F484587

General Info

Members Datasets Scaffolds Average Seq Length
883 382 1766 103

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10062189|Ga0182008_100621892
Length 96
Sequence MLKLAFFVPASHVDGVKSAVFAAGGGRIGAYDHCSWQVLGQGQFRPLDGSQPFIGEVEWKVELVVADELIVAVVAALKLSHPYETPAYEVWRLEDY

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
45 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
46 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
58 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
93 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
114 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
119 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
122 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
123 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
124 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
125 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
126 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
127 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
128 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
129 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
130 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
131 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
132 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
133 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
134 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
135 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
140 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
141 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
225 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
226 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
227 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
228 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
232 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
233 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
234 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
235 2511231006 Pseudomonas sp. GM17 Isolate Nodule
236 2511231015 Pseudomonas sp. GM49 Isolate Nodule
237 2511231023 Pseudomonas sp. GM80 Isolate Nodule
238 2511231024 Pseudomonas sp. GM84 Isolate Nodule
239 2511231031 Pseudomonas sp. GM16 Isolate Nodule
240 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
241 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
242 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
243 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
244 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
245 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
246 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
247 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
248 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
249 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
250 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
251 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
252 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
253 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
254 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
255 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
256 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
257 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
258 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
259 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
260 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
261 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
262 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
263 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
264 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
265 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
266 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
267 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
268 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
269 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
270 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
271 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
272 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
273 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
274 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
275 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
276 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
277 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
278 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
279 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
280 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
281 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
282 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
283 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
284 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
285 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
286 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
287 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
288 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
289 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
290 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
291 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
292 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
293 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
294 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
295 2765235841 Pseudomonas putida AA7 Isolate Unclassified
296 2784132063 Pseudomonas sp. 424 Isolate Unclassified
297 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
298 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
299 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
300 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
301 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
302 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
303 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
304 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
305 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
306 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
307 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
308 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
309 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
310 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
311 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
312 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
313 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
314 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
315 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
316 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
317 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
318 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
319 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
320 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
321 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
322 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
323 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
324 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
325 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
326 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
327 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
328 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
329 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
330 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
331 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
332 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
333 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
334 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
335 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
336 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
337 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
338 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
339 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
340 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
341 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
342 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
343 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
344 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
345 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
346 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
347 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
348 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
349 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
350 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
351 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
352 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
353 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
354 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
355 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
356 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
357 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
358 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
359 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
360 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
361 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
362 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
363 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
364 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
365 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
366 8052494512 Pseudomonas putida LD6 Isolate Unclassified
367 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
368 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
369 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
370 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
371 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
372 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
373 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
374 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
375 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
376 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
377 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
378 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
379 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
380 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
381 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
382 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.24
Metatranscriptomes 0
Isolates 16.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 1.25
Rhizoplane 5.1
Rhizosphere 72.48
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10062189 3300014497 Bacteria 1840
2 SwRhRL2b_contig_1442390 2162886007 Bacteria 3681
3 JGI25163J39215_1004342 3300002771 Bacteria 1007
4 JGI25163J39215_1004908 3300002771 Bacteria 891
5 JGI25164J39214_1000703 3300002772 Bacteria 12960
6 JGI25165J46597_1001416 3300003214 Bacteria 12960
7 Ga0055539_1000037 3300003752 Bacteria 215806
8 Ga0055533_1000047 3300003756 Bacteria 215806
9 Ga0055532_1000129 3300003758 Bacteria 74882
10 Ga0055525_1000271 3300003759 Bacteria 48390
11 Ga0055536_1000723 3300003781 Bacteria 22136
12 Ga0055534_1036827 3300003784 Bacteria 734
13 Ga0055530_10001304 3300003791 Bacteria 18756
14 Ga0055530_10002470 3300003791 Bacteria 11858
15 Ga0055540_1000806 3300003792 Bacteria 21215
16 Ga0055541_1000025 3300003841 Bacteria 215806
17 Ga0065714_10065440 3300005288 Bacteria 10054
18 Ga0065714_10347748 3300005288 Bacteria 638
19 Ga0065714_10477409 3300005288 Bacteria 531
20 Ga0065704_10015268 3300005289 Bacteria 2137
21 Ga0065704_10018014 3300005289 Bacteria 1753
22 Ga0065704_10046174 3300005289 Bacteria 829
23 Ga0065704_10095455 3300005289 Bacteria 2487
24 Ga0065704_10114970 3300005289 Bacteria 1881
25 Ga0065704_10233039 3300005289 Bacteria 1037
26 Ga0065712_10068567 3300005290 Bacteria 9871
27 Ga0070670_100002907 3300005331 Bacteria 14177
28 Ga0070670_100028293 3300005331 Bacteria 4824
29 Ga0070661_100000022 3300005344 Bacteria 127714
30 Ga0070674_102234697 3300005356 Bacteria 500
31 Ga0070659_100917259 3300005366 Bacteria 766
32 Ga0070663_101323870 3300005455 Bacteria 636
33 Ga0070662_100000041 3300005457 Bacteria 72879
34 Ga0070662_100127964 3300005457 Bacteria 1954
35 Ga0068853_100009803 3300005539 Bacteria 7730
36 Ga0070665_100008895 3300005548 Bacteria 10172
37 Ga0070665_100328593 3300005548 Bacteria 1533
38 Ga0070665_101349354 3300005548 Bacteria 723
39 Ga0070665_101807467 3300005548 Bacteria 618
40 Ga0070664_100000088 3300005564 Bacteria 58607
41 Ga0068854_100013980 3300005578 Bacteria 5281
42 Ga0068851_10000044 3300005834 Bacteria 83228
43 Ga0075364_10104773 3300006051 Bacteria 1885
44 Ga0075364_10287067 3300006051 Bacteria 1120
45 Ga0075432_10110299 3300006058 Bacteria 1025
46 Ga0075432_10292168 3300006058 Bacteria 674
47 Ga0075362_10395373 3300006177 Bacteria 696
48 Ga0075369_10447936 3300006186 Bacteria 611
49 Ga0075436_100192079 3300006914 Bacteria 1445
50 Ga0075436_100205541 3300006914 Bacteria 1395
51 Ga0075436_100417703 3300006914 Bacteria 973
52 Ga0099823_1000052 3300006944 Bacteria 56662
53 Ga0079104_1047468 3300006946 Bacteria 971
54 Ga0105251_10000151 3300009011 Bacteria 70872
55 Ga0105251_10000156 3300009011 Bacteria 69639
56 Ga0105251_10002615 3300009011 Bacteria 13924
57 Ga0105251_10005925 3300009011 Bacteria 7900
58 Ga0105251_10008174 3300009011 Bacteria 6327
59 Ga0105251_10024252 3300009011 Bacteria 3117
60 Ga0105251_10031154 3300009011 Bacteria 2671
61 Ga0105251_10041365 3300009011 Bacteria 2243
62 Ga0105251_10052601 3300009011 Bacteria 1938
63 Ga0105251_10057026 3300009011 Bacteria 1847
64 Ga0105251_10063879 3300009011 Bacteria 1727
65 Ga0105251_10117510 3300009011 Bacteria 1209
66 Ga0105251_10164436 3300009011 Bacteria 1000
67 Ga0105251_10188254 3300009011 Bacteria 929
68 Ga0105251_10209749 3300009011 Bacteria 877
69 Ga0105251_10217369 3300009011 Bacteria 860
70 Ga0105251_10302966 3300009011 Bacteria 725
71 Ga0105244_10000074 3300009036 Bacteria 113999
72 Ga0105244_10000724 3300009036 Bacteria 28465
73 Ga0105244_10003567 3300009036 Bacteria 11054
74 Ga0105244_10005787 3300009036 Bacteria 8140
75 Ga0105244_10014340 3300009036 Bacteria 4585
76 Ga0105244_10018455 3300009036 Bacteria 3914
77 Ga0105244_10023141 3300009036 Bacteria 3411
78 Ga0105244_10027560 3300009036 Bacteria 3059
79 Ga0105244_10032297 3300009036 Bacteria 2772
80 Ga0105244_10055931 3300009036 Bacteria 1998
81 Ga0105244_10083518 3300009036 Bacteria 1578
82 Ga0105244_10098306 3300009036 Bacteria 1434
83 Ga0105244_10101998 3300009036 Bacteria 1403
84 Ga0105244_10123021 3300009036 Bacteria 1255
85 Ga0105244_10222041 3300009036 Bacteria 886
86 Ga0105244_10225462 3300009036 Bacteria 878
87 Ga0105244_10240968 3300009036 Bacteria 845
88 Ga0105244_10267915 3300009036 Bacteria 794
89 Ga0105244_10339495 3300009036 Bacteria 693
90 Ga0105250_10000427 3300009092 Bacteria 30787
91 Ga0105250_10000446 3300009092 Bacteria 29848
92 Ga0105250_10005700 3300009092 Bacteria 5557
93 Ga0105250_10009794 3300009092 Bacteria 4024
94 Ga0105250_10045205 3300009092 Bacteria 1765
95 Ga0105250_10098877 3300009092 Bacteria 1190
96 Ga0105250_10118902 3300009092 Bacteria 1085
97 Ga0105250_10122498 3300009092 Bacteria 1070
98 Ga0105250_10132506 3300009092 Bacteria 1029
99 Ga0105250_10148069 3300009092 Bacteria 976
100 Ga0105250_10195089 3300009092 Bacteria 853
101 Ga0105250_10270659 3300009092 Bacteria 729
102 Ga0105243_10001292 3300009148 Bacteria 22446
103 Ga0105243_10001345 3300009148 Bacteria 21894
104 Ga0105243_10011029 3300009148 Bacteria 6834
105 Ga0105243_10039461 3300009148 Bacteria 3680
106 Ga0105243_10049266 3300009148 Bacteria 3322
107 Ga0105243_10118381 3300009148 Bacteria 2229
108 Ga0105242_10134779 3300009176 Bacteria 2136
109 Ga0105237_10001113 3300009545 Bacteria 35975
110 Ga0105249_10093764 3300009553 Bacteria 2813
111 Ga0105246_10000856 3300011119 Bacteria 17401
112 Ga0105246_10003908 3300011119 Bacteria 9027
113 Ga0105246_10125609 3300011119 Bacteria 1908
114 Ga0157336_1010472 3300012477 Bacteria 707
115 Ga0157345_1000706 3300012498 Bacteria 2694
116 Ga0157347_1013960 3300012502 Bacteria 882
117 Ga0157373_10014045 3300013100 Bacteria 5872
118 Ga0157373_10016307 3300013100 Bacteria 5421
119 Ga0157373_10018124 3300013100 Bacteria 5126
120 Ga0157373_10164053 3300013100 Bacteria 1563
121 Ga0157373_10217843 3300013100 Bacteria 1346
122 Ga0157373_10425881 3300013100 Bacteria 953
123 Ga0157373_10976798 3300013100 Bacteria 631
124 Ga0157371_10002116 3300013102 Bacteria 19330
125 Ga0157371_10002403 3300013102 Bacteria 17919
126 Ga0157371_10006388 3300013102 Bacteria 9738
127 Ga0157370_10080216 3300013104 Bacteria 3072
128 Ga0157370_10142756 3300013104 Bacteria 2231
129 Ga0157370_10534922 3300013104 Bacteria 1075
130 Ga0157370_10545025 3300013104 Bacteria 1064
131 Ga0157370_11060627 3300013104 Bacteria 733
132 Ga0157369_10015853 3300013105 Bacteria 8487
133 Ga0157369_10259708 3300013105 Bacteria 1811
134 Ga0157369_10544127 3300013105 Bacteria 1200
135 Ga0157369_11142078 3300013105 Bacteria 796
136 Ga0157369_11238255 3300013105 Bacteria 761
137 Ga0163162_10003878 3300013306 Bacteria 14357
138 Ga0163162_10015992 3300013306 Bacteria 7334
139 Ga0163162_10020659 3300013306 Bacteria 6472
140 Ga0163162_12246387 3300013306 Bacteria 627
141 Ga0157372_10012341 3300013307 Bacteria 9104
142 Ga0157372_10022670 3300013307 Bacteria 6796
143 Ga0157375_11133704 3300013308 Bacteria 916
144 Ga0157375_12878832 3300013308 Bacteria 575
145 Ga0182008_10000570 3300014497 Bacteria 27277
146 Ga0182008_10121858 3300014497 Bacteria 1296
147 Ga0182008_10177395 3300014497 Bacteria 1077
148 Ga0182008_10254779 3300014497 Bacteria 906
149 Ga0182008_10300384 3300014497 Bacteria 840
150 Ga0182006_1001124 3300015261 Bacteria 17017
151 Ga0182006_1009185 3300015261 Bacteria 4442
152 Ga0182006_1011257 3300015261 Bacteria 3944
153 Ga0182006_1118697 3300015261 Bacteria 921
154 Ga0182006_1132864 3300015261 Bacteria 855
155 Ga0182005_1020832 3300015265 Bacteria 1801
156 Ga0182005_1092268 3300015265 Bacteria 843
157 Ga0163161_10002724 3300017792 Bacteria 12559
158 Ga0163161_10003020 3300017792 Bacteria 11880
159 Ga0163161_10006539 3300017792 Bacteria 8067
160 Ga0163161_10493788 3300017792 Bacteria 996
161 Ga0209435_100880 3300025206 Bacteria 4608
162 Ga0209760_100248 3300025207 Bacteria 22328
163 Ga0209760_100553 3300025207 Bacteria 6912
164 Ga0209784_100032 3300025224 Bacteria 314079
165 Ga0209566_100036 3300025225 Bacteria 314079
166 Ga0209674_100054 3300025226 Bacteria 314079
167 Ga0209147_100055 3300025229 Bacteria 262412
168 Ga0209563_100055 3300025230 Bacteria 314079
169 Ga0209563_100693 3300025230 Bacteria 10636
170 Ga0207427_100004 3300025231 Bacteria 939600
171 Ga0209437_100028 3300025233 Bacteria 540136
172 Ga0209437_116779 3300025233 Bacteria 975
173 Ga0209258_100283 3300025242 Bacteria 83776
174 Ga0209646_1000462 3300025246 Bacteria 20662
175 Ga0209026_1015738 3300025250 Bacteria 1237
176 Ga0209677_100033 3300025253 Bacteria 314079
177 Ga0209759_1016440 3300025256 Bacteria 1869
178 Ga0209233_1000008 3300025261 Bacteria 1356712
179 Ga0209676_1000056 3300025292 Bacteria 361329
180 Ga0209676_1000551 3300025292 Bacteria 57320
181 Ga0209050_1001645 3300025298 Bacteria 22807
182 Ga0209051_1000061 3300025303 Bacteria 253485
183 Ga0207656_10000022 3300025321 Bacteria 106345
184 Ga0207696_1000032 3300025711 Bacteria 380071
185 Ga0207696_1000034 3300025711 Bacteria 350426
186 Ga0207696_1000129 3300025711 Bacteria 133308
187 Ga0207696_1000340 3300025711 Bacteria 48448
188 Ga0207696_1004452 3300025711 Bacteria 6034
189 Ga0207696_1026381 3300025711 Bacteria 1799
190 Ga0207696_1031615 3300025711 Bacteria 1600
191 Ga0207696_1095840 3300025711 Bacteria 811
192 Ga0207696_1124543 3300025711 Bacteria 694
193 Ga0207696_1129559 3300025711 Bacteria 678
194 Ga0207696_1159881 3300025711 Bacteria 600
195 Ga0207655_1000357 3300025728 Bacteria 64976
196 Ga0207655_1000408 3300025728 Bacteria 59188
197 Ga0207655_1000487 3300025728 Bacteria 51198
198 Ga0207655_1003661 3300025728 Bacteria 11337
199 Ga0207655_1006079 3300025728 Bacteria 8058
200 Ga0207655_1006620 3300025728 Bacteria 7639
201 Ga0207655_1008861 3300025728 Bacteria 6321
202 Ga0207655_1009590 3300025728 Bacteria 5996
203 Ga0207655_1010833 3300025728 Bacteria 5491
204 Ga0207655_1016182 3300025728 Bacteria 4094
205 Ga0207655_1017075 3300025728 Bacteria 3931
206 Ga0207655_1026687 3300025728 Bacteria 2769
207 Ga0207655_1036740 3300025728 Bacteria 2168
208 Ga0207655_1042410 3300025728 Bacteria 1938
209 Ga0207655_1137211 3300025728 Bacteria 790
210 Ga0207655_1165354 3300025728 Bacteria 688
211 Ga0207713_1000014 3300025735 Bacteria 432450
212 Ga0207713_1000163 3300025735 Bacteria 98277
213 Ga0207713_1001339 3300025735 Bacteria 20177
214 Ga0207713_1005506 3300025735 Bacteria 7900
215 Ga0207713_1008041 3300025735 Bacteria 6129
216 Ga0207713_1012133 3300025735 Bacteria 4631
217 Ga0207713_1014589 3300025735 Bacteria 4074
218 Ga0207713_1027582 3300025735 Bacteria 2577
219 Ga0207713_1028660 3300025735 Bacteria 2507
220 Ga0207713_1095505 3300025735 Bacteria 1036
221 Ga0207713_1122789 3300025735 Bacteria 869
222 Ga0207713_1247938 3300025735 Bacteria 526
223 Ga0207671_10000034 3300025914 Bacteria 245048
224 Ga0207649_10000006 3300025920 Bacteria 349180
225 Ga0207681_10000607 3300025923 Bacteria 24119
226 Ga0207650_10000092 3300025925 Bacteria 116489
227 Ga0207650_10001090 3300025925 Bacteria 20075
228 Ga0207706_10001484 3300025933 Bacteria 23342
229 Ga0207706_10059457 3300025933 Bacteria 3365
230 Ga0207686_10609229 3300025934 Bacteria 860
231 Ga0207709_10000757 3300025935 Bacteria 25461
232 Ga0207709_10005599 3300025935 Bacteria 7105
233 Ga0207709_10077240 3300025935 Bacteria 2134
234 Ga0207709_10212080 3300025935 Bacteria 1391
235 Ga0207669_11127549 3300025937 Bacteria 663
236 Ga0207679_10000010 3300025945 Bacteria 349180
237 Ga0207712_11388021 3300025961 Bacteria 628
238 Ga0207640_10563537 3300025981 Bacteria 959
239 Ga0207639_10003207 3300026041 Bacteria 10994
240 Ga0207678_11315615 3300026067 Bacteria 639
241 Ga0209281_1018994 3300027111 Bacteria 1364
242 Ga0209281_1057859 3300027111 Bacteria 600
243 Ga0209389_1000005 3300027296 Bacteria 232255
244 Ga0209371_1000277 3300027312 Bacteria 59241
245 Ga0207428_10538878 3300027907 Bacteria 845
246 Ga0268266_10010027 3300028379 Bacteria 8313
247 Ga0268266_10323293 3300028379 Bacteria 1444
248 Ga0268266_10503939 3300028379 Bacteria 1156
249 Ga0268266_10979137 3300028379 Bacteria 818
250 Ga0268256_1000315 3300030500 Bacteria 48457
251 Ga0268256_1022197 3300030500 Bacteria 1670
252 Ga0307511_10254534 3300030521 Bacteria 840
253 Ga0316183_1131894 3300030742 Bacteria 968
254 Ga0316183_1206930 3300030742 Bacteria 3386
255 Ga0307509_10866175 3300031507 Bacteria 568
256 Ga0307408_100061680 3300031548 Bacteria 2737
257 Ga0307514_10378887 3300031649 Bacteria 736
258 Ga0307516_10438332 3300031730 Bacteria 963
259 Ga0307405_10000772 3300031731 Bacteria 12528
260 Ga0307405_10005627 3300031731 Bacteria 6065
261 Ga0307413_10122108 3300031824 Bacteria 1766
262 Ga0307413_10907794 3300031824 Bacteria 749
263 Ga0307407_10121169 3300031903 Bacteria 1658
264 Ga0307412_10000233 3300031911 Bacteria 36924
265 Ga0307412_10786722 3300031911 Bacteria 824
266 Ga0307412_10799557 3300031911 Bacteria 818
267 Ga0307412_10966253 3300031911 Bacteria 750
268 Ga0307412_11141867 3300031911 Bacteria 695
269 Ga0307412_11335910 3300031911 Bacteria 646
270 Ga0307409_101006922 3300031995 Bacteria 851
271 Ga0307416_101070791 3300032002 Bacteria 910
272 Ga0307414_10043834 3300032004 Bacteria 3050
273 Ga0307414_10383068 3300032004 Bacteria 1216
274 Ga0307414_10875289 3300032004 Bacteria 822
275 Ga0307411_10134137 3300032005 Bacteria 1814
276 Ga0307510_10008612 3300033180 Bacteria 12157
277 Ga0439438_001545 3300041405 Bacteria 10146
278 Ga0439438_001889 3300041405 Bacteria 9172
279 Ga0439438_018209 3300041405 Bacteria 2004
280 Ga0439438_067003 3300041405 Bacteria 892
281 Ga0439447_011365 3300041407 Bacteria 2602
282 Ga0439447_016069 3300041407 Bacteria 2061
283 Ga0439447_018438 3300041407 Bacteria 1880
284 Ga0439447_034898 3300041407 Bacteria 1248
285 Ga0439466_0011833 3300041411 Bacteria 3221
286 Ga0439466_0022591 3300041411 Bacteria 2218
287 Ga0439466_0038734 3300041411 Bacteria 1600
288 Ga0439466_0082443 3300041411 Bacteria 1013
289 Ga0439466_0134093 3300041411 Bacteria 761
290 Ga0451797_0795164 3300041453 Bacteria 540
291 Ga0451837_1779630 3300041494 Bacteria 794
292 Ga0451841_0884857 3300041498 Bacteria 537
293 Ga0439431_0022692 3300041997 Bacteria 1514
294 Ga0439432_000198 3300042006 Bacteria 21620
295 Ga0439432_000272 3300042006 Bacteria 18658
296 Ga0439432_051602 3300042006 Bacteria 1281
297 Ga0439432_107354 3300042006 Bacteria 832
298 Ga0439451_002129 3300042009 Bacteria 3976
299 Ga0439451_002955 3300042009 Bacteria 3454
300 Ga0439451_004570 3300042009 Bacteria 2816
301 Ga0439451_006684 3300042009 Bacteria 2357
302 Ga0439452_001129 3300042010 Bacteria 11665
303 Ga0439452_012768 3300042010 Bacteria 2377
304 Ga0439452_037852 3300042010 Bacteria 1148
305 Ga0439456_000173 3300042013 Bacteria 19259
306 Ga0439456_013117 3300042013 Bacteria 1722
307 Ga0439456_017969 3300042013 Bacteria 1483
308 Ga0439456_101385 3300042013 Bacteria 651
309 Ga0439463_004835 3300042016 Bacteria 3366
310 Ga0439463_026452 3300042016 Bacteria 1457
311 Ga0450911_000552 3300042115 Bacteria 11643
312 Ga0450911_008582 3300042115 Bacteria 1451
313 Ga0450911_019113 3300042115 Bacteria 898
314 Ga0450920_010368 3300042122 Bacteria 1727
315 Ga0450923_062722 3300042125 Bacteria 813
316 Ga0450923_187374 3300042125 Bacteria 511
317 Ga0450898_000205 3300042134 Bacteria 6314
318 Ga0450900_015897 3300042136 Bacteria 1015
319 Ga0450902_002305 3300042137 Bacteria 2702
320 Ga0450902_021864 3300042137 Bacteria 1057
321 Ga0450902_040800 3300042137 Bacteria 790
322 Ga0450902_045676 3300042137 Bacteria 748
323 Ga0450902_069694 3300042137 Bacteria 612
324 Ga0450902_091233 3300042137 Bacteria 538
325 Ga0450902_102335 3300042137 Bacteria 510
326 Ga0450903_022308 3300042138 Bacteria 976
327 Ga0450903_049209 3300042138 Bacteria 618
328 Ga0450904_000292 3300042139 Bacteria 10835
329 Ga0450905_000284 3300042142 Bacteria 6025
330 Ga0450905_031226 3300042142 Bacteria 823
331 Ga0450906_000396 3300042145 Bacteria 8954
332 Ga0450906_012358 3300042145 Bacteria 1583
333 Ga0450907_056790 3300042146 Bacteria 674
334 Ga0439446_0084009 3300042156 Bacteria 989
335 Ga0450908_022514 3300042184 Bacteria 1103
336 Ga0439464_0014490 3300042439 Bacteria 2120
337 Ga0450893_0017687 3300042532 Bacteria 1212
338 Ga0450901_000018 3300042533 Bacteria 15939
339 Ga0450901_010503 3300042533 Bacteria 958
340 Ga0439440_0028426 3300042993 Bacteria 1305
341 Ga0495617_002206 3300046452 Bacteria 7937
342 Ga0495617_055684 3300046452 Bacteria 1311
343 Ga0495617_081263 3300046452 Bacteria 1061
344 Ga0495617_138370 3300046452 Bacteria 778
345 Ga0495617_191446 3300046452 Bacteria 641
346 Ga0495617_273900 3300046452 Bacteria 517
347 Ga0495617_278478 3300046452 Bacteria 512
348 Ga0495627_000074 3300046453 Bacteria 123139
349 Ga0495627_002496 3300046453 Bacteria 8782
350 Ga0495627_009192 3300046453 Bacteria 3646
351 Ga0495627_063237 3300046453 Bacteria 1091
352 Ga0495627_079781 3300046453 Bacteria 949
353 Ga0495590_0043584 3300046457 Bacteria 1564
354 Ga0495590_0048158 3300046457 Bacteria 1486
355 Ga0495591_000142 3300046458 Bacteria 76727
356 Ga0495591_007147 3300046458 Bacteria 4792
357 Ga0495591_007531 3300046458 Bacteria 4613
358 Ga0495591_026679 3300046458 Bacteria 1790
359 Ga0495591_028978 3300046458 Bacteria 1687
360 Ga0495591_048906 3300046458 Bacteria 1163
361 Ga0495591_064265 3300046458 Bacteria 967
362 Ga0495591_112867 3300046458 Bacteria 666
363 Ga0495591_143812 3300046458 Bacteria 574
364 Ga0495638_0023362 3300046460 Bacteria 4044
365 Ga0495638_0024038 3300046460 Bacteria 3977
366 Ga0495638_0172809 3300046460 Bacteria 1238
367 Ga0495638_0243503 3300046460 Bacteria 994
368 Ga0495638_0631736 3300046460 Bacteria 522
369 Ga0495653_0072273 3300046463 Bacteria 2576
370 Ga0495653_0275055 3300046463 Bacteria 1107
371 Ga0495653_0754748 3300046463 Bacteria 587
372 Ga0495650_0021495 3300046471 Bacteria 3116
373 Ga0495650_0041170 3300046471 Bacteria 1977
374 Ga0495650_0051945 3300046471 Bacteria 1685
375 Ga0495650_0136268 3300046471 Bacteria 891
376 Ga0495650_0220946 3300046471 Bacteria 652
377 Ga0495605_0008969 3300046474 Bacteria 5634
378 Ga0495605_0104124 3300046474 Bacteria 1301
379 Ga0495605_0232105 3300046474 Bacteria 794
380 Ga0495584_0003442 3300046491 Bacteria 8709
381 Ga0495584_0004205 3300046491 Bacteria 7767
382 Ga0495584_0093399 3300046491 Bacteria 1518
383 Ga0495584_0162683 3300046491 Bacteria 1134
384 Ga0495584_0428590 3300046491 Bacteria 672
385 Ga0495584_0459937 3300046491 Bacteria 647
386 Ga0495585_0006062 3300046492 Bacteria 7562
387 Ga0495585_0166376 3300046492 Bacteria 1141
388 Ga0495596_0046741 3300046500 Bacteria 1699
389 Ga0495596_0342790 3300046500 Bacteria 581
390 Ga0495607_0000315 3300046501 Bacteria 50370
391 Ga0495607_0000628 3300046501 Bacteria 34220
392 Ga0495607_0001499 3300046501 Bacteria 20682
393 Ga0495607_0016720 3300046501 Bacteria 4729
394 Ga0495607_0018105 3300046501 Bacteria 4499
395 Ga0495607_0093067 3300046501 Bacteria 1629
396 Ga0495607_0105311 3300046501 Bacteria 1504
397 Ga0495607_0147454 3300046501 Bacteria 1207
398 Ga0495607_0149505 3300046501 Bacteria 1196
399 Ga0495607_0160128 3300046501 Bacteria 1144
400 Ga0495607_0172428 3300046501 Bacteria 1091
401 Ga0495607_0432646 3300046501 Bacteria 593
402 Ga0495583_0003303 3300046506 Bacteria 12497
403 Ga0495583_0005912 3300046506 Bacteria 8135
404 Ga0495583_0015210 3300046506 Bacteria 4195
405 Ga0495583_0054252 3300046506 Bacteria 1816
406 Ga0495606_0002059 3300046507 Bacteria 24574
407 Ga0495606_0010030 3300046507 Bacteria 7918
408 Ga0495606_0012549 3300046507 Bacteria 6786
409 Ga0495606_0028902 3300046507 Bacteria 3902
410 Ga0495606_0031441 3300046507 Bacteria 3690
411 Ga0495606_0063547 3300046507 Bacteria 2353
412 Ga0495606_0095142 3300046507 Bacteria 1824
413 Ga0495606_0182069 3300046507 Bacteria 1210
414 Ga0495610_0003562 3300046512 Bacteria 12047
415 Ga0495610_0017421 3300046512 Bacteria 4095
416 Ga0495610_0078905 3300046512 Bacteria 1517
417 Ga0495610_0099923 3300046512 Bacteria 1301
418 Ga0495610_0132180 3300046512 Bacteria 1082
419 Ga0495610_0149441 3300046512 Bacteria 998
420 Ga0495610_0226777 3300046512 Bacteria 751
421 Ga0495616_0015839 3300046513 Bacteria 4182
422 Ga0495616_0016061 3300046513 Bacteria 4148
423 Ga0495616_0026943 3300046513 Bacteria 3053
424 Ga0495616_0088539 3300046513 Bacteria 1469
425 Ga0495616_0122729 3300046513 Bacteria 1197
426 Ga0495616_0173614 3300046513 Bacteria 962
427 Ga0495620_0000003 3300046515 Bacteria 345923
428 Ga0495620_0003964 3300046515 Bacteria 8412
429 Ga0495620_0016249 3300046515 Bacteria 3741
430 Ga0495620_0033116 3300046515 Bacteria 2348
431 Ga0495620_0055029 3300046515 Bacteria 1678
432 Ga0495620_0116938 3300046515 Bacteria 1053
433 Ga0495620_0166826 3300046515 Bacteria 854
434 Ga0495631_0003979 3300046518 Bacteria 7975
435 Ga0495631_0175205 3300046518 Bacteria 919
436 Ga0495632_0001347 3300046519 Bacteria 20641
437 Ga0495632_0004065 3300046519 Bacteria 10103
438 Ga0495632_0007143 3300046519 Bacteria 7063
439 Ga0495632_0035192 3300046519 Bacteria 2557
440 Ga0495632_0069071 3300046519 Bacteria 1701
441 Ga0495632_0113040 3300046519 Bacteria 1273
442 Ga0495632_0177228 3300046519 Bacteria 977
443 Ga0495632_0243355 3300046519 Bacteria 808
444 Ga0495632_0314466 3300046519 Bacteria 692
445 Ga0495637_0000149 3300046520 Bacteria 53457
446 Ga0495637_0007327 3300046520 Bacteria 5478
447 Ga0495637_0011093 3300046520 Bacteria 4338
448 Ga0495637_0011109 3300046520 Bacteria 4335
449 Ga0495637_0013477 3300046520 Bacteria 3877
450 Ga0495637_0014036 3300046520 Bacteria 3789
451 Ga0495637_0014639 3300046520 Bacteria 3696
452 Ga0495637_0015843 3300046520 Bacteria 3530
453 Ga0495637_0047522 3300046520 Bacteria 1811
454 Ga0495637_0227254 3300046520 Bacteria 677
455 Ga0495643_0000769 3300046522 Bacteria 35803
456 Ga0495643_0005626 3300046522 Bacteria 8408
457 Ga0495643_0009610 3300046522 Bacteria 5998
458 Ga0495643_0017886 3300046522 Bacteria 4133
459 Ga0495643_0109805 3300046522 Bacteria 1403
460 Ga0495643_0131596 3300046522 Bacteria 1255
461 Ga0495644_0021212 3300046523 Bacteria 2478
462 Ga0495644_0074713 3300046523 Bacteria 1275
463 Ga0495644_0166606 3300046523 Bacteria 845
464 Ga0495648_0000711 3300046524 Bacteria 35493
465 Ga0495648_0022690 3300046524 Bacteria 4313
466 Ga0495648_0027692 3300046524 Bacteria 3789
467 Ga0495648_0096980 3300046524 Bacteria 1636
468 Ga0495648_0180524 3300046524 Bacteria 1073
469 Ga0495648_0340493 3300046524 Bacteria 688
470 Ga0495648_0347945 3300046524 Bacteria 678
471 Ga0495666_0080959 3300046526 Bacteria 1536
472 Ga0495666_0081840 3300046526 Bacteria 1527
473 Ga0495652_0073029 3300046529 Bacteria 2858
474 Ga0495654_0001376 3300046530 Bacteria 16853
475 Ga0495654_0004365 3300046530 Bacteria 8415
476 Ga0495654_0004632 3300046530 Bacteria 8114
477 Ga0495654_0059938 3300046530 Bacteria 1830
478 Ga0495654_0105365 3300046530 Bacteria 1292
479 Ga0495654_0110267 3300046530 Bacteria 1256
480 Ga0495654_0222468 3300046530 Bacteria 797
481 Ga0495654_0315912 3300046530 Bacteria 634
482 Ga0495654_0319787 3300046530 Bacteria 629
483 Ga0495654_0343643 3300046530 Bacteria 601
484 Ga0495654_0377031 3300046530 Bacteria 566
485 Ga0495654_0404705 3300046530 Bacteria 541
486 Ga0495654_0408284 3300046530 Bacteria 538
487 Ga0495609_0004361 3300046538 Bacteria 7771
488 Ga0495609_0006000 3300046538 Bacteria 6269
489 Ga0495609_0016858 3300046538 Bacteria 3400
490 Ga0495609_0138241 3300046538 Bacteria 1040
491 Ga0495609_0396707 3300046538 Bacteria 552
492 Ga0495597_0000040 3300046542 Bacteria 112292
493 Ga0495597_0008842 3300046542 Bacteria 5025
494 Ga0495597_0022385 3300046542 Bacteria 2932
495 Ga0495597_0069355 3300046542 Bacteria 1521
496 Ga0495597_0130498 3300046542 Bacteria 1042
497 Ga0495597_0416659 3300046542 Bacteria 509
498 Ga0495597_0429243 3300046542 Bacteria 500
499 Ga0495622_0009776 3300046557 Bacteria 4433
500 Ga0495622_0117666 3300046557 Bacteria 1214
501 Ga0495622_0132301 3300046557 Bacteria 1135
502 Ga0495633_0015207 3300046558 Bacteria 3998
503 Ga0495633_0081240 3300046558 Bacteria 1508
504 Ga0495656_0243945 3300046615 Bacteria 905
505 Ga0495668_0019087 3300046616 Bacteria 3956
506 Ga0495668_0134406 3300046616 Bacteria 1353
507 Ga0495668_0776499 3300046616 Bacteria 530
508 Ga0495634_0096465 3300046642 Bacteria 1914
509 Ga0495611_0002323 3300046648 Bacteria 8801
510 Ga0495625_0009413 3300046660 Bacteria 8173
511 Ga0495625_0012425 3300046660 Bacteria 6899
512 Ga0495625_0022126 3300046660 Bacteria 4879
513 Ga0495625_0030882 3300046660 Bacteria 3991
514 Ga0495625_0044181 3300046660 Bacteria 3227
515 Ga0495625_0340986 3300046660 Bacteria 949
516 Ga0495625_0386123 3300046660 Bacteria 877
517 Ga0495635_0184503 3300046663 Bacteria 1417
518 Ga0495661_0003082 3300046665 Bacteria 12527
519 Ga0495661_0021797 3300046665 Bacteria 4171
520 Ga0495661_0131835 3300046665 Bacteria 1368
521 Ga0495661_0234164 3300046665 Bacteria 945
522 Ga0495661_0501788 3300046665 Bacteria 578
523 Ga0495588_0049970 3300046674 Bacteria 2151
524 Ga0495623_0035311 3300046679 Bacteria 3204
525 Ga0495613_0025885 3300046689 Bacteria 4371
526 Ga0495624_0055548 3300046690 Bacteria 2493
527 Ga0495670_0004025 3300046691 Bacteria 7207
528 Ga0495670_0437418 3300046691 Bacteria 708
529 Ga0495671_0021803 3300046692 Bacteria 3360
530 Ga0495671_0103127 3300046692 Bacteria 1393
531 Ga0495671_0104460 3300046692 Bacteria 1383
532 Ga0495671_0160754 3300046692 Bacteria 1092
533 Ga0495671_0285580 3300046692 Bacteria 794
534 Ga0495671_0306146 3300046692 Bacteria 764
535 Ga0495671_0315213 3300046692 Bacteria 751
536 Ga0495649_0018140 3300046694 Bacteria 3964
537 Ga0495649_0022629 3300046694 Bacteria 3516
538 Ga0495649_0063508 3300046694 Bacteria 1983
539 Ga0495649_0108018 3300046694 Bacteria 1476
540 Ga0495649_0115598 3300046694 Bacteria 1420
541 Ga0495649_0210774 3300046694 Bacteria 1006
542 Ga0495649_0278755 3300046694 Bacteria 854
543 Ga0495589_0003658 3300046794 Bacteria 8309
544 Ga0495589_0005181 3300046794 Bacteria 6893
545 Ga0495589_0008171 3300046794 Bacteria 5470
546 Ga0495600_0091123 3300046809 Bacteria 1989
547 Ga0495600_0839231 3300046809 Bacteria 545
548 Ga0495660_0002366 3300046810 Bacteria 12054
549 Ga0495660_0002578 3300046810 Bacteria 11513
550 Ga0495660_0007120 3300046810 Bacteria 6590
551 Ga0495660_0085495 3300046810 Bacteria 1647
552 Ga0495660_0097007 3300046810 Bacteria 1522
553 Ga0495660_0122532 3300046810 Bacteria 1313
554 Ga0495660_0404321 3300046810 Bacteria 597
555 Ga0495660_0441687 3300046810 Bacteria 563
556 Ga0495604_0985144 3300047317 Bacteria 522
557 Ga0495672_0000803 3300047320 Bacteria 33779
558 Ga0495672_0020935 3300047320 Bacteria 4275
559 Ga0495672_0051133 3300047320 Bacteria 2435
560 Ga0495672_0066847 3300047320 Bacteria 2049
561 Ga0495672_0138972 3300047320 Bacteria 1270
562 Ga0495672_0147788 3300047320 Bacteria 1221
563 Ga0495672_0179430 3300047320 Bacteria 1073
564 Ga0495672_0290118 3300047320 Bacteria 778
565 Ga0495672_0492087 3300047320 Bacteria 546
566 Ga0495676_0012839 3300047321 Bacteria 7532
567 Ga0495676_0043747 3300047321 Bacteria 3661
568 Ga0495680_0049810 3300047322 Bacteria 3278
569 Ga0495680_0099463 3300047322 Bacteria 2168
570 Ga0495680_0145082 3300047322 Bacteria 1734
571 Ga0495680_0171096 3300047322 Bacteria 1572
572 Ga0495683_0014352 3300047323 Bacteria 4127
573 Ga0495683_0102791 3300047323 Bacteria 1372
574 Ga0495683_0161101 3300047323 Bacteria 1037
575 Ga0495683_0216360 3300047323 Bacteria 856
576 Ga0495687_046737 3300047443 Bacteria 1866
577 Ga0495675_0144708 3300047444 Bacteria 1471
578 Ga0495679_001680 3300047446 Bacteria 12285
579 Ga0495679_003292 3300047446 Bacteria 7828
580 Ga0495679_014244 3300047446 Bacteria 2954
581 Ga0495679_040989 3300047446 Bacteria 1436
582 Ga0495673_0009130 3300047469 Bacteria 5503
583 Ga0495673_0011025 3300047469 Bacteria 4888
584 Ga0495673_0041215 3300047469 Bacteria 2080
585 Ga0495673_0072700 3300047469 Bacteria 1442
586 Ga0495673_0072716 3300047469 Bacteria 1442
587 Ga0495673_0083038 3300047469 Bacteria 1323
588 Ga0495673_0127332 3300047469 Bacteria 1003
589 Ga0495673_0141705 3300047469 Bacteria 936
590 Ga0495673_0150382 3300047469 Bacteria 900
591 Ga0495681_0005872 3300047470 Bacteria 8150
592 Ga0495681_0006996 3300047470 Bacteria 7295
593 Ga0495681_0007376 3300047470 Bacteria 7033
594 Ga0495681_0027957 3300047470 Bacteria 2910
595 Ga0495681_0050121 3300047470 Bacteria 1969
596 Ga0495681_0057337 3300047470 Bacteria 1809
597 Ga0495681_0122671 3300047470 Bacteria 1113
598 Ga0495681_0396557 3300047470 Bacteria 516
599 Ga0495684_0137497 3300047471 Bacteria 1833
600 Ga0495686_0005761 3300047472 Bacteria 9683
601 Ga0495686_0014722 3300047472 Bacteria 5375
602 Ga0495686_0034281 3300047472 Bacteria 3270
603 Ga0495686_0264041 3300047472 Bacteria 963
604 Ga0495686_0270277 3300047472 Bacteria 948
605 Ga0495602_0050423 3300048088 Bacteria 3718
606 Ga0495626_0002482 3300048091 Bacteria 12763
607 Ga0495626_0007969 3300048091 Bacteria 5853
608 Ga0495626_0033237 3300048091 Bacteria 2473
609 Ga0496100_0412805 3300048903 Bacteria 1030
610 Ga0496108_0221973 3300048911 Bacteria 1642
611 Ga0496110_0140537 3300048913 Bacteria 2183
612 Ga0496110_1168787 3300048913 Bacteria 678
613 Ga0496110_1520227 3300048913 Bacteria 579
614 Ga0496111_0289461 3300048914 Bacteria 1215
615 Ga0496111_0962508 3300048914 Bacteria 613
616 Ga0496114_0161901 3300048917 Bacteria 1946
617 Ga0496114_1555243 3300048917 Bacteria 549
618 Ga0496116_0000999 3300048919 Bacteria 34585
619 Ga0496116_0004955 3300048919 Bacteria 12543
620 Ga0496116_0015031 3300048919 Bacteria 6138
621 Ga0496116_0196738 3300048919 Bacteria 1060
622 Ga0496117_0001374 3300048920 Bacteria 35457
623 Ga0496117_0003526 3300048920 Bacteria 18097
624 Ga0496117_0006099 3300048920 Bacteria 12344
625 Ga0496117_0011495 3300048920 Bacteria 7924
626 Ga0496117_0013502 3300048920 Bacteria 7120
627 Ga0496117_0017282 3300048920 Bacteria 6031
628 Ga0496117_0030905 3300048920 Bacteria 4099
629 Ga0496117_0043173 3300048920 Bacteria 3281
630 Ga0496117_0074301 3300048920 Bacteria 2263
631 Ga0496117_0082952 3300048920 Bacteria 2097
632 Ga0496117_0090820 3300048920 Bacteria 1966
633 Ga0496117_0095919 3300048920 Bacteria 1893
634 Ga0496117_0497113 3300048920 Bacteria 592
635 Ga0496117_0547954 3300048920 Bacteria 551
636 Ga0496118_0014465 3300048921 Bacteria 7384
637 Ga0496118_0017390 3300048921 Bacteria 6547
638 Ga0496118_0024382 3300048921 Bacteria 5221
639 Ga0496118_0042899 3300048921 Bacteria 3562
640 Ga0496118_0056299 3300048921 Bacteria 2957
641 Ga0496118_0113685 3300048921 Bacteria 1787
642 Ga0496118_0114159 3300048921 Bacteria 1781
643 Ga0496118_0116526 3300048921 Bacteria 1755
644 Ga0496118_0141667 3300048921 Bacteria 1522
645 Ga0496118_0167625 3300048921 Bacteria 1347
646 Ga0496118_0240266 3300048921 Bacteria 1037
647 Ga0496118_0309661 3300048921 Bacteria 862
648 Ga0496119_0001590 3300048922 Bacteria 27017
649 Ga0496119_0037432 3300048922 Bacteria 3151
650 Ga0496119_0551517 3300048922 Bacteria 530
651 Ga0496120_0007481 3300048923 Bacteria 8112
652 Ga0496120_0034739 3300048923 Bacteria 3017
653 Ga0496121_0002354 3300048924 Bacteria 29143
654 Ga0496121_0016619 3300048924 Bacteria 7583
655 Ga0496121_0020740 3300048924 Bacteria 6480
656 Ga0496121_0046064 3300048924 Bacteria 3737
657 Ga0496121_0107503 3300048924 Bacteria 2136
658 Ga0496121_0245921 3300048924 Bacteria 1243
659 Ga0496121_0247835 3300048924 Bacteria 1237
660 Ga0496122_0001232 3300048925 Bacteria 43246
661 Ga0496122_0015945 3300048925 Bacteria 7150
662 Ga0496122_0030731 3300048925 Bacteria 4491
663 Ga0496122_0035390 3300048925 Bacteria 4063
664 Ga0496122_0091273 3300048925 Bacteria 2074
665 Ga0496122_0094246 3300048925 Bacteria 2027
666 Ga0496122_0121958 3300048925 Bacteria 1678
667 Ga0496122_0369638 3300048925 Bacteria 741
668 Ga0496123_0001000 3300048926 Bacteria 43259
669 Ga0496123_0002775 3300048926 Bacteria 20879
670 Ga0496123_0035262 3300048926 Bacteria 3568
671 Ga0496123_0084183 3300048926 Bacteria 1918
672 Ga0496123_0111848 3300048926 Bacteria 1559
673 Ga0496123_0120782 3300048926 Bacteria 1474
674 Ga0496123_0229929 3300048926 Bacteria 929
675 Ga0496123_0286835 3300048926 Bacteria 792
676 Ga0496123_0476110 3300048926 Bacteria 550
677 Ga0496124_0000692 3300048927 Bacteria 55225
678 Ga0496124_0005321 3300048927 Bacteria 14548
679 Ga0496124_0006823 3300048927 Bacteria 12322
680 Ga0496124_0018847 3300048927 Bacteria 6445
681 Ga0496124_0020869 3300048927 Bacteria 6043
682 Ga0496124_0023760 3300048927 Bacteria 5587
683 Ga0496124_0031447 3300048927 Bacteria 4697
684 Ga0496124_0154995 3300048927 Bacteria 1792
685 Ga0496124_0219010 3300048927 Bacteria 1433
686 Ga0496124_0274877 3300048927 Bacteria 1231
687 Ga0496124_0388178 3300048927 Bacteria 973
688 Ga0496124_0491430 3300048927 Bacteria 825
689 Ga0496124_0645513 3300048927 Bacteria 680
690 Ga0496124_0941614 3300048927 Bacteria 520
691 Ga0496125_0003047 3300048928 Bacteria 20950
692 Ga0496125_0006600 3300048928 Bacteria 12493
693 Ga0496125_0016145 3300048928 Bacteria 7181
694 Ga0496125_0019994 3300048928 Bacteria 6295
695 Ga0496125_0033148 3300048928 Bacteria 4576
696 Ga0496125_0040766 3300048928 Bacteria 3979
697 Ga0496125_0050064 3300048928 Bacteria 3463
698 Ga0496125_0068412 3300048928 Bacteria 2794
699 Ga0496125_0092167 3300048928 Bacteria 2267
700 Ga0496125_0367109 3300048928 Bacteria 853
701 Ga0496125_0566381 3300048928 Bacteria 627
702 Ga0496126_0016268 3300048929 Bacteria 7445
703 Ga0496126_0020312 3300048929 Bacteria 6517
704 Ga0496126_0020749 3300048929 Bacteria 6431
705 Ga0496126_0081434 3300048929 Bacteria 2862
706 Ga0496126_0113931 3300048929 Bacteria 2353
707 Ga0495678_004246 3300049459 Bacteria 8391
708 Ga0495678_004646 3300049459 Bacteria 7876
709 Ga0495678_014303 3300049459 Bacteria 3694
710 Ga0495678_039540 3300049459 Bacteria 1902
711 Ga0495678_041250 3300049459 Bacteria 1848
712 Ga0495678_066853 3300049459 Bacteria 1329
713 Ga0495678_111583 3300049459 Bacteria 931
714 Ga0495678_137838 3300049459 Bacteria 801
715 Ga0495682_0000424 3300049460 Bacteria 29663
716 Ga0495682_0007815 3300049460 Bacteria 4235
717 Ga0495682_0016369 3300049460 Bacteria 2807
718 Ga0495682_0135606 3300049460 Bacteria 879
719 Ga0501034_0000020 3300049571 Bacteria 280294
720 Ga0501034_0000338 3300049571 Bacteria 81772
721 Ga0501036_0165148 3300049572 Unclassified 1866
722 Ga0501038_0277868 3300049574 Unclassified 1319
723 Ga0501202_117630 3300049652 Bacteria 665
724 Ga0501241_041058 3300049758 Bacteria 896
725 Ga0501241_050351 3300049758 Bacteria 822
726 Ga0501269_049290 3300049766 Bacteria 576
727 Ga0501204_007269 3300049850 Bacteria 1243
728 Ga0501226_000079 3300049853 Bacteria 29272
729 nmdc:mga00v17_784893_c1 3300050491 Bacteria 607
730 nmdc:mga00v17_962731_c1 3300050491 Bacteria 538
731 nmdc:mga08x19_371992_c1 3300050514 Bacteria 1000
732 Ga0500572_002751 3300053111 Bacteria 4148
733 Ga0500659_0009338 3300053135 Bacteria 5387
734 Ga0500573_0029698 3300053140 Bacteria 3151
735 Ga0500634_0000688 3300053161 Bacteria 11588
736 2511266556 2511231006 Bacteria 6794709
737 2511317309 2511231015 Bacteria 6598026
738 2511369146 2511231023 Bacteria 6808468
739 2511375294 2511231024 Bacteria 5835885
740 2511411118 2511231031 Bacteria 6558529
741 2512328308 2512047018 Bacteria 6663241
742 2555247739 2554235231 Bacteria 5215788
743 2555668039 2554235341 Bacteria 6867980
744 2583790481 2582580891 Bacteria 6800976
745 2597856254 2597489887 Bacteria 6666321
746 2597865804 2597489888 Bacteria 6179543
747 2597871619 2597489889 Bacteria 6297495
748 2599328376 2599185155 Bacteria 5827168
749 2599355038 2599185160 Bacteria 6844013
750 2599361138 2599185161 Bacteria 6960462
751 2599367460 2599185162 Bacteria 6957254
752 2599374250 2599185163 Bacteria 6995158
753 2599380144 2599185164 Bacteria 6841688
754 2599386591 2599185165 Bacteria 6843250
755 2599393108 2599185166 Bacteria 6959206
756 2599399847 2599185167 Bacteria 6353609
757 2599404875 2599185168 Bacteria 6997636
758 2599452630 2599185179 Bacteria 6611171
759 2599461872 2599185181 Bacteria 6844519
760 2599467085 2599185182 Bacteria 6883168
761 2599483490 2599185185 Bacteria 6652270
762 2599491035 2599185186 Bacteria 6831633
763 2599502945 2599185188 Bacteria 6164180
764 2599508286 2599185189 Bacteria 5862825
765 2599514301 2599185190 Bacteria 6285678
766 2599521575 2599185191 Bacteria 6297582
767 2599805396 2599185257 Bacteria 6492581
768 2599881892 2599185288 Bacteria 6666191
769 2599893677 2599185290 Bacteria 6289611
770 2599951666 2599185303 Bacteria 6512725
771 2599996043 2599185311 Bacteria 6354990
772 2600214494 2599185356 Bacteria 6843884
773 2600364102 2600254931 Bacteria 6734225
774 2600442465 2600254954 Bacteria 5100516
775 2601692748 2600255296 Bacteria 5784754
776 2601774801 2600255313 Bacteria 6842543
777 2602012399 2600255389 Bacteria 5275336
778 2608381292 2606217733 Bacteria 6360972
779 2621297737 2619619299 Bacteria 6649820
780 2643844247 2643221565 Bacteria 6216018
781 2643873622 2643221571 Bacteria 6228673
782 2644623412 2643221713 Bacteria 6554480
783 2671097639 2667528171 Bacteria 6900659
784 2671767868 2671180172 Bacteria 6495783
785 2677897962 2675903420 Bacteria 6247433
786 2715750817 2713897148 Bacteria 5883533
787 2723250536 2721755607 Bacteria 5841722
788 2738749305 2738541282 Bacteria 6593925
789 2738811326 2738541294 Bacteria 6925949
790 2738858346 2738541303 Bacteria 6591772
791 2738898686 2738541309 Bacteria 6926455
792 2739286518 2738543020 Bacteria 5718238
793 2739291831 2738543021 Bacteria 5718241
794 2739316421 2738543025 Bacteria 6600348
795 2743735663 2740892503 Bacteria 6855563
796 2765582213 2765235841 Bacteria 6137024
797 2784260457 2784132063 Bacteria 6262788
798 2807409926 2806310737 Bacteria 5751088
799 2807458273 2806310745 Bacteria 5742165
800 2808906903 2808606373 Bacteria 4423627
801 2808921882 2808606376 Bacteria 6248667
802 2808928757 2808606377 Bacteria 6646337
803 2808941123 2808606379 Bacteria 5022697
804 2808944003 2808606380 Bacteria 6248705
805 2808950878 2808606381 Bacteria 6646461
806 2808960449 2808606382 Bacteria 6841132
807 2808980232 2808606385 Bacteria 6711065
808 2808995945 2808606388 Bacteria 6706662
809 2817493129 2816332298 Bacteria 6852809
810 2819658373 2818991456 Bacteria 6123676
811 2819702722 2818991464 Bacteria 6907494
812 2823422538 2823421272 Bacteria 5372474
813 2826584138 2826581358 Bacteria 5963467
814 2834034228 2834028612 Bacteria 6354979
815 2842808887 2842805378 Bacteria 5385175
816 2842820904 2842815866 Bacteria 5947510
817 2842829758 2842826826 Bacteria 5974129
818 2842835713 2842832357 Bacteria 5959113
819 2842841899 2842837860 Bacteria 6066181
820 2842847460 2842843487 Bacteria 6004777
821 2842849687 2842849001 Bacteria 5924277
822 2844668540 2844665904 Bacteria 6817974
823 2852612481 2852612431 Bacteria 6885235
824 2852662826 2852657418 Bacteria 6472974
825 2852669783 2852667396 Bacteria 6885555
826 2860872217 2860867994 Bacteria 5645326
827 2878030782 2878029506 Bacteria 6418441
828 2880231694 2880230671 Bacteria 6140320
829 2904520729 2904518522 Bacteria 6068986
830 2912964858 2912963787 Bacteria 5646108
831 2917071800 2917070673 Bacteria 6868303
832 2919067268 2919063839 Bacteria 6302690
833 2919158015 2919155634 Bacteria 4860545
834 2919385833 2919385768 Bacteria 5897293
835 2919492789 2919487758 Bacteria 5929766
836 2919505023 2919501602 Bacteria 5286340
837 2923154672 2923153595 Bacteria 6870622
838 2926066700 2926063275 Bacteria 5285848
839 2929194331 2929189879 Bacteria 5930554
840 2931395601 2931390751 Bacteria 6273349
841 2935353973 2935353572 Unclassified 6955622
842 2939638119 2939636861 Bacteria 6297853
843 2939653213 2939651529 Bacteria 5895393
844 2945931726 2945928738 Bacteria 6053221
845 2945961363 2945961074 Bacteria 7342064
846 2946007808 2946006987 Bacteria 6705746
847 2946032819 2946027586 Bacteria 6049274
848 2947233574 2947233263 Bacteria 6439278
849 2969305605 2969304461 Bacteria 6601805
850 2984291357 2984286254 Bacteria 6702062
851 2998141047 2998139840 Bacteria 6073514
852 3007400202 3007395558 Bacteria 6755444
853 3007420686 3007419365 Bacteria 7026924
854 3007516333 3007511990 Bacteria 6481491
855 3007619716 3007614139 Bacteria 6053559
856 3007719271 3007718800 Bacteria 5971527
857 3007809345 3007803356 Bacteria 5931491
858 3007860931 3007855910 Bacteria 5637581
859 3007863731 3007861166 Bacteria 6045338
860 3007873363 3007872151 Bacteria 5268868
861 637318417 637000220 Bacteria 7074893
862 651175012 651053060 Bacteria 4689946
863 8011353478 8011350971 Bacteria 6158957
864 8015688908 8015687852 Bacteria 6613826
865 8019773286 8019769354 Bacteria 6924660
866 8034964175 8034962539 Bacteria 4884839
867 8052498894 8052494512 Bacteria 5765634
868 8054286154 8054285046 Bacteria 6919322
869 8054351117 8054347763 Bacteria 5901107
870 8054508116 8054503363 Bacteria 6101651
871 8054934505 8054929484 Bacteria 5599761
872 8055772025 8055770955 Bacteria 6827675
873 8055823068 8055817908 Bacteria 6609162
874 8056120275 8056115690 Bacteria 5527654
875 8056121877 8056120720 Bacteria 5758328
876 8056136482 8056131705 Bacteria 6107031
877 8056141875 8056137416 Bacteria 6147080
878 8056153472 8056148874 Bacteria 6479865
879 8056162739 8056161164 Bacteria 6106669
880 8056170004 8056166840 Bacteria 5820959
881 8056176138 8056172158 Bacteria 6133900
882 8056569697 8056569372 Bacteria 5997322
883 8057803314 8057798959 Bacteria 6713499
884 Ga0182008_10062189
885 SwRhRL2b_contig_1442390
886 JGI25163J39215_1004342
887 JGI25163J39215_1004908
888 JGI25164J39214_1000703
889 JGI25165J46597_1001416
890 Ga0055539_1000037
891 Ga0055533_1000047
892 Ga0055532_1000129
893 Ga0055525_1000271
894 Ga0055536_1000723
895 Ga0055534_1036827
896 Ga0055530_10001304
897 Ga0055530_10002470
898 Ga0055540_1000806
899 Ga0055541_1000025
900 Ga0065714_10065440
901 Ga0065714_10347748
902 Ga0065714_10477409
903 Ga0065704_10015268
904 Ga0065704_10018014
905 Ga0065704_10046174
906 Ga0065704_10095455
907 Ga0065704_10114970
908 Ga0065704_10233039
909 Ga0065712_10068567
910 Ga0070670_100002907
911 Ga0070670_100028293
912 Ga0070661_100000022
913 Ga0070674_102234697
914 Ga0070659_100917259
915 Ga0070663_101323870
916 Ga0070662_100000041
917 Ga0070662_100127964
918 Ga0068853_100009803
919 Ga0070665_100008895
920 Ga0070665_100328593
921 Ga0070665_101349354
922 Ga0070665_101807467
923 Ga0070664_100000088
924 Ga0068854_100013980
925 Ga0068851_10000044
926 Ga0075364_10104773
927 Ga0075364_10287067
928 Ga0075432_10110299
929 Ga0075432_10292168
930 Ga0075362_10395373
931 Ga0075369_10447936
932 Ga0075436_100192079
933 Ga0075436_100205541
934 Ga0075436_100417703
935 Ga0099823_1000052
936 Ga0079104_1047468
937 Ga0105251_10000151
938 Ga0105251_10000156
939 Ga0105251_10002615
940 Ga0105251_10005925
941 Ga0105251_10008174
942 Ga0105251_10024252
943 Ga0105251_10031154
944 Ga0105251_10041365
945 Ga0105251_10052601
946 Ga0105251_10057026
947 Ga0105251_10063879
948 Ga0105251_10117510
949 Ga0105251_10164436
950 Ga0105251_10188254
951 Ga0105251_10209749
952 Ga0105251_10217369
953 Ga0105251_10302966
954 Ga0105244_10000074
955 Ga0105244_10000724
956 Ga0105244_10003567
957 Ga0105244_10005787
958 Ga0105244_10014340
959 Ga0105244_10018455
960 Ga0105244_10023141
961 Ga0105244_10027560
962 Ga0105244_10032297
963 Ga0105244_10055931
964 Ga0105244_10083518
965 Ga0105244_10098306
966 Ga0105244_10101998
967 Ga0105244_10123021
968 Ga0105244_10222041
969 Ga0105244_10225462
970 Ga0105244_10240968
971 Ga0105244_10267915
972 Ga0105244_10339495
973 Ga0105250_10000427
974 Ga0105250_10000446
975 Ga0105250_10005700
976 Ga0105250_10009794
977 Ga0105250_10045205
978 Ga0105250_10098877
979 Ga0105250_10118902
980 Ga0105250_10122498
981 Ga0105250_10132506
982 Ga0105250_10148069
983 Ga0105250_10195089
984 Ga0105250_10270659
985 Ga0105243_10001292
986 Ga0105243_10001345
987 Ga0105243_10011029
988 Ga0105243_10039461
989 Ga0105243_10049266
990 Ga0105243_10118381
991 Ga0105242_10134779
992 Ga0105237_10001113
993 Ga0105249_10093764
994 Ga0105246_10000856
995 Ga0105246_10003908
996 Ga0105246_10125609
997 Ga0157336_1010472
998 Ga0157345_1000706
999 Ga0157347_1013960
1000 Ga0157373_10014045
1001 Ga0157373_10016307
1002 Ga0157373_10018124
1003 Ga0157373_10164053
1004 Ga0157373_10217843
1005 Ga0157373_10425881
1006 Ga0157373_10976798
1007 Ga0157371_10002116
1008 Ga0157371_10002403
1009 Ga0157371_10006388
1010 Ga0157370_10080216
1011 Ga0157370_10142756
1012 Ga0157370_10534922
1013 Ga0157370_10545025
1014 Ga0157370_11060627
1015 Ga0157369_10015853
1016 Ga0157369_10259708
1017 Ga0157369_10544127
1018 Ga0157369_11142078
1019 Ga0157369_11238255
1020 Ga0163162_10003878
1021 Ga0163162_10015992
1022 Ga0163162_10020659
1023 Ga0163162_12246387
1024 Ga0157372_10012341
1025 Ga0157372_10022670
1026 Ga0157375_11133704
1027 Ga0157375_12878832
1028 Ga0182008_10000570
1029 Ga0182008_10121858
1030 Ga0182008_10177395
1031 Ga0182008_10254779
1032 Ga0182008_10300384
1033 Ga0182006_1001124
1034 Ga0182006_1009185
1035 Ga0182006_1011257
1036 Ga0182006_1118697
1037 Ga0182006_1132864
1038 Ga0182005_1020832
1039 Ga0182005_1092268
1040 Ga0163161_10002724
1041 Ga0163161_10003020
1042 Ga0163161_10006539
1043 Ga0163161_10493788
1044 Ga0209435_100880
1045 Ga0209760_100248
1046 Ga0209760_100553
1047 Ga0209784_100032
1048 Ga0209566_100036
1049 Ga0209674_100054
1050 Ga0209147_100055
1051 Ga0209563_100055
1052 Ga0209563_100693
1053 Ga0207427_100004
1054 Ga0209437_100028
1055 Ga0209437_116779
1056 Ga0209258_100283
1057 Ga0209646_1000462
1058 Ga0209026_1015738
1059 Ga0209677_100033
1060 Ga0209759_1016440
1061 Ga0209233_1000008
1062 Ga0209676_1000056
1063 Ga0209676_1000551
1064 Ga0209050_1001645
1065 Ga0209051_1000061
1066 Ga0207656_10000022
1067 Ga0207696_1000032
1068 Ga0207696_1000034
1069 Ga0207696_1000129
1070 Ga0207696_1000340
1071 Ga0207696_1004452
1072 Ga0207696_1026381
1073 Ga0207696_1031615
1074 Ga0207696_1095840
1075 Ga0207696_1124543
1076 Ga0207696_1129559
1077 Ga0207696_1159881
1078 Ga0207655_1000357
1079 Ga0207655_1000408
1080 Ga0207655_1000487
1081 Ga0207655_1003661
1082 Ga0207655_1006079
1083 Ga0207655_1006620
1084 Ga0207655_1008861
1085 Ga0207655_1009590
1086 Ga0207655_1010833
1087 Ga0207655_1016182
1088 Ga0207655_1017075
1089 Ga0207655_1026687
1090 Ga0207655_1036740
1091 Ga0207655_1042410
1092 Ga0207655_1137211
1093 Ga0207655_1165354
1094 Ga0207713_1000014
1095 Ga0207713_1000163
1096 Ga0207713_1001339
1097 Ga0207713_1005506
1098 Ga0207713_1008041
1099 Ga0207713_1012133
1100 Ga0207713_1014589
1101 Ga0207713_1027582
1102 Ga0207713_1028660
1103 Ga0207713_1095505
1104 Ga0207713_1122789
1105 Ga0207713_1247938
1106 Ga0207671_10000034
1107 Ga0207649_10000006
1108 Ga0207681_10000607
1109 Ga0207650_10000092
1110 Ga0207650_10001090
1111 Ga0207706_10001484
1112 Ga0207706_10059457
1113 Ga0207686_10609229
1114 Ga0207709_10000757
1115 Ga0207709_10005599
1116 Ga0207709_10077240
1117 Ga0207709_10212080
1118 Ga0207669_11127549
1119 Ga0207679_10000010
1120 Ga0207712_11388021
1121 Ga0207640_10563537
1122 Ga0207639_10003207
1123 Ga0207678_11315615
1124 Ga0209281_1018994
1125 Ga0209281_1057859
1126 Ga0209389_1000005
1127 Ga0209371_1000277
1128 Ga0207428_10538878
1129 Ga0268266_10010027
1130 Ga0268266_10323293
1131 Ga0268266_10503939
1132 Ga0268266_10979137
1133 Ga0268256_1000315
1134 Ga0268256_1022197
1135 Ga0307511_10254534
1136 Ga0316183_1131894
1137 Ga0316183_1206930
1138 Ga0307509_10866175
1139 Ga0307408_100061680
1140 Ga0307514_10378887
1141 Ga0307516_10438332
1142 Ga0307405_10000772
1143 Ga0307405_10005627
1144 Ga0307413_10122108
1145 Ga0307413_10907794
1146 Ga0307407_10121169
1147 Ga0307412_10000233
1148 Ga0307412_10786722
1149 Ga0307412_10799557
1150 Ga0307412_10966253
1151 Ga0307412_11141867
1152 Ga0307412_11335910
1153 Ga0307409_101006922
1154 Ga0307416_101070791
1155 Ga0307414_10043834
1156 Ga0307414_10383068
1157 Ga0307414_10875289
1158 Ga0307411_10134137
1159 Ga0307510_10008612
1160 Ga0439438_001545
1161 Ga0439438_001889
1162 Ga0439438_018209
1163 Ga0439438_067003
1164 Ga0439447_011365
1165 Ga0439447_016069
1166 Ga0439447_018438
1167 Ga0439447_034898
1168 Ga0439466_0011833
1169 Ga0439466_0022591
1170 Ga0439466_0038734
1171 Ga0439466_0082443
1172 Ga0439466_0134093
1173 Ga0451797_0795164
1174 Ga0451837_1779630
1175 Ga0451841_0884857
1176 Ga0439431_0022692
1177 Ga0439432_000198
1178 Ga0439432_000272
1179 Ga0439432_051602
1180 Ga0439432_107354
1181 Ga0439451_002129
1182 Ga0439451_002955
1183 Ga0439451_004570
1184 Ga0439451_006684
1185 Ga0439452_001129
1186 Ga0439452_012768
1187 Ga0439452_037852
1188 Ga0439456_000173
1189 Ga0439456_013117
1190 Ga0439456_017969
1191 Ga0439456_101385
1192 Ga0439463_004835
1193 Ga0439463_026452
1194 Ga0450911_000552
1195 Ga0450911_008582
1196 Ga0450911_019113
1197 Ga0450920_010368
1198 Ga0450923_062722
1199 Ga0450923_187374
1200 Ga0450898_000205
1201 Ga0450900_015897
1202 Ga0450902_002305
1203 Ga0450902_021864
1204 Ga0450902_040800
1205 Ga0450902_045676
1206 Ga0450902_069694
1207 Ga0450902_091233
1208 Ga0450902_102335
1209 Ga0450903_022308
1210 Ga0450903_049209
1211 Ga0450904_000292
1212 Ga0450905_000284
1213 Ga0450905_031226
1214 Ga0450906_000396
1215 Ga0450906_012358
1216 Ga0450907_056790
1217 Ga0439446_0084009
1218 Ga0450908_022514
1219 Ga0439464_0014490
1220 Ga0450893_0017687
1221 Ga0450901_000018
1222 Ga0450901_010503
1223 Ga0439440_0028426
1224 Ga0495617_002206
1225 Ga0495617_055684
1226 Ga0495617_081263
1227 Ga0495617_138370
1228 Ga0495617_191446
1229 Ga0495617_273900
1230 Ga0495617_278478
1231 Ga0495627_000074
1232 Ga0495627_002496
1233 Ga0495627_009192
1234 Ga0495627_063237
1235 Ga0495627_079781
1236 Ga0495590_0043584
1237 Ga0495590_0048158
1238 Ga0495591_000142
1239 Ga0495591_007147
1240 Ga0495591_007531
1241 Ga0495591_026679
1242 Ga0495591_028978
1243 Ga0495591_048906
1244 Ga0495591_064265
1245 Ga0495591_112867
1246 Ga0495591_143812
1247 Ga0495638_0023362
1248 Ga0495638_0024038
1249 Ga0495638_0172809
1250 Ga0495638_0243503
1251 Ga0495638_0631736
1252 Ga0495653_0072273
1253 Ga0495653_0275055
1254 Ga0495653_0754748
1255 Ga0495650_0021495
1256 Ga0495650_0041170
1257 Ga0495650_0051945
1258 Ga0495650_0136268
1259 Ga0495650_0220946
1260 Ga0495605_0008969
1261 Ga0495605_0104124
1262 Ga0495605_0232105
1263 Ga0495584_0003442
1264 Ga0495584_0004205
1265 Ga0495584_0093399
1266 Ga0495584_0162683
1267 Ga0495584_0428590
1268 Ga0495584_0459937
1269 Ga0495585_0006062
1270 Ga0495585_0166376
1271 Ga0495596_0046741
1272 Ga0495596_0342790
1273 Ga0495607_0000315
1274 Ga0495607_0000628
1275 Ga0495607_0001499
1276 Ga0495607_0016720
1277 Ga0495607_0018105
1278 Ga0495607_0093067
1279 Ga0495607_0105311
1280 Ga0495607_0147454
1281 Ga0495607_0149505
1282 Ga0495607_0160128
1283 Ga0495607_0172428
1284 Ga0495607_0432646
1285 Ga0495583_0003303
1286 Ga0495583_0005912
1287 Ga0495583_0015210
1288 Ga0495583_0054252
1289 Ga0495606_0002059
1290 Ga0495606_0010030
1291 Ga0495606_0012549
1292 Ga0495606_0028902
1293 Ga0495606_0031441
1294 Ga0495606_0063547
1295 Ga0495606_0095142
1296 Ga0495606_0182069
1297 Ga0495610_0003562
1298 Ga0495610_0017421
1299 Ga0495610_0078905
1300 Ga0495610_0099923
1301 Ga0495610_0132180
1302 Ga0495610_0149441
1303 Ga0495610_0226777
1304 Ga0495616_0015839
1305 Ga0495616_0016061
1306 Ga0495616_0026943
1307 Ga0495616_0088539
1308 Ga0495616_0122729
1309 Ga0495616_0173614
1310 Ga0495620_0000003
1311 Ga0495620_0003964
1312 Ga0495620_0016249
1313 Ga0495620_0033116
1314 Ga0495620_0055029
1315 Ga0495620_0116938
1316 Ga0495620_0166826
1317 Ga0495631_0003979
1318 Ga0495631_0175205
1319 Ga0495632_0001347
1320 Ga0495632_0004065
1321 Ga0495632_0007143
1322 Ga0495632_0035192
1323 Ga0495632_0069071
1324 Ga0495632_0113040
1325 Ga0495632_0177228
1326 Ga0495632_0243355
1327 Ga0495632_0314466
1328 Ga0495637_0000149
1329 Ga0495637_0007327
1330 Ga0495637_0011093
1331 Ga0495637_0011109
1332 Ga0495637_0013477
1333 Ga0495637_0014036
1334 Ga0495637_0014639
1335 Ga0495637_0015843
1336 Ga0495637_0047522
1337 Ga0495637_0227254
1338 Ga0495643_0000769
1339 Ga0495643_0005626
1340 Ga0495643_0009610
1341 Ga0495643_0017886
1342 Ga0495643_0109805
1343 Ga0495643_0131596
1344 Ga0495644_0021212
1345 Ga0495644_0074713
1346 Ga0495644_0166606
1347 Ga0495648_0000711
1348 Ga0495648_0022690
1349 Ga0495648_0027692
1350 Ga0495648_0096980
1351 Ga0495648_0180524
1352 Ga0495648_0340493
1353 Ga0495648_0347945
1354 Ga0495666_0080959
1355 Ga0495666_0081840
1356 Ga0495652_0073029
1357 Ga0495654_0001376
1358 Ga0495654_0004365
1359 Ga0495654_0004632
1360 Ga0495654_0059938
1361 Ga0495654_0105365
1362 Ga0495654_0110267
1363 Ga0495654_0222468
1364 Ga0495654_0315912
1365 Ga0495654_0319787
1366 Ga0495654_0343643
1367 Ga0495654_0377031
1368 Ga0495654_0404705
1369 Ga0495654_0408284
1370 Ga0495609_0004361
1371 Ga0495609_0006000
1372 Ga0495609_0016858
1373 Ga0495609_0138241
1374 Ga0495609_0396707
1375 Ga0495597_0000040
1376 Ga0495597_0008842
1377 Ga0495597_0022385
1378 Ga0495597_0069355
1379 Ga0495597_0130498
1380 Ga0495597_0416659
1381 Ga0495597_0429243
1382 Ga0495622_0009776
1383 Ga0495622_0117666
1384 Ga0495622_0132301
1385 Ga0495633_0015207
1386 Ga0495633_0081240
1387 Ga0495656_0243945
1388 Ga0495668_0019087
1389 Ga0495668_0134406
1390 Ga0495668_0776499
1391 Ga0495634_0096465
1392 Ga0495611_0002323
1393 Ga0495625_0009413
1394 Ga0495625_0012425
1395 Ga0495625_0022126
1396 Ga0495625_0030882
1397 Ga0495625_0044181
1398 Ga0495625_0340986
1399 Ga0495625_0386123
1400 Ga0495635_0184503
1401 Ga0495661_0003082
1402 Ga0495661_0021797
1403 Ga0495661_0131835
1404 Ga0495661_0234164
1405 Ga0495661_0501788
1406 Ga0495588_0049970
1407 Ga0495623_0035311
1408 Ga0495613_0025885
1409 Ga0495624_0055548
1410 Ga0495670_0004025
1411 Ga0495670_0437418
1412 Ga0495671_0021803
1413 Ga0495671_0103127
1414 Ga0495671_0104460
1415 Ga0495671_0160754
1416 Ga0495671_0285580
1417 Ga0495671_0306146
1418 Ga0495671_0315213
1419 Ga0495649_0018140
1420 Ga0495649_0022629
1421 Ga0495649_0063508
1422 Ga0495649_0108018
1423 Ga0495649_0115598
1424 Ga0495649_0210774
1425 Ga0495649_0278755
1426 Ga0495589_0003658
1427 Ga0495589_0005181
1428 Ga0495589_0008171
1429 Ga0495600_0091123
1430 Ga0495600_0839231
1431 Ga0495660_0002366
1432 Ga0495660_0002578
1433 Ga0495660_0007120
1434 Ga0495660_0085495
1435 Ga0495660_0097007
1436 Ga0495660_0122532
1437 Ga0495660_0404321
1438 Ga0495660_0441687
1439 Ga0495604_0985144
1440 Ga0495672_0000803
1441 Ga0495672_0020935
1442 Ga0495672_0051133
1443 Ga0495672_0066847
1444 Ga0495672_0138972
1445 Ga0495672_0147788
1446 Ga0495672_0179430
1447 Ga0495672_0290118
1448 Ga0495672_0492087
1449 Ga0495676_0012839
1450 Ga0495676_0043747
1451 Ga0495680_0049810
1452 Ga0495680_0099463
1453 Ga0495680_0145082
1454 Ga0495680_0171096
1455 Ga0495683_0014352
1456 Ga0495683_0102791
1457 Ga0495683_0161101
1458 Ga0495683_0216360
1459 Ga0495687_046737
1460 Ga0495675_0144708
1461 Ga0495679_001680
1462 Ga0495679_003292
1463 Ga0495679_014244
1464 Ga0495679_040989
1465 Ga0495673_0009130
1466 Ga0495673_0011025
1467 Ga0495673_0041215
1468 Ga0495673_0072700
1469 Ga0495673_0072716
1470 Ga0495673_0083038
1471 Ga0495673_0127332
1472 Ga0495673_0141705
1473 Ga0495673_0150382
1474 Ga0495681_0005872
1475 Ga0495681_0006996
1476 Ga0495681_0007376
1477 Ga0495681_0027957
1478 Ga0495681_0050121
1479 Ga0495681_0057337
1480 Ga0495681_0122671
1481 Ga0495681_0396557
1482 Ga0495684_0137497
1483 Ga0495686_0005761
1484 Ga0495686_0014722
1485 Ga0495686_0034281
1486 Ga0495686_0264041
1487 Ga0495686_0270277
1488 Ga0495602_0050423
1489 Ga0495626_0002482
1490 Ga0495626_0007969
1491 Ga0495626_0033237
1492 Ga0496100_0412805
1493 Ga0496108_0221973
1494 Ga0496110_0140537
1495 Ga0496110_1168787
1496 Ga0496110_1520227
1497 Ga0496111_0289461
1498 Ga0496111_0962508
1499 Ga0496114_0161901
1500 Ga0496114_1555243
1501 Ga0496116_0000999
1502 Ga0496116_0004955
1503 Ga0496116_0015031
1504 Ga0496116_0196738
1505 Ga0496117_0001374
1506 Ga0496117_0003526
1507 Ga0496117_0006099
1508 Ga0496117_0011495
1509 Ga0496117_0013502
1510 Ga0496117_0017282
1511 Ga0496117_0030905
1512 Ga0496117_0043173
1513 Ga0496117_0074301
1514 Ga0496117_0082952
1515 Ga0496117_0090820
1516 Ga0496117_0095919
1517 Ga0496117_0497113
1518 Ga0496117_0547954
1519 Ga0496118_0014465
1520 Ga0496118_0017390
1521 Ga0496118_0024382
1522 Ga0496118_0042899
1523 Ga0496118_0056299
1524 Ga0496118_0113685
1525 Ga0496118_0114159
1526 Ga0496118_0116526
1527 Ga0496118_0141667
1528 Ga0496118_0167625
1529 Ga0496118_0240266
1530 Ga0496118_0309661
1531 Ga0496119_0001590
1532 Ga0496119_0037432
1533 Ga0496119_0551517
1534 Ga0496120_0007481
1535 Ga0496120_0034739
1536 Ga0496121_0002354
1537 Ga0496121_0016619
1538 Ga0496121_0020740
1539 Ga0496121_0046064
1540 Ga0496121_0107503
1541 Ga0496121_0245921
1542 Ga0496121_0247835
1543 Ga0496122_0001232
1544 Ga0496122_0015945
1545 Ga0496122_0030731
1546 Ga0496122_0035390
1547 Ga0496122_0091273
1548 Ga0496122_0094246
1549 Ga0496122_0121958
1550 Ga0496122_0369638
1551 Ga0496123_0001000
1552 Ga0496123_0002775
1553 Ga0496123_0035262
1554 Ga0496123_0084183
1555 Ga0496123_0111848
1556 Ga0496123_0120782
1557 Ga0496123_0229929
1558 Ga0496123_0286835
1559 Ga0496123_0476110
1560 Ga0496124_0000692
1561 Ga0496124_0005321
1562 Ga0496124_0006823
1563 Ga0496124_0018847
1564 Ga0496124_0020869
1565 Ga0496124_0023760
1566 Ga0496124_0031447
1567 Ga0496124_0154995
1568 Ga0496124_0219010
1569 Ga0496124_0274877
1570 Ga0496124_0388178
1571 Ga0496124_0491430
1572 Ga0496124_0645513
1573 Ga0496124_0941614
1574 Ga0496125_0003047
1575 Ga0496125_0006600
1576 Ga0496125_0016145
1577 Ga0496125_0019994
1578 Ga0496125_0033148
1579 Ga0496125_0040766
1580 Ga0496125_0050064
1581 Ga0496125_0068412
1582 Ga0496125_0092167
1583 Ga0496125_0367109
1584 Ga0496125_0566381
1585 Ga0496126_0016268
1586 Ga0496126_0020312
1587 Ga0496126_0020749
1588 Ga0496126_0081434
1589 Ga0496126_0113931
1590 Ga0495678_004246
1591 Ga0495678_004646
1592 Ga0495678_014303
1593 Ga0495678_039540
1594 Ga0495678_041250
1595 Ga0495678_066853
1596 Ga0495678_111583
1597 Ga0495678_137838
1598 Ga0495682_0000424
1599 Ga0495682_0007815
1600 Ga0495682_0016369
1601 Ga0495682_0135606
1602 Ga0501034_0000020
1603 Ga0501034_0000338
1604 Ga0501036_0165148
1605 Ga0501038_0277868
1606 Ga0501202_117630
1607 Ga0501241_041058
1608 Ga0501241_050351
1609 Ga0501269_049290
1610 Ga0501204_007269
1611 Ga0501226_000079
1612 nmdc:mga00v17_784893_c1
1613 nmdc:mga00v17_962731_c1
1614 nmdc:mga08x19_371992_c1
1615 Ga0500572_002751
1616 Ga0500659_0009338
1617 Ga0500573_0029698
1618 Ga0500634_0000688
1619 2511266556
1620 2511317309
1621 2511369146
1622 2511375294
1623 2511411118
1624 2512328308
1625 2555247739
1626 2555668039
1627 2583790481
1628 2597856254
1629 2597865804
1630 2597871619
1631 2599328376
1632 2599355038
1633 2599361138
1634 2599367460
1635 2599374250
1636 2599380144
1637 2599386591
1638 2599393108
1639 2599399847
1640 2599404875
1641 2599452630
1642 2599461872
1643 2599467085
1644 2599483490
1645 2599491035
1646 2599502945
1647 2599508286
1648 2599514301
1649 2599521575
1650 2599805396
1651 2599881892
1652 2599893677
1653 2599951666
1654 2599996043
1655 2600214494
1656 2600364102
1657 2600442465
1658 2601692748
1659 2601774801
1660 2602012399
1661 2608381292
1662 2621297737
1663 2643844247
1664 2643873622
1665 2644623412
1666 2671097639
1667 2671767868
1668 2677897962
1669 2715750817
1670 2723250536
1671 2738749305
1672 2738811326
1673 2738858346
1674 2738898686
1675 2739286518
1676 2739291831
1677 2739316421
1678 2743735663
1679 2765582213
1680 2784260457
1681 2807409926
1682 2807458273
1683 2808906903
1684 2808921882
1685 2808928757
1686 2808941123
1687 2808944003
1688 2808950878
1689 2808960449
1690 2808980232
1691 2808995945
1692 2817493129
1693 2819658373
1694 2819702722
1695 2823422538
1696 2826584138
1697 2834034228
1698 2842808887
1699 2842820904
1700 2842829758
1701 2842835713
1702 2842841899
1703 2842847460
1704 2842849687
1705 2844668540
1706 2852612481
1707 2852662826
1708 2852669783
1709 2860872217
1710 2878030782
1711 2880231694
1712 2904520729
1713 2912964858
1714 2917071800
1715 2919067268
1716 2919158015
1717 2919385833
1718 2919492789
1719 2919505023
1720 2923154672
1721 2926066700
1722 2929194331
1723 2931395601
1724 2935353973
1725 2939638119
1726 2939653213
1727 2945931726
1728 2945961363
1729 2946007808
1730 2946032819
1731 2947233574
1732 2969305605
1733 2984291357
1734 2998141047
1735 3007400202
1736 3007420686
1737 3007516333
1738 3007619716
1739 3007719271
1740 3007809345
1741 3007860931
1742 3007863731
1743 3007873363
1744 637318417
1745 651175012
1746 8011353478
1747 8015688908
1748 8019773286
1749 8034964175
1750 8052498894
1751 8054286154
1752 8054351117
1753 8054508116
1754 8054934505
1755 8055772025
1756 8055823068
1757 8056120275
1758 8056121877
1759 8056136482
1760 8056141875
1761 8056153472
1762 8056162739
1763 8056170004
1764 8056176138
1765 8056569697
1766 8057803314

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gx8-assembly1.cif.gz_B the crystal structure of bacillus cereus protein related to nif3 0.9268 2 102
2gx8-assembly1.cif.gz_C-2 the crystal structure of bacillus cereus protein related to nif3 0.9165 2 102
3lnl-assembly1.cif.gz_B crystal structure of staphylococcus aureus protein sa1388 0.8595 2 97
2gx8-assembly1.cif.gz_C-2 the crystal structure of bacillus cereus protein related to nif3 0.825 2 102
6t76-assembly1.cif.gz_A pii-like protein cuta from nostoc sp. pcc 7120 in apo form 0.8229 1 100
ID Description Score Start End Superfamily
af_Q54BW8_1_102_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9788 1 102 3.30.70.120
af_P9WFM1_132_234_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9765 2 101 3.30.70.120
af_Q54BW8_1_102_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9695 1 102 3.30.70.120
af_Q2FY14_127_235_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9509 2 97 3.30.70.120
2gx8B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9268 2 102 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A348HGP7-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9959 1 101
AF-A0A517CPW1-F1-model_v4 deleted 0.993 1 103
AF-A0A5E7RD54-F1-model_v4 GTP cyclohydrolase 1 type 2 0.9927 1 103 GO:0016787
AF-A0A5E6ZTJ4-F1-model_v4 GTP cyclohydrolase 1 type 2 0.9927 1 103 GO:0016787
AF-A0A7C1WQM5-F1-model_v4 NGG1p interacting factor NIF3 0.9924 1 103

Map