627 |
| 141 | Ga0157372_10012341 | 3300013307 | Bacteria | 9104 |
| 142 | Ga0157372_10022670 | 3300013307 | Bacteria | 6796 |
| 143 | Ga0157375_11133704 | 3300013308 | Bacteria | 916 |
| 144 | Ga0157375_12878832 | 3300013308 | Bacteria | 575 |
| 145 | Ga0182008_10000570 | 3300014497 | Bacteria | 27277 |
| 146 | Ga0182008_10121858 | 3300014497 | Bacteria | 1296 |
| 147 | Ga0182008_10177395 | 3300014497 | Bacteria | 1077 |
| 148 | Ga0182008_10254779 | 3300014497 | Bacteria | 906 |
| 149 | Ga0182008_10300384 | 3300014497 | Bacteria | 840 |
| 150 | Ga0182006_1001124 | 3300015261 | Bacteria | 17017 |
| 151 | Ga0182006_1009185 | 3300015261 | Bacteria | 4442 |
| 152 | Ga0182006_1011257 | 3300015261 | Bacteria | 3944 |
| 153 | Ga0182006_1118697 | 3300015261 | Bacteria | 921 |
| 154 | Ga0182006_1132864 | 3300015261 | Bacteria | 855 |
| 155 | Ga0182005_1020832 | 3300015265 | Bacteria | 1801 |
| 156 | Ga0182005_1092268 | 3300015265 | Bacteria | 843 |
| 157 | Ga0163161_10002724 | 3300017792 | Bacteria | 12559 |
| 158 | Ga0163161_10003020 | 3300017792 | Bacteria | 11880 |
| 159 | Ga0163161_10006539 | 3300017792 | Bacteria | 8067 |
| 160 | Ga0163161_10493788 | 3300017792 | Bacteria | 996 |
| 161 | Ga0209435_100880 | 3300025206 | Bacteria | 4608 |
| 162 | Ga0209760_100248 | 3300025207 | Bacteria | 22328 |
| 163 | Ga0209760_100553 | 3300025207 | Bacteria | 6912 |
| 164 | Ga0209784_100032 | 3300025224 | Bacteria | 314079 |
| 165 | Ga0209566_100036 | 3300025225 | Bacteria | 314079 |
| 166 | Ga0209674_100054 | 3300025226 | Bacteria | 314079 |
| 167 | Ga0209147_100055 | 3300025229 | Bacteria | 262412 |
| 168 | Ga0209563_100055 | 3300025230 | Bacteria | 314079 |
| 169 | Ga0209563_100693 | 3300025230 | Bacteria | 10636 |
| 170 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 171 | Ga0209437_100028 | 3300025233 | Bacteria | 540136 |
| 172 | Ga0209437_116779 | 3300025233 | Bacteria | 975 |
| 173 | Ga0209258_100283 | 3300025242 | Bacteria | 83776 |
| 174 | Ga0209646_1000462 | 3300025246 | Bacteria | 20662 |
| 175 | Ga0209026_1015738 | 3300025250 | Bacteria | 1237 |
| 176 | Ga0209677_100033 | 3300025253 | Bacteria | 314079 |
| 177 | Ga0209759_1016440 | 3300025256 | Bacteria | 1869 |
| 178 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 179 | Ga0209676_1000056 | 3300025292 | Bacteria | 361329 |
| 180 | Ga0209676_1000551 | 3300025292 | Bacteria | 57320 |
| 181 | Ga0209050_1001645 | 3300025298 | Bacteria | 22807 |
| 182 | Ga0209051_1000061 | 3300025303 | Bacteria | 253485 |
| 183 | Ga0207656_10000022 | 3300025321 | Bacteria | 106345 |
| 184 | Ga0207696_1000032 | 3300025711 | Bacteria | 380071 |
| 185 | Ga0207696_1000034 | 3300025711 | Bacteria | 350426 |
| 186 | Ga0207696_1000129 | 3300025711 | Bacteria | 133308 |
| 187 | Ga0207696_1000340 | 3300025711 | Bacteria | 48448 |
| 188 | Ga0207696_1004452 | 3300025711 | Bacteria | 6034 |
| 189 | Ga0207696_1026381 | 3300025711 | Bacteria | 1799 |
| 190 | Ga0207696_1031615 | 3300025711 | Bacteria | 1600 |
| 191 | Ga0207696_1095840 | 3300025711 | Bacteria | 811 |
| 192 | Ga0207696_1124543 | 3300025711 | Bacteria | 694 |
| 193 | Ga0207696_1129559 | 3300025711 | Bacteria | 678 |
| 194 | Ga0207696_1159881 | 3300025711 | Bacteria | 600 |
| 195 | Ga0207655_1000357 | 3300025728 | Bacteria | 64976 |
| 196 | Ga0207655_1000408 | 3300025728 | Bacteria | 59188 |
| 197 | Ga0207655_1000487 | 3300025728 | Bacteria | 51198 |
| 198 | Ga0207655_1003661 | 3300025728 | Bacteria | 11337 |
| 199 | Ga0207655_1006079 | 3300025728 | Bacteria | 8058 |
| 200 | Ga0207655_1006620 | 3300025728 | Bacteria | 7639 |
| 201 | Ga0207655_1008861 | 3300025728 | Bacteria | 6321 |
| 202 | Ga0207655_1009590 | 3300025728 | Bacteria | 5996 |
| 203 | Ga0207655_1010833 | 3300025728 | Bacteria | 5491 |
| 204 | Ga0207655_1016182 | 3300025728 | Bacteria | 4094 |
| 205 | Ga0207655_1017075 | 3300025728 | Bacteria | 3931 |
| 206 | Ga0207655_1026687 | 3300025728 | Bacteria | 2769 |
| 207 | Ga0207655_1036740 | 3300025728 | Bacteria | 2168 |
| 208 | Ga0207655_1042410 | 3300025728 | Bacteria | 1938 |
| 209 | Ga0207655_1137211 | 3300025728 | Bacteria | 790 |
| 210 | Ga0207655_1165354 | 3300025728 | Bacteria | 688 |
| 211 | Ga0207713_1000014 | 3300025735 | Bacteria | 432450 |
| 212 | Ga0207713_1000163 | 3300025735 | Bacteria | 98277 |
| 213 | Ga0207713_1001339 | 3300025735 | Bacteria | 20177 |
| 214 | Ga0207713_1005506 | 3300025735 | Bacteria | 7900 |
| 215 | Ga0207713_1008041 | 3300025735 | Bacteria | 6129 |
| 216 | Ga0207713_1012133 | 3300025735 | Bacteria | 4631 |
| 217 | Ga0207713_1014589 | 3300025735 | Bacteria | 4074 |
| 218 | Ga0207713_1027582 | 3300025735 | Bacteria | 2577 |
| 219 | Ga0207713_1028660 | 3300025735 | Bacteria | 2507 |
| 220 | Ga0207713_1095505 | 3300025735 | Bacteria | 1036 |
| 221 | Ga0207713_1122789 | 3300025735 | Bacteria | 869 |
| 222 | Ga0207713_1247938 | 3300025735 | Bacteria | 526 |
| 223 | Ga0207671_10000034 | 3300025914 | Bacteria | 245048 |
| 224 | Ga0207649_10000006 | 3300025920 | Bacteria | 349180 |
| 225 | Ga0207681_10000607 | 3300025923 | Bacteria | 24119 |
| 226 | Ga0207650_10000092 | 3300025925 | Bacteria | 116489 |
| 227 | Ga0207650_10001090 | 3300025925 | Bacteria | 20075 |
| 228 | Ga0207706_10001484 | 3300025933 | Bacteria | 23342 |
| 229 | Ga0207706_10059457 | 3300025933 | Bacteria | 3365 |
| 230 | Ga0207686_10609229 | 3300025934 | Bacteria | 860 |
| 231 | Ga0207709_10000757 | 3300025935 | Bacteria | 25461 |
| 232 | Ga0207709_10005599 | 3300025935 | Bacteria | 7105 |
| 233 | Ga0207709_10077240 | 3300025935 | Bacteria | 2134 |
| 234 | Ga0207709_10212080 | 3300025935 | Bacteria | 1391 |
| 235 | Ga0207669_11127549 | 3300025937 | Bacteria | 663 |
| 236 | Ga0207679_10000010 | 3300025945 | Bacteria | 349180 |
| 237 | Ga0207712_11388021 | 3300025961 | Bacteria | 628 |
| 238 | Ga0207640_10563537 | 3300025981 | Bacteria | 959 |
| 239 | Ga0207639_10003207 | 3300026041 | Bacteria | 10994 |
| 240 | Ga0207678_11315615 | 3300026067 | Bacteria | 639 |
| 241 | Ga0209281_1018994 | 3300027111 | Bacteria | 1364 |
| 242 | Ga0209281_1057859 | 3300027111 | Bacteria | 600 |
| 243 | Ga0209389_1000005 | 3300027296 | Bacteria | 232255 |
| 244 | Ga0209371_1000277 | 3300027312 | Bacteria | 59241 |
| 245 | Ga0207428_10538878 | 3300027907 | Bacteria | 845 |
| 246 | Ga0268266_10010027 | 3300028379 | Bacteria | 8313 |
| 247 | Ga0268266_10323293 | 3300028379 | Bacteria | 1444 |
| 248 | Ga0268266_10503939 | 3300028379 | Bacteria | 1156 |
| 249 | Ga0268266_10979137 | 3300028379 | Bacteria | 818 |
| 250 | Ga0268256_1000315 | 3300030500 | Bacteria | 48457 |
| 251 | Ga0268256_1022197 | 3300030500 | Bacteria | 1670 |
| 252 | Ga0307511_10254534 | 3300030521 | Bacteria | 840 |
| 253 | Ga0316183_1131894 | 3300030742 | Bacteria | 968 |
| 254 | Ga0316183_1206930 | 3300030742 | Bacteria | 3386 |
| 255 | Ga0307509_10866175 | 3300031507 | Bacteria | 568 |
| 256 | Ga0307408_100061680 | 3300031548 | Bacteria | 2737 |
| 257 | Ga0307514_10378887 | 3300031649 | Bacteria | 736 |
| 258 | Ga0307516_10438332 | 3300031730 | Bacteria | 963 |
| 259 | Ga0307405_10000772 | 3300031731 | Bacteria | 12528 |
| 260 | Ga0307405_10005627 | 3300031731 | Bacteria | 6065 |
| 261 | Ga0307413_10122108 | 3300031824 | Bacteria | 1766 |
| 262 | Ga0307413_10907794 | 3300031824 | Bacteria | 749 |
| 263 | Ga0307407_10121169 | 3300031903 | Bacteria | 1658 |
| 264 | Ga0307412_10000233 | 3300031911 | Bacteria | 36924 |
| 265 | Ga0307412_10786722 | 3300031911 | Bacteria | 824 |
| 266 | Ga0307412_10799557 | 3300031911 | Bacteria | 818 |
| 267 | Ga0307412_10966253 | 3300031911 | Bacteria | 750 |
| 268 | Ga0307412_11141867 | 3300031911 | Bacteria | 695 |
| 269 | Ga0307412_11335910 | 3300031911 | Bacteria | 646 |
| 270 | Ga0307409_101006922 | 3300031995 | Bacteria | 851 |
| 271 | Ga0307416_101070791 | 3300032002 | Bacteria | 910 |
| 272 | Ga0307414_10043834 | 3300032004 | Bacteria | 3050 |
| 273 | Ga0307414_10383068 | 3300032004 | Bacteria | 1216 |
| 274 | Ga0307414_10875289 | 3300032004 | Bacteria | 822 |
| 275 | Ga0307411_10134137 | 3300032005 | Bacteria | 1814 |
| 276 | Ga0307510_10008612 | 3300033180 | Bacteria | 12157 |
| 277 | Ga0439438_001545 | 3300041405 | Bacteria | 10146 |
| 278 | Ga0439438_001889 | 3300041405 | Bacteria | 9172 |
| 279 | Ga0439438_018209 | 3300041405 | Bacteria | 2004 |
| 280 | Ga0439438_067003 | 3300041405 | Bacteria | 892 |
| 281 | Ga0439447_011365 | 3300041407 | Bacteria | 2602 |
| 282 | Ga0439447_016069 | 3300041407 | Bacteria | 2061 |
| 283 | Ga0439447_018438 | 3300041407 | Bacteria | 1880 |
| 284 | Ga0439447_034898 | 3300041407 | Bacteria | 1248 |
| 285 | Ga0439466_0011833 | 3300041411 | Bacteria | 3221 |
| 286 | Ga0439466_0022591 | 3300041411 | Bacteria | 2218 |
| 287 | Ga0439466_0038734 | 3300041411 | Bacteria | 1600 |
| 288 | Ga0439466_0082443 | 3300041411 | Bacteria | 1013 |
| 289 | Ga0439466_0134093 | 3300041411 | Bacteria | 761 |
| 290 | Ga0451797_0795164 | 3300041453 | Bacteria | 540 |
| 291 | Ga0451837_1779630 | 3300041494 | Bacteria | 794 |
| 292 | Ga0451841_0884857 | 3300041498 | Bacteria | 537 |
| 293 | Ga0439431_0022692 | 3300041997 | Bacteria | 1514 |
| 294 | Ga0439432_000198 | 3300042006 | Bacteria | 21620 |
| 295 | Ga0439432_000272 | 3300042006 | Bacteria | 18658 |
| 296 | Ga0439432_051602 | 3300042006 | Bacteria | 1281 |
| 297 | Ga0439432_107354 | 3300042006 | Bacteria | 832 |
| 298 | Ga0439451_002129 | 3300042009 | Bacteria | 3976 |
| 299 | Ga0439451_002955 | 3300042009 | Bacteria | 3454 |
| 300 | Ga0439451_004570 | 3300042009 | Bacteria | 2816 |
| 301 | Ga0439451_006684 | 3300042009 | Bacteria | 2357 |
| 302 | Ga0439452_001129 | 3300042010 | Bacteria | 11665 |
| 303 | Ga0439452_012768 | 3300042010 | Bacteria | 2377 |
| 304 | Ga0439452_037852 | 3300042010 | Bacteria | 1148 |
| 305 | Ga0439456_000173 | 3300042013 | Bacteria | 19259 |
| 306 | Ga0439456_013117 | 3300042013 | Bacteria | 1722 |
| 307 | Ga0439456_017969 | 3300042013 | Bacteria | 1483 |
| 308 | Ga0439456_101385 | 3300042013 | Bacteria | 651 |
| 309 | Ga0439463_004835 | 3300042016 | Bacteria | 3366 |
| 310 | Ga0439463_026452 | 3300042016 | Bacteria | 1457 |
| 311 | Ga0450911_000552 | 3300042115 | Bacteria | 11643 |
| 312 | Ga0450911_008582 | 3300042115 | Bacteria | 1451 |
| 313 | Ga0450911_019113 | 3300042115 | Bacteria | 898 |
| 314 | Ga0450920_010368 | 3300042122 | Bacteria | 1727 |
| 315 | Ga0450923_062722 | 3300042125 | Bacteria | 813 |
| 316 | Ga0450923_187374 | 3300042125 | Bacteria | 511 |
| 317 | Ga0450898_000205 | 3300042134 | Bacteria | 6314 |
| 318 | Ga0450900_015897 | 3300042136 | Bacteria | 1015 |
| 319 | Ga0450902_002305 | 3300042137 | Bacteria | 2702 |
| 320 | Ga0450902_021864 | 3300042137 | Bacteria | 1057 |
| 321 | Ga0450902_040800 | 3300042137 | Bacteria | 790 |
| 322 | Ga0450902_045676 | 3300042137 | Bacteria | 748 |
| 323 | Ga0450902_069694 | 3300042137 | Bacteria | 612 |
| 324 | Ga0450902_091233 | 3300042137 | Bacteria | 538 |
| 325 | Ga0450902_102335 | 3300042137 | Bacteria | 510 |
| 326 | Ga0450903_022308 | 3300042138 | Bacteria | 976 |
| 327 | Ga0450903_049209 | 3300042138 | Bacteria | 618 |
| 328 | Ga0450904_000292 | 3300042139 | Bacteria | 10835 |
| 329 | Ga0450905_000284 | 3300042142 | Bacteria | 6025 |
| 330 | Ga0450905_031226 | 3300042142 | Bacteria | 823 |
| 331 | Ga0450906_000396 | 3300042145 | Bacteria | 8954 |
| 332 | Ga0450906_012358 | 3300042145 | Bacteria | 1583 |
| 333 | Ga0450907_056790 | 3300042146 | Bacteria | 674 |
| 334 | Ga0439446_0084009 | 3300042156 | Bacteria | 989 |
| 335 | Ga0450908_022514 | 3300042184 | Bacteria | 1103 |
| 336 | Ga0439464_0014490 | 3300042439 | Bacteria | 2120 |
| 337 | Ga0450893_0017687 | 3300042532 | Bacteria | 1212 |
| 338 | Ga0450901_000018 | 3300042533 | Bacteria | 15939 |
| 339 | Ga0450901_010503 | 3300042533 | Bacteria | 958 |
| 340 | Ga0439440_0028426 | 3300042993 | Bacteria | 1305 |
| 341 | Ga0495617_002206 | 3300046452 | Bacteria | 7937 |
| 342 | Ga0495617_055684 | 3300046452 | Bacteria | 1311 |
| 343 | Ga0495617_081263 | 3300046452 | Bacteria | 1061 |
| 344 | Ga0495617_138370 | 3300046452 | Bacteria | 778 |
| 345 | Ga0495617_191446 | 3300046452 | Bacteria | 641 |
| 346 | Ga0495617_273900 | 3300046452 | Bacteria | 517 |
| 347 | Ga0495617_278478 | 3300046452 | Bacteria | 512 |
| 348 | Ga0495627_000074 | 3300046453 | Bacteria | 123139 |
| 349 | Ga0495627_002496 | 3300046453 | Bacteria | 8782 |
| 350 | Ga0495627_009192 | 3300046453 | Bacteria | 3646 |
| 351 | Ga0495627_063237 | 3300046453 | Bacteria | 1091 |
| 352 | Ga0495627_079781 | 3300046453 | Bacteria | 949 |
| 353 | Ga0495590_0043584 | 3300046457 | Bacteria | 1564 |
| 354 | Ga0495590_0048158 | 3300046457 | Bacteria | 1486 |
| 355 | Ga0495591_000142 | 3300046458 | Bacteria | 76727 |
| 356 | Ga0495591_007147 | 3300046458 | Bacteria | 4792 |
| 357 | Ga0495591_007531 | 3300046458 | Bacteria | 4613 |
| 358 | Ga0495591_026679 | 3300046458 | Bacteria | 1790 |
| 359 | Ga0495591_028978 | 3300046458 | Bacteria | 1687 |
| 360 | Ga0495591_048906 | 3300046458 | Bacteria | 1163 |
| 361 | Ga0495591_064265 | 3300046458 | Bacteria | 967 |
| 362 | Ga0495591_112867 | 3300046458 | Bacteria | 666 |
| 363 | Ga0495591_143812 | 3300046458 | Bacteria | 574 |
| 364 | Ga0495638_0023362 | 3300046460 | Bacteria | 4044 |
| 365 | Ga0495638_0024038 | 3300046460 | Bacteria | 3977 |
| 366 | Ga0495638_0172809 | 3300046460 | Bacteria | 1238 |
| 367 | Ga0495638_0243503 | 3300046460 | Bacteria | 994 |
| 368 | Ga0495638_0631736 | 3300046460 | Bacteria | 522 |
| 369 | Ga0495653_0072273 | 3300046463 | Bacteria | 2576 |
| 370 | Ga0495653_0275055 | 3300046463 | Bacteria | 1107 |
| 371 | Ga0495653_0754748 | 3300046463 | Bacteria | 587 |
| 372 | Ga0495650_0021495 | 3300046471 | Bacteria | 3116 |
| 373 | Ga0495650_0041170 | 3300046471 | Bacteria | 1977 |
| 374 | Ga0495650_0051945 | 3300046471 | Bacteria | 1685 |
| 375 | Ga0495650_0136268 | 3300046471 | Bacteria | 891 |
| 376 | Ga0495650_0220946 | 3300046471 | Bacteria | 652 |
| 377 | Ga0495605_0008969 | 3300046474 | Bacteria | 5634 |
| 378 | Ga0495605_0104124 | 3300046474 | Bacteria | 1301 |
| 379 | Ga0495605_0232105 | 3300046474 | Bacteria | 794 |
| 380 | Ga0495584_0003442 | 3300046491 | Bacteria | 8709 |
| 381 | Ga0495584_0004205 | 3300046491 | Bacteria | 7767 |
| 382 | Ga0495584_0093399 | 3300046491 | Bacteria | 1518 |
| 383 | Ga0495584_0162683 | 3300046491 | Bacteria | 1134 |
| 384 | Ga0495584_0428590 | 3300046491 | Bacteria | 672 |
| 385 | Ga0495584_0459937 | 3300046491 | Bacteria | 647 |
| 386 | Ga0495585_0006062 | 3300046492 | Bacteria | 7562 |
| 387 | Ga0495585_0166376 | 3300046492 | Bacteria | 1141 |
| 388 | Ga0495596_0046741 | 3300046500 | Bacteria | 1699 |
| 389 | Ga0495596_0342790 | 3300046500 | Bacteria | 581 |
| 390 | Ga0495607_0000315 | 3300046501 | Bacteria | 50370 |
| 391 | Ga0495607_0000628 | 3300046501 | Bacteria | 34220 |
| 392 | Ga0495607_0001499 | 3300046501 | Bacteria | 20682 |
| 393 | Ga0495607_0016720 | 3300046501 | Bacteria | 4729 |
| 394 | Ga0495607_0018105 | 3300046501 | Bacteria | 4499 |
| 395 | Ga0495607_0093067 | 3300046501 | Bacteria | 1629 |
| 396 | Ga0495607_0105311 | 3300046501 | Bacteria | 1504 |
| 397 | Ga0495607_0147454 | 3300046501 | Bacteria | 1207 |
| 398 | Ga0495607_0149505 | 3300046501 | Bacteria | 1196 |
| 399 | Ga0495607_0160128 | 3300046501 | Bacteria | 1144 |
| 400 | Ga0495607_0172428 | 3300046501 | Bacteria | 1091 |
| 401 | Ga0495607_0432646 | 3300046501 | Bacteria | 593 |
| 402 | Ga0495583_0003303 | 3300046506 | Bacteria | 12497 |
| 403 | Ga0495583_0005912 | 3300046506 | Bacteria | 8135 |
| 404 | Ga0495583_0015210 | 3300046506 | Bacteria | 4195 |
| 405 | Ga0495583_0054252 | 3300046506 | Bacteria | 1816 |
| 406 | Ga0495606_0002059 | 3300046507 | Bacteria | 24574 |
| 407 | Ga0495606_0010030 | 3300046507 | Bacteria | 7918 |
| 408 | Ga0495606_0012549 | 3300046507 | Bacteria | 6786 |
| 409 | Ga0495606_0028902 | 3300046507 | Bacteria | 3902 |
| 410 | Ga0495606_0031441 | 3300046507 | Bacteria | 3690 |
| 411 | Ga0495606_0063547 | 3300046507 | Bacteria | 2353 |
| 412 | Ga0495606_0095142 | 3300046507 | Bacteria | 1824 |
| 413 | Ga0495606_0182069 | 3300046507 | Bacteria | 1210 |
| 414 | Ga0495610_0003562 | 3300046512 | Bacteria | 12047 |
| 415 | Ga0495610_0017421 | 3300046512 | Bacteria | 4095 |
| 416 | Ga0495610_0078905 | 3300046512 | Bacteria | 1517 |
| 417 | Ga0495610_0099923 | 3300046512 | Bacteria | 1301 |
| 418 | Ga0495610_0132180 | 3300046512 | Bacteria | 1082 |
| 419 | Ga0495610_0149441 | 3300046512 | Bacteria | 998 |
| 420 | Ga0495610_0226777 | 3300046512 | Bacteria | 751 |
| 421 | Ga0495616_0015839 | 3300046513 | Bacteria | 4182 |
| 422 | Ga0495616_0016061 | 3300046513 | Bacteria | 4148 |
| 423 | Ga0495616_0026943 | 3300046513 | Bacteria | 3053 |
| 424 | Ga0495616_0088539 | 3300046513 | Bacteria | 1469 |
| 425 | Ga0495616_0122729 | 3300046513 | Bacteria | 1197 |
| 426 | Ga0495616_0173614 | 3300046513 | Bacteria | 962 |
| 427 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 428 | Ga0495620_0003964 | 3300046515 | Bacteria | 8412 |
| 429 | Ga0495620_0016249 | 3300046515 | Bacteria | 3741 |
| 430 | Ga0495620_0033116 | 3300046515 | Bacteria | 2348 |
| 431 | Ga0495620_0055029 | 3300046515 | Bacteria | 1678 |
| 432 | Ga0495620_0116938 | 3300046515 | Bacteria | 1053 |
| 433 | Ga0495620_0166826 | 3300046515 | Bacteria | 854 |
| 434 | Ga0495631_0003979 | 3300046518 | Bacteria | 7975 |
| 435 | Ga0495631_0175205 | 3300046518 | Bacteria | 919 |
| 436 | Ga0495632_0001347 | 3300046519 | Bacteria | 20641 |
| 437 | Ga0495632_0004065 | 3300046519 | Bacteria | 10103 |
| 438 | Ga0495632_0007143 | 3300046519 | Bacteria | 7063 |
| 439 | Ga0495632_0035192 | 3300046519 | Bacteria | 2557 |
| 440 | Ga0495632_0069071 | 3300046519 | Bacteria | 1701 |
| 441 | Ga0495632_0113040 | 3300046519 | Bacteria | 1273 |
| 442 | Ga0495632_0177228 | 3300046519 | Bacteria | 977 |
| 443 | Ga0495632_0243355 | 3300046519 | Bacteria | 808 |
| 444 | Ga0495632_0314466 | 3300046519 | Bacteria | 692 |
| 445 | Ga0495637_0000149 | 3300046520 | Bacteria | 53457 |
| 446 | Ga0495637_0007327 | 3300046520 | Bacteria | 5478 |
| 447 | Ga0495637_0011093 | 3300046520 | Bacteria | 4338 |
| 448 | Ga0495637_0011109 | 3300046520 | Bacteria | 4335 |
| 449 | Ga0495637_0013477 | 3300046520 | Bacteria | 3877 |
| 450 | Ga0495637_0014036 | 3300046520 | Bacteria | 3789 |
| 451 | Ga0495637_0014639 | 3300046520 | Bacteria | 3696 |
| 452 | Ga0495637_0015843 | 3300046520 | Bacteria | 3530 |
| 453 | Ga0495637_0047522 | 3300046520 | Bacteria | 1811 |
| 454 | Ga0495637_0227254 | 3300046520 | Bacteria | 677 |
| 455 | Ga0495643_0000769 | 3300046522 | Bacteria | 35803 |
| 456 | Ga0495643_0005626 | 3300046522 | Bacteria | 8408 |
| 457 | Ga0495643_0009610 | 3300046522 | Bacteria | 5998 |
| 458 | Ga0495643_0017886 | 3300046522 | Bacteria | 4133 |
| 459 | Ga0495643_0109805 | 3300046522 | Bacteria | 1403 |
| 460 | Ga0495643_0131596 | 3300046522 | Bacteria | 1255 |
| 461 | Ga0495644_0021212 | 3300046523 | Bacteria | 2478 |
| 462 | Ga0495644_0074713 | 3300046523 | Bacteria | 1275 |
| 463 | Ga0495644_0166606 | 3300046523 | Bacteria | 845 |
| 464 | Ga0495648_0000711 | 3300046524 | Bacteria | 35493 |
| 465 | Ga0495648_0022690 | 3300046524 | Bacteria | 4313 |
| 466 | Ga0495648_0027692 | 3300046524 | Bacteria | 3789 |
| 467 | Ga0495648_0096980 | 3300046524 | Bacteria | 1636 |
| 468 | Ga0495648_0180524 | 3300046524 | Bacteria | 1073 |
| 469 | Ga0495648_0340493 | 3300046524 | Bacteria | 688 |
| 470 | Ga0495648_0347945 | 3300046524 | Bacteria | 678 |
| 471 | Ga0495666_0080959 | 3300046526 | Bacteria | 1536 |
| 472 | Ga0495666_0081840 | 3300046526 | Bacteria | 1527 |
| 473 | Ga0495652_0073029 | 3300046529 | Bacteria | 2858 |
| 474 | Ga0495654_0001376 | 3300046530 | Bacteria | 16853 |
| 475 | Ga0495654_0004365 | 3300046530 | Bacteria | 8415 |
| 476 | Ga0495654_0004632 | 3300046530 | Bacteria | 8114 |
| 477 | Ga0495654_0059938 | 3300046530 | Bacteria | 1830 |
| 478 | Ga0495654_0105365 | 3300046530 | Bacteria | 1292 |
| 479 | Ga0495654_0110267 | 3300046530 | Bacteria | 1256 |
| 480 | Ga0495654_0222468 | 3300046530 | Bacteria | 797 |
| 481 | Ga0495654_0315912 | 3300046530 | Bacteria | 634 |
| 482 | Ga0495654_0319787 | 3300046530 | Bacteria | 629 |
| 483 | Ga0495654_0343643 | 3300046530 | Bacteria | 601 |
| 484 | Ga0495654_0377031 | 3300046530 | Bacteria | 566 |
| 485 | Ga0495654_0404705 | 3300046530 | Bacteria | 541 |
| 486 | Ga0495654_0408284 | 3300046530 | Bacteria | 538 |
| 487 | Ga0495609_0004361 | 3300046538 | Bacteria | 7771 |
| 488 | Ga0495609_0006000 | 3300046538 | Bacteria | 6269 |
| 489 | Ga0495609_0016858 | 3300046538 | Bacteria | 3400 |
| 490 | Ga0495609_0138241 | 3300046538 | Bacteria | 1040 |
| 491 | Ga0495609_0396707 | 3300046538 | Bacteria | 552 |
| 492 | Ga0495597_0000040 | 3300046542 | Bacteria | 112292 |
| 493 | Ga0495597_0008842 | 3300046542 | Bacteria | 5025 |
| 494 | Ga0495597_0022385 | 3300046542 | Bacteria | 2932 |
| 495 | Ga0495597_0069355 | 3300046542 | Bacteria | 1521 |
| 496 | Ga0495597_0130498 | 3300046542 | Bacteria | 1042 |
| 497 | Ga0495597_0416659 | 3300046542 | Bacteria | 509 |
| 498 | Ga0495597_0429243 | 3300046542 | Bacteria | 500 |
| 499 | Ga0495622_0009776 | 3300046557 | Bacteria | 4433 |
| 500 | Ga0495622_0117666 | 3300046557 | Bacteria | 1214 |
| 501 | Ga0495622_0132301 | 3300046557 | Bacteria | 1135 |
| 502 | Ga0495633_0015207 | 3300046558 | Bacteria | 3998 |
| 503 | Ga0495633_0081240 | 3300046558 | Bacteria | 1508 |
| 504 | Ga0495656_0243945 | 3300046615 | Bacteria | 905 |
| 505 | Ga0495668_0019087 | 3300046616 | Bacteria | 3956 |
| 506 | Ga0495668_0134406 | 3300046616 | Bacteria | 1353 |
| 507 | Ga0495668_0776499 | 3300046616 | Bacteria | 530 |
| 508 | Ga0495634_0096465 | 3300046642 | Bacteria | 1914 |
| 509 | Ga0495611_0002323 | 3300046648 | Bacteria | 8801 |
| 510 | Ga0495625_0009413 | 3300046660 | Bacteria | 8173 |
| 511 | Ga0495625_0012425 | 3300046660 | Bacteria | 6899 |
| 512 | Ga0495625_0022126 | 3300046660 | Bacteria | 4879 |
| 513 | Ga0495625_0030882 | 3300046660 | Bacteria | 3991 |
| 514 | Ga0495625_0044181 | 3300046660 | Bacteria | 3227 |
| 515 | Ga0495625_0340986 | 3300046660 | Bacteria | 949 |
| 516 | Ga0495625_0386123 | 3300046660 | Bacteria | 877 |
| 517 | Ga0495635_0184503 | 3300046663 | Bacteria | 1417 |
| 518 | Ga0495661_0003082 | 3300046665 | Bacteria | 12527 |
| 519 | Ga0495661_0021797 | 3300046665 | Bacteria | 4171 |
| 520 | Ga0495661_0131835 | 3300046665 | Bacteria | 1368 |
| 521 | Ga0495661_0234164 | 3300046665 | Bacteria | 945 |
| 522 | Ga0495661_0501788 | 3300046665 | Bacteria | 578 |
| 523 | Ga0495588_0049970 | 3300046674 | Bacteria | 2151 |
| 524 | Ga0495623_0035311 | 3300046679 | Bacteria | 3204 |
| 525 | Ga0495613_0025885 | 3300046689 | Bacteria | 4371 |
| 526 | Ga0495624_0055548 | 3300046690 | Bacteria | 2493 |
| 527 | Ga0495670_0004025 | 3300046691 | Bacteria | 7207 |
| 528 | Ga0495670_0437418 | 3300046691 | Bacteria | 708 |
| 529 | Ga0495671_0021803 | 3300046692 | Bacteria | 3360 |
| 530 | Ga0495671_0103127 | 3300046692 | Bacteria | 1393 |
| 531 | Ga0495671_0104460 | 3300046692 | Bacteria | 1383 |
| 532 | Ga0495671_0160754 | 3300046692 | Bacteria | 1092 |
| 533 | Ga0495671_0285580 | 3300046692 | Bacteria | 794 |
| 534 | Ga0495671_0306146 | 3300046692 | Bacteria | 764 |
| 535 | Ga0495671_0315213 | 3300046692 | Bacteria | 751 |
| 536 | Ga0495649_0018140 | 3300046694 | Bacteria | 3964 |
| 537 | Ga0495649_0022629 | 3300046694 | Bacteria | 3516 |
| 538 | Ga0495649_0063508 | 3300046694 | Bacteria | 1983 |
| 539 | Ga0495649_0108018 | 3300046694 | Bacteria | 1476 |
| 540 | Ga0495649_0115598 | 3300046694 | Bacteria | 1420 |
| 541 | Ga0495649_0210774 | 3300046694 | Bacteria | 1006 |
| 542 | Ga0495649_0278755 | 3300046694 | Bacteria | 854 |
| 543 | Ga0495589_0003658 | 3300046794 | Bacteria | 8309 |
| 544 | Ga0495589_0005181 | 3300046794 | Bacteria | 6893 |
| 545 | Ga0495589_0008171 | 3300046794 | Bacteria | 5470 |
| 546 | Ga0495600_0091123 | 3300046809 | Bacteria | 1989 |
| 547 | Ga0495600_0839231 | 3300046809 | Bacteria | 545 |
| 548 | Ga0495660_0002366 | 3300046810 | Bacteria | 12054 |
| 549 | Ga0495660_0002578 | 3300046810 | Bacteria | 11513 |
| 550 | Ga0495660_0007120 | 3300046810 | Bacteria | 6590 |
| 551 | Ga0495660_0085495 | 3300046810 | Bacteria | 1647 |
| 552 | Ga0495660_0097007 | 3300046810 | Bacteria | 1522 |
| 553 | Ga0495660_0122532 | 3300046810 | Bacteria | 1313 |
| 554 | Ga0495660_0404321 | 3300046810 | Bacteria | 597 |
| 555 | Ga0495660_0441687 | 3300046810 | Bacteria | 563 |
| 556 | Ga0495604_0985144 | 3300047317 | Bacteria | 522 |
| 557 | Ga0495672_0000803 | 3300047320 | Bacteria | 33779 |
| 558 | Ga0495672_0020935 | 3300047320 | Bacteria | 4275 |
| 559 | Ga0495672_0051133 | 3300047320 | Bacteria | 2435 |
| 560 | Ga0495672_0066847 | 3300047320 | Bacteria | 2049 |
| 561 | Ga0495672_0138972 | 3300047320 | Bacteria | 1270 |
| 562 | Ga0495672_0147788 | 3300047320 | Bacteria | 1221 |
| 563 | Ga0495672_0179430 | 3300047320 | Bacteria | 1073 |
| 564 | Ga0495672_0290118 | 3300047320 | Bacteria | 778 |
| 565 | Ga0495672_0492087 | 3300047320 | Bacteria | 546 |
| 566 | Ga0495676_0012839 | 3300047321 | Bacteria | 7532 |
| 567 | Ga0495676_0043747 | 3300047321 | Bacteria | 3661 |
| 568 | Ga0495680_0049810 | 3300047322 | Bacteria | 3278 |
| 569 | Ga0495680_0099463 | 3300047322 | Bacteria | 2168 |
| 570 | Ga0495680_0145082 | 3300047322 | Bacteria | 1734 |
| 571 | Ga0495680_0171096 | 3300047322 | Bacteria | 1572 |
| 572 | Ga0495683_0014352 | 3300047323 | Bacteria | 4127 |
| 573 | Ga0495683_0102791 | 3300047323 | Bacteria | 1372 |
| 574 | Ga0495683_0161101 | 3300047323 | Bacteria | 1037 |
| 575 | Ga0495683_0216360 | 3300047323 | Bacteria | 856 |
| 576 | Ga0495687_046737 | 3300047443 | Bacteria | 1866 |
| 577 | Ga0495675_0144708 | 3300047444 | Bacteria | 1471 |
| 578 | Ga0495679_001680 | 3300047446 | Bacteria | 12285 |
| 579 | Ga0495679_003292 | 3300047446 | Bacteria | 7828 |
| 580 | Ga0495679_014244 | 3300047446 | Bacteria | 2954 |
| 581 | Ga0495679_040989 | 3300047446 | Bacteria | 1436 |
| 582 | Ga0495673_0009130 | 3300047469 | Bacteria | 5503 |
| 583 | Ga0495673_0011025 | 3300047469 | Bacteria | 4888 |
| 584 | Ga0495673_0041215 | 3300047469 | Bacteria | 2080 |
| 585 | Ga0495673_0072700 | 3300047469 | Bacteria | 1442 |
| 586 | Ga0495673_0072716 | 3300047469 | Bacteria | 1442 |
| 587 | Ga0495673_0083038 | 3300047469 | Bacteria | 1323 |
| 588 | Ga0495673_0127332 | 3300047469 | Bacteria | 1003 |
| 589 | Ga0495673_0141705 | 3300047469 | Bacteria | 936 |
| 590 | Ga0495673_0150382 | 3300047469 | Bacteria | 900 |
| 591 | Ga0495681_0005872 | 3300047470 | Bacteria | 8150 |
| 592 | Ga0495681_0006996 | 3300047470 | Bacteria | 7295 |
| 593 | Ga0495681_0007376 | 3300047470 | Bacteria | 7033 |
| 594 | Ga0495681_0027957 | 3300047470 | Bacteria | 2910 |
| 595 | Ga0495681_0050121 | 3300047470 | Bacteria | 1969 |
| 596 | Ga0495681_0057337 | 3300047470 | Bacteria | 1809 |
| 597 | Ga0495681_0122671 | 3300047470 | Bacteria | 1113 |
| 598 | Ga0495681_0396557 | 3300047470 | Bacteria | 516 |
| 599 | Ga0495684_0137497 | 3300047471 | Bacteria | 1833 |
| 600 | Ga0495686_0005761 | 3300047472 | Bacteria | 9683 |
| 601 | Ga0495686_0014722 | 3300047472 | Bacteria | 5375 |
| 602 | Ga0495686_0034281 | 3300047472 | Bacteria | 3270 |
| 603 | Ga0495686_0264041 | 3300047472 | Bacteria | 963 |
| 604 | Ga0495686_0270277 | 3300047472 | Bacteria | 948 |
| 605 | Ga0495602_0050423 | 3300048088 | Bacteria | 3718 |
| 606 | Ga0495626_0002482 | 3300048091 | Bacteria | 12763 |
| 607 | Ga0495626_0007969 | 3300048091 | Bacteria | 5853 |
| 608 | Ga0495626_0033237 | 3300048091 | Bacteria | 2473 |
| 609 | Ga0496100_0412805 | 3300048903 | Bacteria | 1030 |
| 610 | Ga0496108_0221973 | 3300048911 | Bacteria | 1642 |
| 611 | Ga0496110_0140537 | 3300048913 | Bacteria | 2183 |
| 612 | Ga0496110_1168787 | 3300048913 | Bacteria | 678 |
| 613 | Ga0496110_1520227 | 3300048913 | Bacteria | 579 |
| 614 | Ga0496111_0289461 | 3300048914 | Bacteria | 1215 |
| 615 | Ga0496111_0962508 | 3300048914 | Bacteria | 613 |
| 616 | Ga0496114_0161901 | 3300048917 | Bacteria | 1946 |
| 617 | Ga0496114_1555243 | 3300048917 | Bacteria | 549 |
| 618 | Ga0496116_0000999 | 3300048919 | Bacteria | 34585 |
| 619 | Ga0496116_0004955 | 3300048919 | Bacteria | 12543 |
| 620 | Ga0496116_0015031 | 3300048919 | Bacteria | 6138 |
| 621 | Ga0496116_0196738 | 3300048919 | Bacteria | 1060 |
| 622 | Ga0496117_0001374 | 3300048920 | Bacteria | 35457 |
| 623 | Ga0496117_0003526 | 3300048920 | Bacteria | 18097 |
| 624 | Ga0496117_0006099 | 3300048920 | Bacteria | 12344 |
| 625 | Ga0496117_0011495 | 3300048920 | Bacteria | 7924 |
| 626 | Ga0496117_0013502 | 3300048920 | Bacteria | 7120 |
| 627 | Ga0496117_0017282 | 3300048920 | Bacteria | 6031 |
| 628 | Ga0496117_0030905 | 3300048920 | Bacteria | 4099 |
| 629 | Ga0496117_0043173 | 3300048920 | Bacteria | 3281 |
| 630 | Ga0496117_0074301 | 3300048920 | Bacteria | 2263 |
| 631 | Ga0496117_0082952 | 3300048920 | Bacteria | 2097 |
| 632 | Ga0496117_0090820 | 3300048920 | Bacteria | 1966 |
| 633 | Ga0496117_0095919 | 3300048920 | Bacteria | 1893 |
| 634 | Ga0496117_0497113 | 3300048920 | Bacteria | 592 |
| 635 | Ga0496117_0547954 | 3300048920 | Bacteria | 551 |
| 636 | Ga0496118_0014465 | 3300048921 | Bacteria | 7384 |
| 637 | Ga0496118_0017390 | 3300048921 | Bacteria | 6547 |
| 638 | Ga0496118_0024382 | 3300048921 | Bacteria | 5221 |
| 639 | Ga0496118_0042899 | 3300048921 | Bacteria | 3562 |
| 640 | Ga0496118_0056299 | 3300048921 | Bacteria | 2957 |
| 641 | Ga0496118_0113685 | 3300048921 | Bacteria | 1787 |
| 642 | Ga0496118_0114159 | 3300048921 | Bacteria | 1781 |
| 643 | Ga0496118_0116526 | 3300048921 | Bacteria | 1755 |
| 644 | Ga0496118_0141667 | 3300048921 | Bacteria | 1522 |
| 645 | Ga0496118_0167625 | 3300048921 | Bacteria | 1347 |
| 646 | Ga0496118_0240266 | 3300048921 | Bacteria | 1037 |
| 647 | Ga0496118_0309661 | 3300048921 | Bacteria | 862 |
| 648 | Ga0496119_0001590 | 3300048922 | Bacteria | 27017 |
| 649 | Ga0496119_0037432 | 3300048922 | Bacteria | 3151 |
| 650 | Ga0496119_0551517 | 3300048922 | Bacteria | 530 |
| 651 | Ga0496120_0007481 | 3300048923 | Bacteria | 8112 |
| 652 | Ga0496120_0034739 | 3300048923 | Bacteria | 3017 |
| 653 | Ga0496121_0002354 | 3300048924 | Bacteria | 29143 |
| 654 | Ga0496121_0016619 | 3300048924 | Bacteria | 7583 |
| 655 | Ga0496121_0020740 | 3300048924 | Bacteria | 6480 |
| 656 | Ga0496121_0046064 | 3300048924 | Bacteria | 3737 |
| 657 | Ga0496121_0107503 | 3300048924 | Bacteria | 2136 |
| 658 | Ga0496121_0245921 | 3300048924 | Bacteria | 1243 |
| 659 | Ga0496121_0247835 | 3300048924 | Bacteria | 1237 |
| 660 | Ga0496122_0001232 | 3300048925 | Bacteria | 43246 |
| 661 | Ga0496122_0015945 | 3300048925 | Bacteria | 7150 |
| 662 | Ga0496122_0030731 | 3300048925 | Bacteria | 4491 |
| 663 | Ga0496122_0035390 | 3300048925 | Bacteria | 4063 |
| 664 | Ga0496122_0091273 | 3300048925 | Bacteria | 2074 |
| 665 | Ga0496122_0094246 | 3300048925 | Bacteria | 2027 |
| 666 | Ga0496122_0121958 | 3300048925 | Bacteria | 1678 |
| 667 | Ga0496122_0369638 | 3300048925 | Bacteria | 741 |
| 668 | Ga0496123_0001000 | 3300048926 | Bacteria | 43259 |
| 669 | Ga0496123_0002775 | 3300048926 | Bacteria | 20879 |
| 670 | Ga0496123_0035262 | 3300048926 | Bacteria | 3568 |
| 671 | Ga0496123_0084183 | 3300048926 | Bacteria | 1918 |
| 672 | Ga0496123_0111848 | 3300048926 | Bacteria | 1559 |
| 673 | Ga0496123_0120782 | 3300048926 | Bacteria | 1474 |
| 674 | Ga0496123_0229929 | 3300048926 | Bacteria | 929 |
| 675 | Ga0496123_0286835 | 3300048926 | Bacteria | 792 |
| 676 | Ga0496123_0476110 | 3300048926 | Bacteria | 550 |
| 677 | Ga0496124_0000692 | 3300048927 | Bacteria | 55225 |
| 678 | Ga0496124_0005321 | 3300048927 | Bacteria | 14548 |
| 679 | Ga0496124_0006823 | 3300048927 | Bacteria | 12322 |
| 680 | Ga0496124_0018847 | 3300048927 | Bacteria | 6445 |
| 681 | Ga0496124_0020869 | 3300048927 | Bacteria | 6043 |
| 682 | Ga0496124_0023760 | 3300048927 | Bacteria | 5587 |
| 683 | Ga0496124_0031447 | 3300048927 | Bacteria | 4697 |
| 684 | Ga0496124_0154995 | 3300048927 | Bacteria | 1792 |
| 685 | Ga0496124_0219010 | 3300048927 | Bacteria | 1433 |
| 686 | Ga0496124_0274877 | 3300048927 | Bacteria | 1231 |
| 687 | Ga0496124_0388178 | 3300048927 | Bacteria | 973 |
| 688 | Ga0496124_0491430 | 3300048927 | Bacteria | 825 |
| 689 | Ga0496124_0645513 | 3300048927 | Bacteria | 680 |
| 690 | Ga0496124_0941614 | 3300048927 | Bacteria | 520 |
| 691 | Ga0496125_0003047 | 3300048928 | Bacteria | 20950 |
| 692 | Ga0496125_0006600 | 3300048928 | Bacteria | 12493 |
| 693 | Ga0496125_0016145 | 3300048928 | Bacteria | 7181 |
| 694 | Ga0496125_0019994 | 3300048928 | Bacteria | 6295 |
| 695 | Ga0496125_0033148 | 3300048928 | Bacteria | 4576 |
| 696 | Ga0496125_0040766 | 3300048928 | Bacteria | 3979 |
| 697 | Ga0496125_0050064 | 3300048928 | Bacteria | 3463 |
| 698 | Ga0496125_0068412 | 3300048928 | Bacteria | 2794 |
| 699 | Ga0496125_0092167 | 3300048928 | Bacteria | 2267 |
| 700 | Ga0496125_0367109 | 3300048928 | Bacteria | 853 |
| 701 | Ga0496125_0566381 | 3300048928 | Bacteria | 627 |
| 702 | Ga0496126_0016268 | 3300048929 | Bacteria | 7445 |
| 703 | Ga0496126_0020312 | 3300048929 | Bacteria | 6517 |
| 704 | Ga0496126_0020749 | 3300048929 | Bacteria | 6431 |
| 705 | Ga0496126_0081434 | 3300048929 | Bacteria | 2862 |
| 706 | Ga0496126_0113931 | 3300048929 | Bacteria | 2353 |
| 707 | Ga0495678_004246 | 3300049459 | Bacteria | 8391 |
| 708 | Ga0495678_004646 | 3300049459 | Bacteria | 7876 |
| 709 | Ga0495678_014303 | 3300049459 | Bacteria | 3694 |
| 710 | Ga0495678_039540 | 3300049459 | Bacteria | 1902 |
| 711 | Ga0495678_041250 | 3300049459 | Bacteria | 1848 |
| 712 | Ga0495678_066853 | 3300049459 | Bacteria | 1329 |
| 713 | Ga0495678_111583 | 3300049459 | Bacteria | 931 |
| 714 | Ga0495678_137838 | 3300049459 | Bacteria | 801 |
| 715 | Ga0495682_0000424 | 3300049460 | Bacteria | 29663 |
| 716 | Ga0495682_0007815 | 3300049460 | Bacteria | 4235 |
| 717 | Ga0495682_0016369 | 3300049460 | Bacteria | 2807 |
| 718 | Ga0495682_0135606 | 3300049460 | Bacteria | 879 |
| 719 | Ga0501034_0000020 | 3300049571 | Bacteria | 280294 |
| 720 | Ga0501034_0000338 | 3300049571 | Bacteria | 81772 |
| 721 | Ga0501036_0165148 | 3300049572 | Unclassified | 1866 |
| 722 | Ga0501038_0277868 | 3300049574 | Unclassified | 1319 |
| 723 | Ga0501202_117630 | 3300049652 | Bacteria | 665 |
| 724 | Ga0501241_041058 | 3300049758 | Bacteria | 896 |
| 725 | Ga0501241_050351 | 3300049758 | Bacteria | 822 |
| 726 | Ga0501269_049290 | 3300049766 | Bacteria | 576 |
| 727 | Ga0501204_007269 | 3300049850 | Bacteria | 1243 |
| 728 | Ga0501226_000079 | 3300049853 | Bacteria | 29272 |
| 729 | nmdc:mga00v17_784893_c1 | 3300050491 | Bacteria | 607 |
| 730 | nmdc:mga00v17_962731_c1 | 3300050491 | Bacteria | 538 |
| 731 | nmdc:mga08x19_371992_c1 | 3300050514 | Bacteria | 1000 |
| 732 | Ga0500572_002751 | 3300053111 | Bacteria | 4148 |
| 733 | Ga0500659_0009338 | 3300053135 | Bacteria | 5387 |
| 734 | Ga0500573_0029698 | 3300053140 | Bacteria | 3151 |
| 735 | Ga0500634_0000688 | 3300053161 | Bacteria | 11588 |
| 736 | 2511266556 | 2511231006 | Bacteria | 6794709 |
| 737 | 2511317309 | 2511231015 | Bacteria | 6598026 |
| 738 | 2511369146 | 2511231023 | Bacteria | 6808468 |
| 739 | 2511375294 | 2511231024 | Bacteria | 5835885 |
| 740 | 2511411118 | 2511231031 | Bacteria | 6558529 |
| 741 | 2512328308 | 2512047018 | Bacteria | 6663241 |
| 742 | 2555247739 | 2554235231 | Bacteria | 5215788 |
| 743 | 2555668039 | 2554235341 | Bacteria | 6867980 |
| 744 | 2583790481 | 2582580891 | Bacteria | 6800976 |
| 745 | 2597856254 | 2597489887 | Bacteria | 6666321 |
| 746 | 2597865804 | 2597489888 | Bacteria | 6179543 |
| 747 | 2597871619 | 2597489889 | Bacteria | 6297495 |
| 748 | 2599328376 | 2599185155 | Bacteria | 5827168 |
| 749 | 2599355038 | 2599185160 | Bacteria | 6844013 |
| 750 | 2599361138 | 2599185161 | Bacteria | 6960462 |
| 751 | 2599367460 | 2599185162 | Bacteria | 6957254 |
| 752 | 2599374250 | 2599185163 | Bacteria | 6995158 |
| 753 | 2599380144 | 2599185164 | Bacteria | 6841688 |
| 754 | 2599386591 | 2599185165 | Bacteria | 6843250 |
| 755 | 2599393108 | 2599185166 | Bacteria | 6959206 |
| 756 | 2599399847 | 2599185167 | Bacteria | 6353609 |
| 757 | 2599404875 | 2599185168 | Bacteria | 6997636 |
| 758 | 2599452630 | 2599185179 | Bacteria | 6611171 |
| 759 | 2599461872 | 2599185181 | Bacteria | 6844519 |
| 760 | 2599467085 | 2599185182 | Bacteria | 6883168 |
| 761 | 2599483490 | 2599185185 | Bacteria | 6652270 |
| 762 | 2599491035 | 2599185186 | Bacteria | 6831633 |
| 763 | 2599502945 | 2599185188 | Bacteria | 6164180 |
| 764 | 2599508286 | 2599185189 | Bacteria | 5862825 |
| 765 | 2599514301 | 2599185190 | Bacteria | 6285678 |
| 766 | 2599521575 | 2599185191 | Bacteria | 6297582 |
| 767 | 2599805396 | 2599185257 | Bacteria | 6492581 |
| 768 | 2599881892 | 2599185288 | Bacteria | 6666191 |
| 769 | 2599893677 | 2599185290 | Bacteria | 6289611 |
| 770 | 2599951666 | 2599185303 | Bacteria | 6512725 |
| 771 | 2599996043 | 2599185311 | Bacteria | 6354990 |
| 772 | 2600214494 | 2599185356 | Bacteria | 6843884 |
| 773 | 2600364102 | 2600254931 | Bacteria | 6734225 |
| 774 | 2600442465 | 2600254954 | Bacteria | 5100516 |
| 775 | 2601692748 | 2600255296 | Bacteria | 5784754 |
| 776 | 2601774801 | 2600255313 | Bacteria | 6842543 |
| 777 | 2602012399 | 2600255389 | Bacteria | 5275336 |
| 778 | 2608381292 | 2606217733 | Bacteria | 6360972 |
| 779 | 2621297737 | 2619619299 | Bacteria | 6649820 |
| 780 | 2643844247 | 2643221565 | Bacteria | 6216018 |
| 781 | 2643873622 | 2643221571 | Bacteria | 6228673 |
| 782 | 2644623412 | 2643221713 | Bacteria | 6554480 |
| 783 | 2671097639 | 2667528171 | Bacteria | 6900659 |
| 784 | 2671767868 | 2671180172 | Bacteria | 6495783 |
| 785 | 2677897962 | 2675903420 | Bacteria | 6247433 |
| 786 | 2715750817 | 2713897148 | Bacteria | 5883533 |
| 787 | 2723250536 | 2721755607 | Bacteria | 5841722 |
| 788 | 2738749305 | 2738541282 | Bacteria | 6593925 |
| 789 | 2738811326 | 2738541294 | Bacteria | 6925949 |
| 790 | 2738858346 | 2738541303 | Bacteria | 6591772 |
| 791 | 2738898686 | 2738541309 | Bacteria | 6926455 |
| 792 | 2739286518 | 2738543020 | Bacteria | 5718238 |
| 793 | 2739291831 | 2738543021 | Bacteria | 5718241 |
| 794 | 2739316421 | 2738543025 | Bacteria | 6600348 |
| 795 | 2743735663 | 2740892503 | Bacteria | 6855563 |
| 796 | 2765582213 | 2765235841 | Bacteria | 6137024 |
| 797 | 2784260457 | 2784132063 | Bacteria | 6262788 |
| 798 | 2807409926 | 2806310737 | Bacteria | 5751088 |
| 799 | 2807458273 | 2806310745 | Bacteria | 5742165 |
| 800 | 2808906903 | 2808606373 | Bacteria | 4423627 |
| 801 | 2808921882 | 2808606376 | Bacteria | 6248667 |
| 802 | 2808928757 | 2808606377 | Bacteria | 6646337 |
| 803 | 2808941123 | 2808606379 | Bacteria | 5022697 |
| 804 | 2808944003 | 2808606380 | Bacteria | 6248705 |
| 805 | 2808950878 | 2808606381 | Bacteria | 6646461 |
| 806 | 2808960449 | 2808606382 | Bacteria | 6841132 |
| 807 | 2808980232 | 2808606385 | Bacteria | 6711065 |
| 808 | 2808995945 | 2808606388 | Bacteria | 6706662 |
| 809 | 2817493129 | 2816332298 | Bacteria | 6852809 |
| 810 | 2819658373 | 2818991456 | Bacteria | 6123676 |
| 811 | 2819702722 | 2818991464 | Bacteria | 6907494 |
| 812 | 2823422538 | 2823421272 | Bacteria | 5372474 |
| 813 | 2826584138 | 2826581358 | Bacteria | 5963467 |
| 814 | 2834034228 | 2834028612 | Bacteria | 6354979 |
| 815 | 2842808887 | 2842805378 | Bacteria | 5385175 |
| 816 | 2842820904 | 2842815866 | Bacteria | 5947510 |
| 817 | 2842829758 | 2842826826 | Bacteria | 5974129 |
| 818 | 2842835713 | 2842832357 | Bacteria | 5959113 |
| 819 | 2842841899 | 2842837860 | Bacteria | 6066181 |
| 820 | 2842847460 | 2842843487 | Bacteria | 6004777 |
| 821 | 2842849687 | 2842849001 | Bacteria | 5924277 |
| 822 | 2844668540 | 2844665904 | Bacteria | 6817974 |
| 823 | 2852612481 | 2852612431 | Bacteria | 6885235 |
| 824 | 2852662826 | 2852657418 | Bacteria | 6472974 |
| 825 | 2852669783 | 2852667396 | Bacteria | 6885555 |
| 826 | 2860872217 | 2860867994 | Bacteria | 5645326 |
| 827 | 2878030782 | 2878029506 | Bacteria | 6418441 |
| 828 | 2880231694 | 2880230671 | Bacteria | 6140320 |
| 829 | 2904520729 | 2904518522 | Bacteria | 6068986 |
| 830 | 2912964858 | 2912963787 | Bacteria | 5646108 |
| 831 | 2917071800 | 2917070673 | Bacteria | 6868303 |
| 832 | 2919067268 | 2919063839 | Bacteria | 6302690 |
| 833 | 2919158015 | 2919155634 | Bacteria | 4860545 |
| 834 | 2919385833 | 2919385768 | Bacteria | 5897293 |
| 835 | 2919492789 | 2919487758 | Bacteria | 5929766 |
| 836 | 2919505023 | 2919501602 | Bacteria | 5286340 |
| 837 | 2923154672 | 2923153595 | Bacteria | 6870622 |
| 838 | 2926066700 | 2926063275 | Bacteria | 5285848 |
| 839 | 2929194331 | 2929189879 | Bacteria | 5930554 |
| 840 | 2931395601 | 2931390751 | Bacteria | 6273349 |
| 841 | 2935353973 | 2935353572 | Unclassified | 6955622 |
| 842 | 2939638119 | 2939636861 | Bacteria | 6297853 |
| 843 | 2939653213 | 2939651529 | Bacteria | 5895393 |
| 844 | 2945931726 | 2945928738 | Bacteria | 6053221 |
| 845 | 2945961363 | 2945961074 | Bacteria | 7342064 |
| 846 | 2946007808 | 2946006987 | Bacteria | 6705746 |
| 847 | 2946032819 | 2946027586 | Bacteria | 6049274 |
| 848 | 2947233574 | 2947233263 | Bacteria | 6439278 |
| 849 | 2969305605 | 2969304461 | Bacteria | 6601805 |
| 850 | 2984291357 | 2984286254 | Bacteria | 6702062 |
| 851 | 2998141047 | 2998139840 | Bacteria | 6073514 |
| 852 | 3007400202 | 3007395558 | Bacteria | 6755444 |
| 853 | 3007420686 | 3007419365 | Bacteria | 7026924 |
| 854 | 3007516333 | 3007511990 | Bacteria | 6481491 |
| 855 | 3007619716 | 3007614139 | Bacteria | 6053559 |
| 856 | 3007719271 | 3007718800 | Bacteria | 5971527 |
| 857 | 3007809345 | 3007803356 | Bacteria | 5931491 |
| 858 | 3007860931 | 3007855910 | Bacteria | 5637581 |
| 859 | 3007863731 | 3007861166 | Bacteria | 6045338 |
| 860 | 3007873363 | 3007872151 | Bacteria | 5268868 |
| 861 | 637318417 | 637000220 | Bacteria | 7074893 |
| 862 | 651175012 | 651053060 | Bacteria | 4689946 |
| 863 | 8011353478 | 8011350971 | Bacteria | 6158957 |
| 864 | 8015688908 | 8015687852 | Bacteria | 6613826 |
| 865 | 8019773286 | 8019769354 | Bacteria | 6924660 |
| 866 | 8034964175 | 8034962539 | Bacteria | 4884839 |
| 867 | 8052498894 | 8052494512 | Bacteria | 5765634 |
| 868 | 8054286154 | 8054285046 | Bacteria | 6919322 |
| 869 | 8054351117 | 8054347763 | Bacteria | 5901107 |
| 870 | 8054508116 | 8054503363 | Bacteria | 6101651 |
| 871 | 8054934505 | 8054929484 | Bacteria | 5599761 |
| 872 | 8055772025 | 8055770955 | Bacteria | 6827675 |
| 873 | 8055823068 | 8055817908 | Bacteria | 6609162 |
| 874 | 8056120275 | 8056115690 | Bacteria | 5527654 |
| 875 | 8056121877 | 8056120720 | Bacteria | 5758328 |
| 876 | 8056136482 | 8056131705 | Bacteria | 6107031 |
| 877 | 8056141875 | 8056137416 | Bacteria | 6147080 |
| 878 | 8056153472 | 8056148874 | Bacteria | 6479865 |
| 879 | 8056162739 | 8056161164 | Bacteria | 6106669 |
| 880 | 8056170004 | 8056166840 | Bacteria | 5820959 |
| 881 | 8056176138 | 8056172158 | Bacteria | 6133900 |
| 882 | 8056569697 | 8056569372 | Bacteria | 5997322 |
| 883 | 8057803314 | 8057798959 | Bacteria | 6713499 |
| 884 | Ga0182008_10062189 | |||
| 885 | SwRhRL2b_contig_1442390 | |||
| 886 | JGI25163J39215_1004342 | |||
| 887 | JGI25163J39215_1004908 | |||
| 888 | JGI25164J39214_1000703 | |||
| 889 | JGI25165J46597_1001416 | |||
| 890 | Ga0055539_1000037 | |||
| 891 | Ga0055533_1000047 | |||
| 892 | Ga0055532_1000129 | |||
| 893 | Ga0055525_1000271 | |||
| 894 | Ga0055536_1000723 | |||
| 895 | Ga0055534_1036827 | |||
| 896 | Ga0055530_10001304 | |||
| 897 | Ga0055530_10002470 | |||
| 898 | Ga0055540_1000806 | |||
| 899 | Ga0055541_1000025 | |||
| 900 | Ga0065714_10065440 | |||
| 901 | Ga0065714_10347748 | |||
| 902 | Ga0065714_10477409 | |||
| 903 | Ga0065704_10015268 | |||
| 904 | Ga0065704_10018014 | |||
| 905 | Ga0065704_10046174 | |||
| 906 | Ga0065704_10095455 | |||
| 907 | Ga0065704_10114970 | |||
| 908 | Ga0065704_10233039 | |||
| 909 | Ga0065712_10068567 | |||
| 910 | Ga0070670_100002907 | |||
| 911 | Ga0070670_100028293 | |||
| 912 | Ga0070661_100000022 | |||
| 913 | Ga0070674_102234697 | |||
| 914 | Ga0070659_100917259 | |||
| 915 | Ga0070663_101323870 | |||
| 916 | Ga0070662_100000041 | |||
| 917 | Ga0070662_100127964 | |||
| 918 | Ga0068853_100009803 | |||
| 919 | Ga0070665_100008895 | |||
| 920 | Ga0070665_100328593 | |||
| 921 | Ga0070665_101349354 | |||
| 922 | Ga0070665_101807467 | |||
| 923 | Ga0070664_100000088 | |||
| 924 | Ga0068854_100013980 | |||
| 925 | Ga0068851_10000044 | |||
| 926 | Ga0075364_10104773 | |||
| 927 | Ga0075364_10287067 | |||
| 928 | Ga0075432_10110299 | |||
| 929 | Ga0075432_10292168 | |||
| 930 | Ga0075362_10395373 | |||
| 931 | Ga0075369_10447936 | |||
| 932 | Ga0075436_100192079 | |||
| 933 | Ga0075436_100205541 | |||
| 934 | Ga0075436_100417703 | |||
| 935 | Ga0099823_1000052 | |||
| 936 | Ga0079104_1047468 | |||
| 937 | Ga0105251_10000151 | |||
| 938 | Ga0105251_10000156 | |||
| 939 | Ga0105251_10002615 | |||
| 940 | Ga0105251_10005925 | |||
| 941 | Ga0105251_10008174 | |||
| 942 | Ga0105251_10024252 | |||
| 943 | Ga0105251_10031154 | |||
| 944 | Ga0105251_10041365 | |||
| 945 | Ga0105251_10052601 | |||
| 946 | Ga0105251_10057026 | |||
| 947 | Ga0105251_10063879 | |||
| 948 | Ga0105251_10117510 | |||
| 949 | Ga0105251_10164436 | |||
| 950 | Ga0105251_10188254 | |||
| 951 | Ga0105251_10209749 | |||
| 952 | Ga0105251_10217369 | |||
| 953 | Ga0105251_10302966 | |||
| 954 | Ga0105244_10000074 | |||
| 955 | Ga0105244_10000724 | |||
| 956 | Ga0105244_10003567 | |||
| 957 | Ga0105244_10005787 | |||
| 958 | Ga0105244_10014340 | |||
| 959 | Ga0105244_10018455 | |||
| 960 | Ga0105244_10023141 | |||
| 961 | Ga0105244_10027560 | |||
| 962 | Ga0105244_10032297 | |||
| 963 | Ga0105244_10055931 | |||
| 964 | Ga0105244_10083518 | |||
| 965 | Ga0105244_10098306 | |||
| 966 | Ga0105244_10101998 | |||
| 967 | Ga0105244_10123021 | |||
| 968 | Ga0105244_10222041 | |||
| 969 | Ga0105244_10225462 | |||
| 970 | Ga0105244_10240968 | |||
| 971 | Ga0105244_10267915 | |||
| 972 | Ga0105244_10339495 | |||
| 973 | Ga0105250_10000427 | |||
| 974 | Ga0105250_10000446 | |||
| 975 | Ga0105250_10005700 | |||
| 976 | Ga0105250_10009794 | |||
| 977 | Ga0105250_10045205 | |||
| 978 | Ga0105250_10098877 | |||
| 979 | Ga0105250_10118902 | |||
| 980 | Ga0105250_10122498 | |||
| 981 | Ga0105250_10132506 | |||
| 982 | Ga0105250_10148069 | |||
| 983 | Ga0105250_10195089 | |||
| 984 | Ga0105250_10270659 | |||
| 985 | Ga0105243_10001292 | |||
| 986 | Ga0105243_10001345 | |||
| 987 | Ga0105243_10011029 | |||
| 988 | Ga0105243_10039461 | |||
| 989 | Ga0105243_10049266 | |||
| 990 | Ga0105243_10118381 | |||
| 991 | Ga0105242_10134779 | |||
| 992 | Ga0105237_10001113 | |||
| 993 | Ga0105249_10093764 | |||
| 994 | Ga0105246_10000856 | |||
| 995 | Ga0105246_10003908 | |||
| 996 | Ga0105246_10125609 | |||
| 997 | Ga0157336_1010472 | |||
| 998 | Ga0157345_1000706 | |||
| 999 | Ga0157347_1013960 | |||
| 1000 | Ga0157373_10014045 | |||
| 1001 | Ga0157373_10016307 | |||
| 1002 | Ga0157373_10018124 | |||
| 1003 | Ga0157373_10164053 | |||
| 1004 | Ga0157373_10217843 | |||
| 1005 | Ga0157373_10425881 | |||
| 1006 | Ga0157373_10976798 | |||
| 1007 | Ga0157371_10002116 | |||
| 1008 | Ga0157371_10002403 | |||
| 1009 | Ga0157371_10006388 | |||
| 1010 | Ga0157370_10080216 | |||
| 1011 | Ga0157370_10142756 | |||
| 1012 | Ga0157370_10534922 | |||
| 1013 | Ga0157370_10545025 | |||
| 1014 | Ga0157370_11060627 | |||
| 1015 | Ga0157369_10015853 | |||
| 1016 | Ga0157369_10259708 | |||
| 1017 | Ga0157369_10544127 | |||
| 1018 | Ga0157369_11142078 | |||
| 1019 | Ga0157369_11238255 | |||
| 1020 | Ga0163162_10003878 | |||
| 1021 | Ga0163162_10015992 | |||
| 1022 | Ga0163162_10020659 | |||
| 1023 | Ga0163162_12246387 | |||
| 1024 | Ga0157372_10012341 | |||
| 1025 | Ga0157372_10022670 | |||
| 1026 | Ga0157375_11133704 | |||
| 1027 | Ga0157375_12878832 | |||
| 1028 | Ga0182008_10000570 | |||
| 1029 | Ga0182008_10121858 | |||
| 1030 | Ga0182008_10177395 | |||
| 1031 | Ga0182008_10254779 | |||
| 1032 | Ga0182008_10300384 | |||
| 1033 | Ga0182006_1001124 | |||
| 1034 | Ga0182006_1009185 | |||
| 1035 | Ga0182006_1011257 | |||
| 1036 | Ga0182006_1118697 | |||
| 1037 | Ga0182006_1132864 | |||
| 1038 | Ga0182005_1020832 | |||
| 1039 | Ga0182005_1092268 | |||
| 1040 | Ga0163161_10002724 | |||
| 1041 | Ga0163161_10003020 | |||
| 1042 | Ga0163161_10006539 | |||
| 1043 | Ga0163161_10493788 | |||
| 1044 | Ga0209435_100880 | |||
| 1045 | Ga0209760_100248 | |||
| 1046 | Ga0209760_100553 | |||
| 1047 | Ga0209784_100032 | |||
| 1048 | Ga0209566_100036 | |||
| 1049 | Ga0209674_100054 | |||
| 1050 | Ga0209147_100055 | |||
| 1051 | Ga0209563_100055 | |||
| 1052 | Ga0209563_100693 | |||
| 1053 | Ga0207427_100004 | |||
| 1054 | Ga0209437_100028 | |||
| 1055 | Ga0209437_116779 | |||
| 1056 | Ga0209258_100283 | |||
| 1057 | Ga0209646_1000462 | |||
| 1058 | Ga0209026_1015738 | |||
| 1059 | Ga0209677_100033 | |||
| 1060 | Ga0209759_1016440 | |||
| 1061 | Ga0209233_1000008 | |||
| 1062 | Ga0209676_1000056 | |||
| 1063 | Ga0209676_1000551 | |||
| 1064 | Ga0209050_1001645 | |||
| 1065 | Ga0209051_1000061 | |||
| 1066 | Ga0207656_10000022 | |||
| 1067 | Ga0207696_1000032 | |||
| 1068 | Ga0207696_1000034 | |||
| 1069 | Ga0207696_1000129 | |||
| 1070 | Ga0207696_1000340 | |||
| 1071 | Ga0207696_1004452 | |||
| 1072 | Ga0207696_1026381 | |||
| 1073 | Ga0207696_1031615 | |||
| 1074 | Ga0207696_1095840 | |||
| 1075 | Ga0207696_1124543 | |||
| 1076 | Ga0207696_1129559 | |||
| 1077 | Ga0207696_1159881 | |||
| 1078 | Ga0207655_1000357 | |||
| 1079 | Ga0207655_1000408 | |||
| 1080 | Ga0207655_1000487 | |||
| 1081 | Ga0207655_1003661 | |||
| 1082 | Ga0207655_1006079 | |||
| 1083 | Ga0207655_1006620 | |||
| 1084 | Ga0207655_1008861 | |||
| 1085 | Ga0207655_1009590 | |||
| 1086 | Ga0207655_1010833 | |||
| 1087 | Ga0207655_1016182 | |||
| 1088 | Ga0207655_1017075 | |||
| 1089 | Ga0207655_1026687 | |||
| 1090 | Ga0207655_1036740 | |||
| 1091 | Ga0207655_1042410 | |||
| 1092 | Ga0207655_1137211 | |||
| 1093 | Ga0207655_1165354 | |||
| 1094 | Ga0207713_1000014 | |||
| 1095 | Ga0207713_1000163 | |||
| 1096 | Ga0207713_1001339 | |||
| 1097 | Ga0207713_1005506 | |||
| 1098 | Ga0207713_1008041 | |||
| 1099 | Ga0207713_1012133 | |||
| 1100 | Ga0207713_1014589 | |||
| 1101 | Ga0207713_1027582 | |||
| 1102 | Ga0207713_1028660 | |||
| 1103 | Ga0207713_1095505 | |||
| 1104 | Ga0207713_1122789 | |||
| 1105 | Ga0207713_1247938 | |||
| 1106 | Ga0207671_10000034 | |||
| 1107 | Ga0207649_10000006 | |||
| 1108 | Ga0207681_10000607 | |||
| 1109 | Ga0207650_10000092 | |||
| 1110 | Ga0207650_10001090 | |||
| 1111 | Ga0207706_10001484 | |||
| 1112 | Ga0207706_10059457 | |||
| 1113 | Ga0207686_10609229 | |||
| 1114 | Ga0207709_10000757 | |||
| 1115 | Ga0207709_10005599 | |||
| 1116 | Ga0207709_10077240 | |||
| 1117 | Ga0207709_10212080 | |||
| 1118 | Ga0207669_11127549 | |||
| 1119 | Ga0207679_10000010 | |||
| 1120 | Ga0207712_11388021 | |||
| 1121 | Ga0207640_10563537 | |||
| 1122 | Ga0207639_10003207 | |||
| 1123 | Ga0207678_11315615 | |||
| 1124 | Ga0209281_1018994 | |||
| 1125 | Ga0209281_1057859 | |||
| 1126 | Ga0209389_1000005 | |||
| 1127 | Ga0209371_1000277 | |||
| 1128 | Ga0207428_10538878 | |||
| 1129 | Ga0268266_10010027 | |||
| 1130 | Ga0268266_10323293 | |||
| 1131 | Ga0268266_10503939 | |||
| 1132 | Ga0268266_10979137 | |||
| 1133 | Ga0268256_1000315 | |||
| 1134 | Ga0268256_1022197 | |||
| 1135 | Ga0307511_10254534 | |||
| 1136 | Ga0316183_1131894 | |||
| 1137 | Ga0316183_1206930 | |||
| 1138 | Ga0307509_10866175 | |||
| 1139 | Ga0307408_100061680 | |||
| 1140 | Ga0307514_10378887 | |||
| 1141 | Ga0307516_10438332 | |||
| 1142 | Ga0307405_10000772 | |||
| 1143 | Ga0307405_10005627 | |||
| 1144 | Ga0307413_10122108 | |||
| 1145 | Ga0307413_10907794 | |||
| 1146 | Ga0307407_10121169 | |||
| 1147 | Ga0307412_10000233 | |||
| 1148 | Ga0307412_10786722 | |||
| 1149 | Ga0307412_10799557 | |||
| 1150 | Ga0307412_10966253 | |||
| 1151 | Ga0307412_11141867 | |||
| 1152 | Ga0307412_11335910 | |||
| 1153 | Ga0307409_101006922 | |||
| 1154 | Ga0307416_101070791 | |||
| 1155 | Ga0307414_10043834 | |||
| 1156 | Ga0307414_10383068 | |||
| 1157 | Ga0307414_10875289 | |||
| 1158 | Ga0307411_10134137 | |||
| 1159 | Ga0307510_10008612 | |||
| 1160 | Ga0439438_001545 | |||
| 1161 | Ga0439438_001889 | |||
| 1162 | Ga0439438_018209 | |||
| 1163 | Ga0439438_067003 | |||
| 1164 | Ga0439447_011365 | |||
| 1165 | Ga0439447_016069 | |||
| 1166 | Ga0439447_018438 | |||
| 1167 | Ga0439447_034898 | |||
| 1168 | Ga0439466_0011833 | |||
| 1169 | Ga0439466_0022591 | |||
| 1170 | Ga0439466_0038734 | |||
| 1171 | Ga0439466_0082443 | |||
| 1172 | Ga0439466_0134093 | |||
| 1173 | Ga0451797_0795164 | |||
| 1174 | Ga0451837_1779630 | |||
| 1175 | Ga0451841_0884857 | |||
| 1176 | Ga0439431_0022692 | |||
| 1177 | Ga0439432_000198 | |||
| 1178 | Ga0439432_000272 | |||
| 1179 | Ga0439432_051602 | |||
| 1180 | Ga0439432_107354 | |||
| 1181 | Ga0439451_002129 | |||
| 1182 | Ga0439451_002955 | |||
| 1183 | Ga0439451_004570 | |||
| 1184 | Ga0439451_006684 | |||
| 1185 | Ga0439452_001129 | |||
| 1186 | Ga0439452_012768 | |||
| 1187 | Ga0439452_037852 | |||
| 1188 | Ga0439456_000173 | |||
| 1189 | Ga0439456_013117 | |||
| 1190 | Ga0439456_017969 | |||
| 1191 | Ga0439456_101385 | |||
| 1192 | Ga0439463_004835 | |||
| 1193 | Ga0439463_026452 | |||
| 1194 | Ga0450911_000552 | |||
| 1195 | Ga0450911_008582 | |||
| 1196 | Ga0450911_019113 | |||
| 1197 | Ga0450920_010368 | |||
| 1198 | Ga0450923_062722 | |||
| 1199 | Ga0450923_187374 | |||
| 1200 | Ga0450898_000205 | |||
| 1201 | Ga0450900_015897 | |||
| 1202 | Ga0450902_002305 | |||
| 1203 | Ga0450902_021864 | |||
| 1204 | Ga0450902_040800 | |||
| 1205 | Ga0450902_045676 | |||
| 1206 | Ga0450902_069694 | |||
| 1207 | Ga0450902_091233 | |||
| 1208 | Ga0450902_102335 | |||
| 1209 | Ga0450903_022308 | |||
| 1210 | Ga0450903_049209 | |||
| 1211 | Ga0450904_000292 | |||
| 1212 | Ga0450905_000284 | |||
| 1213 | Ga0450905_031226 | |||
| 1214 | Ga0450906_000396 | |||
| 1215 | Ga0450906_012358 | |||
| 1216 | Ga0450907_056790 | |||
| 1217 | Ga0439446_0084009 | |||
| 1218 | Ga0450908_022514 | |||
| 1219 | Ga0439464_0014490 | |||
| 1220 | Ga0450893_0017687 | |||
| 1221 | Ga0450901_000018 | |||
| 1222 | Ga0450901_010503 | |||
| 1223 | Ga0439440_0028426 | |||
| 1224 | Ga0495617_002206 | |||
| 1225 | Ga0495617_055684 | |||
| 1226 | Ga0495617_081263 | |||
| 1227 | Ga0495617_138370 | |||
| 1228 | Ga0495617_191446 | |||
| 1229 | Ga0495617_273900 | |||
| 1230 | Ga0495617_278478 | |||
| 1231 | Ga0495627_000074 | |||
| 1232 | Ga0495627_002496 | |||
| 1233 | Ga0495627_009192 | |||
| 1234 | Ga0495627_063237 | |||
| 1235 | Ga0495627_079781 | |||
| 1236 | Ga0495590_0043584 | |||
| 1237 | Ga0495590_0048158 | |||
| 1238 | Ga0495591_000142 | |||
| 1239 | Ga0495591_007147 | |||
| 1240 | Ga0495591_007531 | |||
| 1241 | Ga0495591_026679 | |||
| 1242 | Ga0495591_028978 | |||
| 1243 | Ga0495591_048906 | |||
| 1244 | Ga0495591_064265 | |||
| 1245 | Ga0495591_112867 | |||
| 1246 | Ga0495591_143812 | |||
| 1247 | Ga0495638_0023362 | |||
| 1248 | Ga0495638_0024038 | |||
| 1249 | Ga0495638_0172809 | |||
| 1250 | Ga0495638_0243503 | |||
| 1251 | Ga0495638_0631736 | |||
| 1252 | Ga0495653_0072273 | |||
| 1253 | Ga0495653_0275055 | |||
| 1254 | Ga0495653_0754748 | |||
| 1255 | Ga0495650_0021495 | |||
| 1256 | Ga0495650_0041170 | |||
| 1257 | Ga0495650_0051945 | |||
| 1258 | Ga0495650_0136268 | |||
| 1259 | Ga0495650_0220946 | |||
| 1260 | Ga0495605_0008969 | |||
| 1261 | Ga0495605_0104124 | |||
| 1262 | Ga0495605_0232105 | |||
| 1263 | Ga0495584_0003442 | |||
| 1264 | Ga0495584_0004205 | |||
| 1265 | Ga0495584_0093399 | |||
| 1266 | Ga0495584_0162683 | |||
| 1267 | Ga0495584_0428590 | |||
| 1268 | Ga0495584_0459937 | |||
| 1269 | Ga0495585_0006062 | |||
| 1270 | Ga0495585_0166376 | |||
| 1271 | Ga0495596_0046741 | |||
| 1272 | Ga0495596_0342790 | |||
| 1273 | Ga0495607_0000315 | |||
| 1274 | Ga0495607_0000628 | |||
| 1275 | Ga0495607_0001499 | |||
| 1276 | Ga0495607_0016720 | |||
| 1277 | Ga0495607_0018105 | |||
| 1278 | Ga0495607_0093067 | |||
| 1279 | Ga0495607_0105311 | |||
| 1280 | Ga0495607_0147454 | |||
| 1281 | Ga0495607_0149505 | |||
| 1282 | Ga0495607_0160128 | |||
| 1283 | Ga0495607_0172428 | |||
| 1284 | Ga0495607_0432646 | |||
| 1285 | Ga0495583_0003303 | |||
| 1286 | Ga0495583_0005912 | |||
| 1287 | Ga0495583_0015210 | |||
| 1288 | Ga0495583_0054252 | |||
| 1289 | Ga0495606_0002059 | |||
| 1290 | Ga0495606_0010030 | |||
| 1291 | Ga0495606_0012549 | |||
| 1292 | Ga0495606_0028902 | |||
| 1293 | Ga0495606_0031441 | |||
| 1294 | Ga0495606_0063547 | |||
| 1295 | Ga0495606_0095142 | |||
| 1296 | Ga0495606_0182069 | |||
| 1297 | Ga0495610_0003562 | |||
| 1298 | Ga0495610_0017421 | |||
| 1299 | Ga0495610_0078905 | |||
| 1300 | Ga0495610_0099923 | |||
| 1301 | Ga0495610_0132180 | |||
| 1302 | Ga0495610_0149441 | |||
| 1303 | Ga0495610_0226777 | |||
| 1304 | Ga0495616_0015839 | |||
| 1305 | Ga0495616_0016061 | |||
| 1306 | Ga0495616_0026943 | |||
| 1307 | Ga0495616_0088539 | |||
| 1308 | Ga0495616_0122729 | |||
| 1309 | Ga0495616_0173614 | |||
| 1310 | Ga0495620_0000003 | |||
| 1311 | Ga0495620_0003964 | |||
| 1312 | Ga0495620_0016249 | |||
| 1313 | Ga0495620_0033116 | |||
| 1314 | Ga0495620_0055029 | |||
| 1315 | Ga0495620_0116938 | |||
| 1316 | Ga0495620_0166826 | |||
| 1317 | Ga0495631_0003979 | |||
| 1318 | Ga0495631_0175205 | |||
| 1319 | Ga0495632_0001347 | |||
| 1320 | Ga0495632_0004065 | |||
| 1321 | Ga0495632_0007143 | |||
| 1322 | Ga0495632_0035192 | |||
| 1323 | Ga0495632_0069071 | |||
| 1324 | Ga0495632_0113040 | |||
| 1325 | Ga0495632_0177228 | |||
| 1326 | Ga0495632_0243355 | |||
| 1327 | Ga0495632_0314466 | |||
| 1328 | Ga0495637_0000149 | |||
| 1329 | Ga0495637_0007327 | |||
| 1330 | Ga0495637_0011093 | |||
| 1331 | Ga0495637_0011109 | |||
| 1332 | Ga0495637_0013477 | |||
| 1333 | Ga0495637_0014036 | |||
| 1334 | Ga0495637_0014639 | |||
| 1335 | Ga0495637_0015843 | |||
| 1336 | Ga0495637_0047522 | |||
| 1337 | Ga0495637_0227254 | |||
| 1338 | Ga0495643_0000769 | |||
| 1339 | Ga0495643_0005626 | |||
| 1340 | Ga0495643_0009610 | |||
| 1341 | Ga0495643_0017886 | |||
| 1342 | Ga0495643_0109805 | |||
| 1343 | Ga0495643_0131596 | |||
| 1344 | Ga0495644_0021212 | |||
| 1345 | Ga0495644_0074713 | |||
| 1346 | Ga0495644_0166606 | |||
| 1347 | Ga0495648_0000711 | |||
| 1348 | Ga0495648_0022690 | |||
| 1349 | Ga0495648_0027692 | |||
| 1350 | Ga0495648_0096980 | |||
| 1351 | Ga0495648_0180524 | |||
| 1352 | Ga0495648_0340493 | |||
| 1353 | Ga0495648_0347945 | |||
| 1354 | Ga0495666_0080959 | |||
| 1355 | Ga0495666_0081840 | |||
| 1356 | Ga0495652_0073029 | |||
| 1357 | Ga0495654_0001376 | |||
| 1358 | Ga0495654_0004365 | |||
| 1359 | Ga0495654_0004632 | |||
| 1360 | Ga0495654_0059938 | |||
| 1361 | Ga0495654_0105365 | |||
| 1362 | Ga0495654_0110267 | |||
| 1363 | Ga0495654_0222468 | |||
| 1364 | Ga0495654_0315912 | |||
| 1365 | Ga0495654_0319787 | |||
| 1366 | Ga0495654_0343643 | |||
| 1367 | Ga0495654_0377031 | |||
| 1368 | Ga0495654_0404705 | |||
| 1369 | Ga0495654_0408284 | |||
| 1370 | Ga0495609_0004361 | |||
| 1371 | Ga0495609_0006000 | |||
| 1372 | Ga0495609_0016858 | |||
| 1373 | Ga0495609_0138241 | |||
| 1374 | Ga0495609_0396707 | |||
| 1375 | Ga0495597_0000040 | |||
| 1376 | Ga0495597_0008842 | |||
| 1377 | Ga0495597_0022385 | |||
| 1378 | Ga0495597_0069355 | |||
| 1379 | Ga0495597_0130498 | |||
| 1380 | Ga0495597_0416659 | |||
| 1381 | Ga0495597_0429243 | |||
| 1382 | Ga0495622_0009776 | |||
| 1383 | Ga0495622_0117666 | |||
| 1384 | Ga0495622_0132301 | |||
| 1385 | Ga0495633_0015207 | |||
| 1386 | Ga0495633_0081240 | |||
| 1387 | Ga0495656_0243945 | |||
| 1388 | Ga0495668_0019087 | |||
| 1389 | Ga0495668_0134406 | |||
| 1390 | Ga0495668_0776499 | |||
| 1391 | Ga0495634_0096465 | |||
| 1392 | Ga0495611_0002323 | |||
| 1393 | Ga0495625_0009413 | |||
| 1394 | Ga0495625_0012425 | |||
| 1395 | Ga0495625_0022126 | |||
| 1396 | Ga0495625_0030882 | |||
| 1397 | Ga0495625_0044181 | |||
| 1398 | Ga0495625_0340986 | |||
| 1399 | Ga0495625_0386123 | |||
| 1400 | Ga0495635_0184503 | |||
| 1401 | Ga0495661_0003082 | |||
| 1402 | Ga0495661_0021797 | |||
| 1403 | Ga0495661_0131835 | |||
| 1404 | Ga0495661_0234164 | |||
| 1405 | Ga0495661_0501788 | |||
| 1406 | Ga0495588_0049970 | |||
| 1407 | Ga0495623_0035311 | |||
| 1408 | Ga0495613_0025885 | |||
| 1409 | Ga0495624_0055548 | |||
| 1410 | Ga0495670_0004025 | |||
| 1411 | Ga0495670_0437418 | |||
| 1412 | Ga0495671_0021803 | |||
| 1413 | Ga0495671_0103127 | |||
| 1414 | Ga0495671_0104460 | |||
| 1415 | Ga0495671_0160754 | |||
| 1416 | Ga0495671_0285580 | |||
| 1417 | Ga0495671_0306146 | |||
| 1418 | Ga0495671_0315213 | |||
| 1419 | Ga0495649_0018140 | |||
| 1420 | Ga0495649_0022629 | |||
| 1421 | Ga0495649_0063508 | |||
| 1422 | Ga0495649_0108018 | |||
| 1423 | Ga0495649_0115598 | |||
| 1424 | Ga0495649_0210774 | |||
| 1425 | Ga0495649_0278755 | |||
| 1426 | Ga0495589_0003658 | |||
| 1427 | Ga0495589_0005181 | |||
| 1428 | Ga0495589_0008171 | |||
| 1429 | Ga0495600_0091123 | |||
| 1430 | Ga0495600_0839231 | |||
| 1431 | Ga0495660_0002366 | |||
| 1432 | Ga0495660_0002578 | |||
| 1433 | Ga0495660_0007120 | |||
| 1434 | Ga0495660_0085495 | |||
| 1435 | Ga0495660_0097007 | |||
| 1436 | Ga0495660_0122532 | |||
| 1437 | Ga0495660_0404321 | |||
| 1438 | Ga0495660_0441687 | |||
| 1439 | Ga0495604_0985144 | |||
| 1440 | Ga0495672_0000803 | |||
| 1441 | Ga0495672_0020935 | |||
| 1442 | Ga0495672_0051133 | |||
| 1443 | Ga0495672_0066847 | |||
| 1444 | Ga0495672_0138972 | |||
| 1445 | Ga0495672_0147788 | |||
| 1446 | Ga0495672_0179430 | |||
| 1447 | Ga0495672_0290118 | |||
| 1448 | Ga0495672_0492087 | |||
| 1449 | Ga0495676_0012839 | |||
| 1450 | Ga0495676_0043747 | |||
| 1451 | Ga0495680_0049810 | |||
| 1452 | Ga0495680_0099463 | |||
| 1453 | Ga0495680_0145082 | |||
| 1454 | Ga0495680_0171096 | |||
| 1455 | Ga0495683_0014352 | |||
| 1456 | Ga0495683_0102791 | |||
| 1457 | Ga0495683_0161101 | |||
| 1458 | Ga0495683_0216360 | |||
| 1459 | Ga0495687_046737 | |||
| 1460 | Ga0495675_0144708 | |||
| 1461 | Ga0495679_001680 | |||
| 1462 | Ga0495679_003292 | |||
| 1463 | Ga0495679_014244 | |||
| 1464 | Ga0495679_040989 | |||
| 1465 | Ga0495673_0009130 | |||
| 1466 | Ga0495673_0011025 | |||
| 1467 | Ga0495673_0041215 | |||
| 1468 | Ga0495673_0072700 | |||
| 1469 | Ga0495673_0072716 | |||
| 1470 | Ga0495673_0083038 | |||
| 1471 | Ga0495673_0127332 | |||
| 1472 | Ga0495673_0141705 | |||
| 1473 | Ga0495673_0150382 | |||
| 1474 | Ga0495681_0005872 | |||
| 1475 | Ga0495681_0006996 | |||
| 1476 | Ga0495681_0007376 | |||
| 1477 | Ga0495681_0027957 | |||
| 1478 | Ga0495681_0050121 | |||
| 1479 | Ga0495681_0057337 | |||
| 1480 | Ga0495681_0122671 | |||
| 1481 | Ga0495681_0396557 | |||
| 1482 | Ga0495684_0137497 | |||
| 1483 | Ga0495686_0005761 | |||
| 1484 | Ga0495686_0014722 | |||
| 1485 | Ga0495686_0034281 | |||
| 1486 | Ga0495686_0264041 | |||
| 1487 | Ga0495686_0270277 | |||
| 1488 | Ga0495602_0050423 | |||
| 1489 | Ga0495626_0002482 | |||
| 1490 | Ga0495626_0007969 | |||
| 1491 | Ga0495626_0033237 | |||
| 1492 | Ga0496100_0412805 | |||
| 1493 | Ga0496108_0221973 | |||
| 1494 | Ga0496110_0140537 | |||
| 1495 | Ga0496110_1168787 | |||
| 1496 | Ga0496110_1520227 | |||
| 1497 | Ga0496111_0289461 | |||
| 1498 | Ga0496111_0962508 | |||
| 1499 | Ga0496114_0161901 | |||
| 1500 | Ga0496114_1555243 | |||
| 1501 | Ga0496116_0000999 | |||
| 1502 | Ga0496116_0004955 | |||
| 1503 | Ga0496116_0015031 | |||
| 1504 | Ga0496116_0196738 | |||
| 1505 | Ga0496117_0001374 | |||
| 1506 | Ga0496117_0003526 | |||
| 1507 | Ga0496117_0006099 | |||
| 1508 | Ga0496117_0011495 | |||
| 1509 | Ga0496117_0013502 | |||
| 1510 | Ga0496117_0017282 | |||
| 1511 | Ga0496117_0030905 | |||
| 1512 | Ga0496117_0043173 | |||
| 1513 | Ga0496117_0074301 | |||
| 1514 | Ga0496117_0082952 | |||
| 1515 | Ga0496117_0090820 | |||
| 1516 | Ga0496117_0095919 | |||
| 1517 | Ga0496117_0497113 | |||
| 1518 | Ga0496117_0547954 | |||
| 1519 | Ga0496118_0014465 | |||
| 1520 | Ga0496118_0017390 | |||
| 1521 | Ga0496118_0024382 | |||
| 1522 | Ga0496118_0042899 | |||
| 1523 | Ga0496118_0056299 | |||
| 1524 | Ga0496118_0113685 | |||
| 1525 | Ga0496118_0114159 | |||
| 1526 | Ga0496118_0116526 | |||
| 1527 | Ga0496118_0141667 | |||
| 1528 | Ga0496118_0167625 | |||
| 1529 | Ga0496118_0240266 | |||
| 1530 | Ga0496118_0309661 | |||
| 1531 | Ga0496119_0001590 | |||
| 1532 | Ga0496119_0037432 | |||
| 1533 | Ga0496119_0551517 | |||
| 1534 | Ga0496120_0007481 | |||
| 1535 | Ga0496120_0034739 | |||
| 1536 | Ga0496121_0002354 | |||
| 1537 | Ga0496121_0016619 | |||
| 1538 | Ga0496121_0020740 | |||
| 1539 | Ga0496121_0046064 | |||
| 1540 | Ga0496121_0107503 | |||
| 1541 | Ga0496121_0245921 | |||
| 1542 | Ga0496121_0247835 | |||
| 1543 | Ga0496122_0001232 | |||
| 1544 | Ga0496122_0015945 | |||
| 1545 | Ga0496122_0030731 | |||
| 1546 | Ga0496122_0035390 | |||
| 1547 | Ga0496122_0091273 | |||
| 1548 | Ga0496122_0094246 | |||
| 1549 | Ga0496122_0121958 | |||
| 1550 | Ga0496122_0369638 | |||
| 1551 | Ga0496123_0001000 | |||
| 1552 | Ga0496123_0002775 | |||
| 1553 | Ga0496123_0035262 | |||
| 1554 | Ga0496123_0084183 | |||
| 1555 | Ga0496123_0111848 | |||
| 1556 | Ga0496123_0120782 | |||
| 1557 | Ga0496123_0229929 | |||
| 1558 | Ga0496123_0286835 | |||
| 1559 | Ga0496123_0476110 | |||
| 1560 | Ga0496124_0000692 | |||
| 1561 | Ga0496124_0005321 | |||
| 1562 | Ga0496124_0006823 | |||
| 1563 | Ga0496124_0018847 | |||
| 1564 | Ga0496124_0020869 | |||
| 1565 | Ga0496124_0023760 | |||
| 1566 | Ga0496124_0031447 | |||
| 1567 | Ga0496124_0154995 | |||
| 1568 | Ga0496124_0219010 | |||
| 1569 | Ga0496124_0274877 | |||
| 1570 | Ga0496124_0388178 | |||
| 1571 | Ga0496124_0491430 | |||
| 1572 | Ga0496124_0645513 | |||
| 1573 | Ga0496124_0941614 | |||
| 1574 | Ga0496125_0003047 | |||
| 1575 | Ga0496125_0006600 | |||
| 1576 | Ga0496125_0016145 | |||
| 1577 | Ga0496125_0019994 | |||
| 1578 | Ga0496125_0033148 | |||
| 1579 | Ga0496125_0040766 | |||
| 1580 | Ga0496125_0050064 | |||
| 1581 | Ga0496125_0068412 | |||
| 1582 | Ga0496125_0092167 | |||
| 1583 | Ga0496125_0367109 | |||
| 1584 | Ga0496125_0566381 | |||
| 1585 | Ga0496126_0016268 | |||
| 1586 | Ga0496126_0020312 | |||
| 1587 | Ga0496126_0020749 | |||
| 1588 | Ga0496126_0081434 | |||
| 1589 | Ga0496126_0113931 | |||
| 1590 | Ga0495678_004246 | |||
| 1591 | Ga0495678_004646 | |||
| 1592 | Ga0495678_014303 | |||
| 1593 | Ga0495678_039540 | |||
| 1594 | Ga0495678_041250 | |||
| 1595 | Ga0495678_066853 | |||
| 1596 | Ga0495678_111583 | |||
| 1597 | Ga0495678_137838 | |||
| 1598 | Ga0495682_0000424 | |||
| 1599 | Ga0495682_0007815 | |||
| 1600 | Ga0495682_0016369 | |||
| 1601 | Ga0495682_0135606 | |||
| 1602 | Ga0501034_0000020 | |||
| 1603 | Ga0501034_0000338 | |||
| 1604 | Ga0501036_0165148 | |||
| 1605 | Ga0501038_0277868 | |||
| 1606 | Ga0501202_117630 | |||
| 1607 | Ga0501241_041058 | |||
| 1608 | Ga0501241_050351 | |||
| 1609 | Ga0501269_049290 | |||
| 1610 | Ga0501204_007269 | |||
| 1611 | Ga0501226_000079 | |||
| 1612 | nmdc:mga00v17_784893_c1 | |||
| 1613 | nmdc:mga00v17_962731_c1 | |||
| 1614 | nmdc:mga08x19_371992_c1 | |||
| 1615 | Ga0500572_002751 | |||
| 1616 | Ga0500659_0009338 | |||
| 1617 | Ga0500573_0029698 | |||
| 1618 | Ga0500634_0000688 | |||
| 1619 | 2511266556 | |||
| 1620 | 2511317309 | |||
| 1621 | 2511369146 | |||
| 1622 | 2511375294 | |||
| 1623 | 2511411118 | |||
| 1624 | 2512328308 | |||
| 1625 | 2555247739 | |||
| 1626 | 2555668039 | |||
| 1627 | 2583790481 | |||
| 1628 | 2597856254 | |||
| 1629 | 2597865804 | |||
| 1630 | 2597871619 | |||
| 1631 | 2599328376 | |||
| 1632 | 2599355038 | |||
| 1633 | 2599361138 | |||
| 1634 | 2599367460 | |||
| 1635 | 2599374250 | |||
| 1636 | 2599380144 | |||
| 1637 | 2599386591 | |||
| 1638 | 2599393108 | |||
| 1639 | 2599399847 | |||
| 1640 | 2599404875 | |||
| 1641 | 2599452630 | |||
| 1642 | 2599461872 | |||
| 1643 | 2599467085 | |||
| 1644 | 2599483490 | |||
| 1645 | 2599491035 | |||
| 1646 | 2599502945 | |||
| 1647 | 2599508286 | |||
| 1648 | 2599514301 | |||
| 1649 | 2599521575 | |||
| 1650 | 2599805396 | |||
| 1651 | 2599881892 | |||
| 1652 | 2599893677 | |||
| 1653 | 2599951666 | |||
| 1654 | 2599996043 | |||
| 1655 | 2600214494 | |||
| 1656 | 2600364102 | |||
| 1657 | 2600442465 | |||
| 1658 | 2601692748 | |||
| 1659 | 2601774801 | |||
| 1660 | 2602012399 | |||
| 1661 | 2608381292 | |||
| 1662 | 2621297737 | |||
| 1663 | 2643844247 | |||
| 1664 | 2643873622 | |||
| 1665 | 2644623412 | |||
| 1666 | 2671097639 | |||
| 1667 | 2671767868 | |||
| 1668 | 2677897962 | |||
| 1669 | 2715750817 | |||
| 1670 | 2723250536 | |||
| 1671 | 2738749305 | |||
| 1672 | 2738811326 | |||
| 1673 | 2738858346 | |||
| 1674 | 2738898686 | |||
| 1675 | 2739286518 | |||
| 1676 | 2739291831 | |||
| 1677 | 2739316421 | |||
| 1678 | 2743735663 | |||
| 1679 | 2765582213 | |||
| 1680 | 2784260457 | |||
| 1681 | 2807409926 | |||
| 1682 | 2807458273 | |||
| 1683 | 2808906903 | |||
| 1684 | 2808921882 | |||
| 1685 | 2808928757 | |||
| 1686 | 2808941123 | |||
| 1687 | 2808944003 | |||
| 1688 | 2808950878 | |||
| 1689 | 2808960449 | |||
| 1690 | 2808980232 | |||
| 1691 | 2808995945 | |||
| 1692 | 2817493129 | |||
| 1693 | 2819658373 | |||
| 1694 | 2819702722 | |||
| 1695 | 2823422538 | |||
| 1696 | 2826584138 | |||
| 1697 | 2834034228 | |||
| 1698 | 2842808887 | |||
| 1699 | 2842820904 | |||
| 1700 | 2842829758 | |||
| 1701 | 2842835713 | |||
| 1702 | 2842841899 | |||
| 1703 | 2842847460 | |||
| 1704 | 2842849687 | |||
| 1705 | 2844668540 | |||
| 1706 | 2852612481 | |||
| 1707 | 2852662826 | |||
| 1708 | 2852669783 | |||
| 1709 | 2860872217 | |||
| 1710 | 2878030782 | |||
| 1711 | 2880231694 | |||
| 1712 | 2904520729 | |||
| 1713 | 2912964858 | |||
| 1714 | 2917071800 | |||
| 1715 | 2919067268 | |||
| 1716 | 2919158015 | |||
| 1717 | 2919385833 | |||
| 1718 | 2919492789 | |||
| 1719 | 2919505023 | |||
| 1720 | 2923154672 | |||
| 1721 | 2926066700 | |||
| 1722 | 2929194331 | |||
| 1723 | 2931395601 | |||
| 1724 | 2935353973 | |||
| 1725 | 2939638119 | |||
| 1726 | 2939653213 | |||
| 1727 | 2945931726 | |||
| 1728 | 2945961363 | |||
| 1729 | 2946007808 | |||
| 1730 | 2946032819 | |||
| 1731 | 2947233574 | |||
| 1732 | 2969305605 | |||
| 1733 | 2984291357 | |||
| 1734 | 2998141047 | |||
| 1735 | 3007400202 | |||
| 1736 | 3007420686 | |||
| 1737 | 3007516333 | |||
| 1738 | 3007619716 | |||
| 1739 | 3007719271 | |||
| 1740 | 3007809345 | |||
| 1741 | 3007860931 | |||
| 1742 | 3007863731 | |||
| 1743 | 3007873363 | |||
| 1744 | 637318417 | |||
| 1745 | 651175012 | |||
| 1746 | 8011353478 | |||
| 1747 | 8015688908 | |||
| 1748 | 8019773286 | |||
| 1749 | 8034964175 | |||
| 1750 | 8052498894 | |||
| 1751 | 8054286154 | |||
| 1752 | 8054351117 | |||
| 1753 | 8054508116 | |||
| 1754 | 8054934505 | |||
| 1755 | 8055772025 | |||
| 1756 | 8055823068 | |||
| 1757 | 8056120275 | |||
| 1758 | 8056121877 | |||
| 1759 | 8056136482 | |||
| 1760 | 8056141875 | |||
| 1761 | 8056153472 | |||
| 1762 | 8056162739 | |||
| 1763 | 8056170004 | |||
| 1764 | 8056176138 | |||
| 1765 | 8056569697 | |||
| 1766 | 8057803314 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gx8-assembly1.cif.gz_B | the crystal structure of bacillus cereus protein related to nif3 | 0.9268 | 2 | 102 |
| 2gx8-assembly1.cif.gz_C-2 | the crystal structure of bacillus cereus protein related to nif3 | 0.9165 | 2 | 102 |
| 3lnl-assembly1.cif.gz_B | crystal structure of staphylococcus aureus protein sa1388 | 0.8595 | 2 | 97 |
| 2gx8-assembly1.cif.gz_C-2 | the crystal structure of bacillus cereus protein related to nif3 | 0.825 | 2 | 102 |
| 6t76-assembly1.cif.gz_A | pii-like protein cuta from nostoc sp. pcc 7120 in apo form | 0.8229 | 1 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54BW8_1_102_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9788 | 1 | 102 | 3.30.70.120 |
| af_P9WFM1_132_234_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9765 | 2 | 101 | 3.30.70.120 |
| af_Q54BW8_1_102_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9695 | 1 | 102 | 3.30.70.120 |
| af_Q2FY14_127_235_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9509 | 2 | 97 | 3.30.70.120 |
| 2gx8B02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9268 | 2 | 102 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A348HGP7-F1-model_v4 | Uncharacterized protein conserved in bacteria | 0.9959 | 1 | 101 |
|
| AF-A0A517CPW1-F1-model_v4 | deleted | 0.993 | 1 | 103 |
|
| AF-A0A5E7RD54-F1-model_v4 | GTP cyclohydrolase 1 type 2 | 0.9927 | 1 | 103 |
GO:0016787
|
| AF-A0A5E6ZTJ4-F1-model_v4 | GTP cyclohydrolase 1 type 2 | 0.9927 | 1 | 103 |
GO:0016787
|
| AF-A0A7C1WQM5-F1-model_v4 | NGG1p interacting factor NIF3 | 0.9924 | 1 | 103 |
|