F484569

General Info

Members Datasets Scaffolds Average Seq Length
882 326 1764 555

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221678|2644438961
Length 604
Sequence RLRAVPGIRAVSTYRREWLVKDLVAGVVLTTLLVPQGMAYAELAGLPAITGLYTSILCLLGYAVCGPSRVLVLGPDSSLGPMIAATVLPLVVADGDPDRAVALASVLALMVAAVMILASVAKLGFIADLISKPTMIGYMNGLALTILIGQLPKLLGFKVEADNLIGECAGLVRKLADGAAVPAAATVGGCGIVLILVLQRLLPKIPAVLVMVVLAIAATAVFDLGAHGVDLVGELPEGFPPFTVPDVRLADLAPLFGGALGIALVSLADTISNASAFAARSGQEVRGNQEMAGVGAANLAAGLFQGFPVSASGSRTAVAERAGARSQLTGVVGAALIVLMLVLVPGLFRDLPQPALAAVVITASLSLADIPGAVRLWRQRRAEFLLCLAAFVGVALLGVLPGIAVAVALSVLNVFRRAWWPYNTVLGRVQDLEGYHDVRSYPQARQLPGLVIHRFDAPLIFANAKAFRDEIRRLADVDPRPTWIVIAAEPITDVDTTAADVLQELDENLNAQGVHLVFAELKDPVRRKIERYELTRTIDPRHFFPTVEAAVDAFRLRTGAEWAPRRPPPDIAPPPADTAPPPLDIASPPPADDGHHDGAEDRTT

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
310 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
311 2558860280 Kutzneria sp. 744 Isolate Unclassified
312 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
313 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
314 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
315 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
316 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
317 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
318 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
319 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
320 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
321 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
322 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
323 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
324 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
325 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
326 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 0.23
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0.23
Rhizoplane 9.52
Rhizosphere 88.1
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10002594 3300002075 Bacteria 4675
2 JGI24738J21930_10007244 3300002075 Bacteria 2570
3 JGI24744J21845_10000361 3300002077 Bacteria 7757
4 JGI25406J46586_10001317 3300003203 Bacteria 11674
5 Ga0070658_10149849 3300005327 Bacteria 1952
6 Ga0070683_100004234 3300005329 Bacteria 11763
7 Ga0070683_100012321 3300005329 Bacteria 7428
8 Ga0070683_100039924 3300005329 Bacteria 4312
9 Ga0070683_100040738 3300005329 Bacteria 4271
10 Ga0070683_100060608 3300005329 Bacteria 3517
11 Ga0070683_100129725 3300005329 Bacteria 2385
12 Ga0070683_100177975 3300005329 Bacteria 2019
13 Ga0070670_100011377 3300005331 Bacteria 7608
14 Ga0068869_100000672 3300005334 Bacteria 19319
15 Ga0068869_100035330 3300005334 Bacteria 3541
16 Ga0070680_100000135 3300005336 Bacteria 44656
17 Ga0070680_100005054 3300005336 Bacteria 9949
18 Ga0070680_100030659 3300005336 Bacteria 4321
19 Ga0070680_100061964 3300005336 Bacteria 3062
20 Ga0070680_100080356 3300005336 Unclassified 2688
21 Ga0070682_100001129 3300005337 Bacteria 15254
22 Ga0070682_100006989 3300005337 Bacteria 6347
23 Ga0070682_100021497 3300005337 Bacteria 3808
24 Ga0068868_100007548 3300005338 Bacteria 7747
25 Ga0068868_100034361 3300005338 Bacteria 3914
26 Ga0068868_100105593 3300005338 Bacteria 2284
27 Ga0068868_100117303 3300005338 Bacteria 2168
28 Ga0070660_100009909 3300005339 Bacteria 6721
29 Ga0070689_100004510 3300005340 Bacteria 9430
30 Ga0070689_100102416 3300005340 Bacteria 2268
31 Ga0070687_100021220 3300005343 Bacteria 3049
32 Ga0070661_100101541 3300005344 Bacteria 2140
33 Ga0070692_10001374 3300005345 Bacteria 8788
34 Ga0070692_10005242 3300005345 Bacteria 5500
35 Ga0070671_100005326 3300005355 Bacteria 10264
36 Ga0070671_100012639 3300005355 Bacteria 6803
37 Ga0070674_100005664 3300005356 Bacteria 7238
38 Ga0070673_100024595 3300005364 Bacteria 4420
39 Ga0070659_100013914 3300005366 Bacteria 6004
40 Ga0070659_100049618 3300005366 Bacteria 3301
41 Ga0070659_100049664 3300005366 Bacteria 3299
42 Ga0070709_10005337 3300005434 Bacteria 6960
43 Ga0070709_10022372 3300005434 Bacteria 3696
44 Ga0070714_100000974 3300005435 Bacteria 20448
45 Ga0070714_100002168 3300005435 Bacteria 14424
46 Ga0070714_100002616 3300005435 Bacteria 13269
47 Ga0070714_100007815 3300005435 Bacteria 8332
48 Ga0070714_100013040 3300005435 Bacteria 6650
49 Ga0070714_100017478 3300005435 Bacteria 5809
50 Ga0070714_100046678 3300005435 Unclassified 3676
51 Ga0070714_100068894 3300005435 Bacteria 3054
52 Ga0070714_100101202 3300005435 Bacteria 2539
53 Ga0070713_100003754 3300005436 Bacteria 10050
54 Ga0070713_100023202 3300005436 Bacteria 4811
55 Ga0070713_100029057 3300005436 Bacteria 4372
56 Ga0070713_100041203 3300005436 Bacteria 3761
57 Ga0070713_100061707 3300005436 Bacteria 3137
58 Ga0070713_100085957 3300005436 Bacteria 2695
59 Ga0070710_10007083 3300005437 Bacteria 5414
60 Ga0070710_10020055 3300005437 Bacteria 3464
61 Ga0070710_10032808 3300005437 Bacteria 2815
62 Ga0070701_10005335 3300005438 Bacteria 5296
63 Ga0070701_10013604 3300005438 Bacteria 3707
64 Ga0070701_10023749 3300005438 Bacteria 2958
65 Ga0070711_100007610 3300005439 Bacteria 6594
66 Ga0070711_100020370 3300005439 Bacteria 4274
67 Ga0070711_100042360 3300005439 Bacteria 3077
68 Ga0070711_100071560 3300005439 Bacteria 2444
69 Ga0070700_100004148 3300005441 Bacteria 7557
70 Ga0070700_100007174 3300005441 Bacteria 6002
71 Ga0070700_100012601 3300005441 Bacteria 4725
72 Ga0070700_100021607 3300005441 Bacteria 3742
73 Ga0070694_100006385 3300005444 Bacteria 7152
74 Ga0070663_100029447 3300005455 Bacteria 3753
75 Ga0070663_100029835 3300005455 Bacteria 3731
76 Ga0070678_100003700 3300005456 Bacteria 8557
77 Ga0070662_100017767 3300005457 Bacteria 4799
78 Ga0070681_10000020 3300005458 Bacteria 123918
79 Ga0070681_10026083 3300005458 Bacteria 5876
80 Ga0070681_10032436 3300005458 Bacteria 5242
81 Ga0070681_10036883 3300005458 Bacteria 4907
82 Ga0070681_10055574 3300005458 Bacteria 3941
83 Ga0068867_100019015 3300005459 Bacteria 4891
84 Ga0068867_100021874 3300005459 Bacteria 4566
85 Ga0068867_100044464 3300005459 Bacteria 3254
86 Ga0070685_10002662 3300005466 Bacteria 9150
87 Ga0070706_100004208 3300005467 Bacteria 13977
88 Ga0070706_100012140 3300005467 Bacteria 7990
89 Ga0070707_100012396 3300005468 Bacteria 7960
90 Ga0070707_100080485 3300005468 Unclassified 3144
91 Ga0070698_100104833 3300005471 Bacteria 2797
92 Ga0070699_100002823 3300005518 Bacteria 15504
93 Ga0070679_100000044 3300005530 Bacteria 94029
94 Ga0070679_100033742 3300005530 Bacteria 5068
95 Ga0070679_100037668 3300005530 Bacteria 4805
96 Ga0070679_100085799 3300005530 Bacteria 3135
97 Ga0070679_100102225 3300005530 Bacteria 2852
98 Ga0070679_100167816 3300005530 Bacteria 2168
99 Ga0070684_100000622 3300005535 Bacteria 24475
100 Ga0070684_100020042 3300005535 Bacteria 5544
101 Ga0070684_100022148 3300005535 Bacteria 5296
102 Ga0070684_100037755 3300005535 Bacteria 4146
103 Ga0070684_100049238 3300005535 Bacteria 3657
104 Ga0070684_100055477 3300005535 Bacteria 3454
105 Ga0070697_100005200 3300005536 Bacteria 9996
106 Ga0070672_100039743 3300005543 Bacteria 3605
107 Ga0070672_100072106 3300005543 Bacteria 2750
108 Ga0070672_100120348 3300005543 Bacteria 2148
109 Ga0070686_100122995 3300005544 Bacteria 1784
110 Ga0070693_100010163 3300005547 Bacteria 4704
111 Ga0070693_100060028 3300005547 Bacteria 2206
112 Ga0070665_100012542 3300005548 Bacteria 8537
113 Ga0070665_100042412 3300005548 Bacteria 4573
114 Ga0070665_100062706 3300005548 Bacteria 3727
115 Ga0070665_100126293 3300005548 Bacteria 2560
116 Ga0068855_100002117 3300005563 Bacteria 24552
117 Ga0068855_100005045 3300005563 Bacteria 16111
118 Ga0068855_100181217 3300005563 Bacteria 2381
119 Ga0070664_100034953 3300005564 Bacteria 4217
120 Ga0070664_100054431 3300005564 Bacteria 3394
121 Ga0068857_100005707 3300005577 Bacteria 10644
122 Ga0068857_100022308 3300005577 Bacteria 5570
123 Ga0068857_100140635 3300005577 Bacteria 2181
124 Ga0068854_100002147 3300005578 Bacteria 12110
125 Ga0068856_100006035 3300005614 Bacteria 11916
126 Ga0068856_100013804 3300005614 Bacteria 7809
127 Ga0068856_100076180 3300005614 Bacteria 3323
128 Ga0068856_100136322 3300005614 Bacteria 2460
129 Ga0070702_100005662 3300005615 Bacteria 5848
130 Ga0070702_100009743 3300005615 Bacteria 4711
131 Ga0070702_100059838 3300005615 Bacteria 2212
132 Ga0070702_100092737 3300005615 Bacteria 1835
133 Ga0068852_100005875 3300005616 Bacteria 8820
134 Ga0068852_100009233 3300005616 Bacteria 7306
135 Ga0068852_100037992 3300005616 Bacteria 4043
136 Ga0068852_100084755 3300005616 Bacteria 2821
137 Ga0068852_100110271 3300005616 Bacteria 2500
138 Ga0068859_100046929 3300005617 Bacteria 4338
139 Ga0068859_100082194 3300005617 Bacteria 3264
140 Ga0068864_100003975 3300005618 Bacteria 12171
141 Ga0068866_10025248 3300005718 Bacteria 2791
142 Ga0068861_100002408 3300005719 Bacteria 12180
143 Ga0068851_10012207 3300005834 Bacteria 4045
144 Ga0068851_10020541 3300005834 Bacteria 3199
145 Ga0068870_10003481 3300005840 Bacteria 6675
146 Ga0068863_100006471 3300005841 Bacteria 11485
147 Ga0068863_100081257 3300005841 Bacteria 3070
148 Ga0068858_100068777 3300005842 Bacteria 3282
149 Ga0068860_100045967 3300005843 Bacteria 4164
150 Ga0081455_10000123 3300005937 Bacteria 89254
151 Ga0081455_10001506 3300005937 Bacteria 28768
152 Ga0081539_10000919 3300005985 Bacteria 55491
153 Ga0070717_10011176 3300006028 Bacteria 6805
154 Ga0070717_10013777 3300006028 Bacteria 6205
155 Ga0070717_10025313 3300006028 Bacteria 4718
156 Ga0070717_10041275 3300006028 Bacteria 3762
157 Ga0070717_10047747 3300006028 Bacteria 3509
158 Ga0070717_10084741 3300006028 Bacteria 2666
159 Ga0075365_10013836 3300006038 Bacteria 4840
160 Ga0075368_10006845 3300006042 Bacteria 4005
161 Ga0075363_100025841 3300006048 Bacteria 2999
162 Ga0070715_10001284 3300006163 Bacteria 7195
163 Ga0070716_100004409 3300006173 Bacteria 6728
164 Ga0070716_100012672 3300006173 Bacteria 4279
165 Ga0070716_100046609 3300006173 Bacteria 2440
166 Ga0070716_100074208 3300006173 Bacteria 2009
167 Ga0070712_100012909 3300006175 Bacteria 5322
168 Ga0070712_100017813 3300006175 Bacteria 4601
169 Ga0070712_100031738 3300006175 Bacteria 3561
170 Ga0070712_100042643 3300006175 Bacteria 3121
171 Ga0070712_100046323 3300006175 Bacteria 3006
172 Ga0070712_100055682 3300006175 Bacteria 2770
173 Ga0097621_100007462 3300006237 Bacteria 7822
174 Ga0097621_100117148 3300006237 Bacteria 2256
175 Ga0068871_100009216 3300006358 Bacteria 7139
176 Ga0068871_100075614 3300006358 Bacteria 2781
177 Ga0075428_100134410 3300006844 Bacteria 2689
178 Ga0075428_100167834 3300006844 Bacteria 2380
179 Ga0075431_100025422 3300006847 Bacteria 6069
180 Ga0075431_100085037 3300006847 Bacteria 3265
181 Ga0075431_100097074 3300006847 Bacteria 3042
182 Ga0075433_10011613 3300006852 Bacteria 7095
183 Ga0075433_10024336 3300006852 Bacteria 5108
184 Ga0075433_10025055 3300006852 Bacteria 5042
185 Ga0075433_10038978 3300006852 Bacteria 4106
186 Ga0075433_10105672 3300006852 Bacteria 2495
187 Ga0075434_100012332 3300006871 Bacteria 8098
188 Ga0075434_100026109 3300006871 Bacteria 5721
189 Ga0075434_100084553 3300006871 Bacteria 3172
190 Ga0075434_100119422 3300006871 Bacteria 2650
191 Ga0075434_100180303 3300006871 Bacteria 2132
192 Ga0075429_100047159 3300006880 Bacteria 3749
193 Ga0075429_100082607 3300006880 Bacteria 2800
194 Ga0068865_100003709 3300006881 Bacteria 9176
195 Ga0068865_100031231 3300006881 Bacteria 3551
196 Ga0068865_100066120 3300006881 Bacteria 2550
197 Ga0075436_100010143 3300006914 Bacteria 6450
198 Ga0075436_100017185 3300006914 Bacteria 4951
199 Ga0075436_100049588 3300006914 Bacteria 2897
200 Ga0097620_100046929 3300006931 Bacteria 4338
201 Ga0097620_100082193 3300006931 Bacteria 3264
202 Ga0075435_100000523 3300007076 Bacteria 23542
203 Ga0075435_100005298 3300007076 Bacteria 8981
204 Ga0075435_100058051 3300007076 Bacteria 3133
205 Ga0105251_10016259 3300009011 Bacteria 4028
206 Ga0105240_10015709 3300009093 Bacteria 10273
207 Ga0105240_10072227 3300009093 Bacteria 4265
208 Ga0105240_10094129 3300009093 Bacteria 3655
209 Ga0105240_10114985 3300009093 Bacteria 3249
210 Ga0111539_10019426 3300009094 Bacteria 8387
211 Ga0111539_10148357 3300009094 Bacteria 2746
212 Ga0111539_10178312 3300009094 Bacteria 2482
213 Ga0111539_10234046 3300009094 Bacteria 2139
214 Ga0105245_10005589 3300009098 Bacteria 11043
215 Ga0105245_10011825 3300009098 Bacteria 7592
216 Ga0105245_10036074 3300009098 Bacteria 4390
217 Ga0105245_10125346 3300009098 Bacteria 2404
218 Ga0105247_10009645 3300009101 Bacteria 5857
219 Ga0105247_10039178 3300009101 Bacteria 2895
220 Ga0114129_10015764 3300009147 Bacteria 10745
221 Ga0114129_10040454 3300009147 Bacteria 6571
222 Ga0114129_10046739 3300009147 Bacteria 6083
223 Ga0114129_10055068 3300009147 Bacteria 5575
224 Ga0114129_10314640 3300009147 Bacteria 2083
225 Ga0105243_10002387 3300009148 Bacteria 15737
226 Ga0105243_10009903 3300009148 Bacteria 7248
227 Ga0105243_10094380 3300009148 Bacteria 2470
228 Ga0105241_10001988 3300009174 Bacteria 15474
229 Ga0105241_10005381 3300009174 Bacteria 9465
230 Ga0105241_10019360 3300009174 Bacteria 5019
231 Ga0105242_10027713 3300009176 Bacteria 4503
232 Ga0105248_10067072 3300009177 Bacteria 4029
233 Ga0105248_10068314 3300009177 Bacteria 3990
234 Ga0105237_10008550 3300009545 Bacteria 11066
235 Ga0105237_10021863 3300009545 Bacteria 6570
236 Ga0105238_10004485 3300009551 Bacteria 13832
237 Ga0105238_10013378 3300009551 Bacteria 8281
238 Ga0105238_10015810 3300009551 Bacteria 7638
239 Ga0105238_10030996 3300009551 Bacteria 5443
240 Ga0105238_10044458 3300009551 Bacteria 4489
241 Ga0105249_10008050 3300009553 Bacteria 9190
242 Ga0105249_10010209 3300009553 Bacteria 8248
243 Ga0105249_10036681 3300009553 Bacteria 4448
244 Ga0105249_10046632 3300009553 Bacteria 3945
245 Ga0105249_10055325 3300009553 Bacteria 3629
246 Ga0105239_10028892 3300010375 Bacteria 6095
247 Ga0105239_10032423 3300010375 Bacteria 5741
248 Ga0105239_10041232 3300010375 Bacteria 5059
249 Ga0105239_10054291 3300010375 Bacteria 4394
250 Ga0105239_10081713 3300010375 Bacteria 3557
251 Ga0105246_10002583 3300011119 Bacteria 10949
252 Ga0105246_10010935 3300011119 Bacteria 5626
253 Ga0105246_10017620 3300011119 Bacteria 4543
254 Ga0105246_10038000 3300011119 Bacteria 3233
255 Ga0105246_10050252 3300011119 Bacteria 2859
256 Ga0105246_10050500 3300011119 Bacteria 2853
257 Ga0157373_10047373 3300013100 Bacteria 3066
258 Ga0157369_10001889 3300013105 Bacteria 25266
259 Ga0157369_10011108 3300013105 Bacteria 10244
260 Ga0157369_10018141 3300013105 Bacteria 7893
261 Ga0157369_10157007 3300013105 Bacteria 2402
262 Ga0157369_10250643 3300013105 Bacteria 1848
263 Ga0157374_10008821 3300013296 Bacteria 8631
264 Ga0157374_10040301 3300013296 Bacteria 4301
265 Ga0157374_10094403 3300013296 Bacteria 2858
266 Ga0163162_10033665 3300013306 Bacteria 5092
267 Ga0163162_10068450 3300013306 Bacteria 3602
268 Ga0157372_10017094 3300013307 Bacteria 7786
269 Ga0157372_10077393 3300013307 Bacteria 3757
270 Ga0157372_10112101 3300013307 Bacteria 3125
271 Ga0157372_10129147 3300013307 Bacteria 2907
272 Ga0157372_10209447 3300013307 Bacteria 2259
273 Ga0157375_10030166 3300013308 Bacteria 5110
274 Ga0157375_10042902 3300013308 Bacteria 4382
275 Ga0157375_10134302 3300013308 Bacteria 2596
276 Ga0163163_10009952 3300014325 Bacteria 8526
277 Ga0163163_10061935 3300014325 Bacteria 3707
278 Ga0163163_10115834 3300014325 Bacteria 2711
279 Ga0157380_10009185 3300014326 Bacteria 7072
280 Ga0157380_10038542 3300014326 Bacteria 3712
281 Ga0182008_10025926 3300014497 Bacteria 2974
282 Ga0157377_10009848 3300014745 Bacteria 4708
283 Ga0157377_10010375 3300014745 Bacteria 4606
284 Ga0157377_10014394 3300014745 Bacteria 4025
285 Ga0157376_10017650 3300014969 Bacteria 5450
286 Ga0157376_10022075 3300014969 Bacteria 4954
287 Ga0206353_11878011 3300020082 Bacteria 5824
288 Ga0224712_10025006 3300022467 Bacteria 2094
289 Ga0224572_1002365 3300024225 Bacteria 3028
290 Ga0207656_10012516 3300025321 Bacteria 3227
291 Ga0207656_10021898 3300025321 Bacteria 2559
292 Ga0207692_10006172 3300025898 Bacteria 4853
293 Ga0207692_10042480 3300025898 Bacteria 2257
294 Ga0207642_10012998 3300025899 Bacteria 3023
295 Ga0207710_10006639 3300025900 Bacteria 4931
296 Ga0207688_10000213 3300025901 Bacteria 25981
297 Ga0207688_10002494 3300025901 Bacteria 9907
298 Ga0207688_10044282 3300025901 Bacteria 2480
299 Ga0207647_10005252 3300025904 Bacteria 9533
300 Ga0207699_10000619 3300025906 Bacteria 17260
301 Ga0207699_10001901 3300025906 Bacteria 9839
302 Ga0207699_10004489 3300025906 Bacteria 6669
303 Ga0207699_10004492 3300025906 Bacteria 6666
304 Ga0207645_10044425 3300025907 Bacteria 2843
305 Ga0207643_10000218 3300025908 Bacteria 40287
306 Ga0207643_10007267 3300025908 Bacteria 5942
307 Ga0207643_10007735 3300025908 Bacteria 5773
308 Ga0207705_10037063 3300025909 Bacteria 3489
309 Ga0207684_10001508 3300025910 Bacteria 24953
310 Ga0207684_10005740 3300025910 Bacteria 11395
311 Ga0207654_10003770 3300025911 Bacteria 7638
312 Ga0207707_10000090 3300025912 Bacteria 90918
313 Ga0207707_10007781 3300025912 Bacteria 9328
314 Ga0207707_10035007 3300025912 Bacteria 4391
315 Ga0207695_10002866 3300025913 Bacteria 25047
316 Ga0207671_10003461 3300025914 Bacteria 15716
317 Ga0207671_10035151 3300025914 Bacteria 3720
318 Ga0207693_10010102 3300025915 Bacteria 7668
319 Ga0207693_10027829 3300025915 Bacteria 4468
320 Ga0207693_10081784 3300025915 Bacteria 2529
321 Ga0207663_10035938 3300025916 Bacteria 2976
322 Ga0207663_10122751 3300025916 Bacteria 1782
323 Ga0207660_10000219 3300025917 Bacteria 36887
324 Ga0207660_10043409 3300025917 Bacteria 3160
325 Ga0207660_10059241 3300025917 Bacteria 2748
326 Ga0207662_10016436 3300025918 Bacteria 4176
327 Ga0207657_10008572 3300025919 Bacteria 10359
328 Ga0207657_10010945 3300025919 Bacteria 9024
329 Ga0207657_10013651 3300025919 Bacteria 7961
330 Ga0207657_10102038 3300025919 Bacteria 2380
331 Ga0207649_10007987 3300025920 Bacteria 5756
332 Ga0207652_10000485 3300025921 Bacteria 40829
333 Ga0207652_10016208 3300025921 Bacteria 6080
334 Ga0207646_10012024 3300025922 Bacteria 8341
335 Ga0207694_10000843 3300025924 Bacteria 27292
336 Ga0207694_10114250 3300025924 Bacteria 2150
337 Ga0207650_10009927 3300025925 Bacteria 6513
338 Ga0207687_10000842 3300025927 Bacteria 20740
339 Ga0207687_10031812 3300025927 Bacteria 3569
340 Ga0207700_10004656 3300025928 Bacteria 8128
341 Ga0207700_10008259 3300025928 Bacteria 6434
342 Ga0207700_10011992 3300025928 Bacteria 5562
343 Ga0207700_10024576 3300025928 Bacteria 4172
344 Ga0207700_10025233 3300025928 Bacteria 4125
345 Ga0207700_10035520 3300025928 Bacteria 3591
346 Ga0207700_10048897 3300025928 Bacteria 3143
347 Ga0207700_10058256 3300025928 Bacteria 2917
348 Ga0207700_10066774 3300025928 Bacteria 2750
349 Ga0207700_10072356 3300025928 Bacteria 2658
350 Ga0207664_10003669 3300025929 Bacteria 10285
351 Ga0207664_10003919 3300025929 Bacteria 10001
352 Ga0207664_10004524 3300025929 Bacteria 9421
353 Ga0207664_10010352 3300025929 Bacteria 6586
354 Ga0207664_10017382 3300025929 Bacteria 5271
355 Ga0207664_10025480 3300025929 Bacteria 4457
356 Ga0207664_10026630 3300025929 Unclassified 4373
357 Ga0207664_10039346 3300025929 Bacteria 3672
358 Ga0207644_10008003 3300025931 Bacteria 6912
359 Ga0207644_10012375 3300025931 Bacteria 5664
360 Ga0207690_10004202 3300025932 Bacteria 8512
361 Ga0207690_10090184 3300025932 Bacteria 2163
362 Ga0207706_10076573 3300025933 Bacteria 2942
363 Ga0207706_10106804 3300025933 Bacteria 2464
364 Ga0207709_10008686 3300025935 Bacteria 5606
365 Ga0207709_10029106 3300025935 Bacteria 3200
366 Ga0207670_10097738 3300025936 Bacteria 2091
367 Ga0207669_10105408 3300025937 Bacteria 1875
368 Ga0207704_10056512 3300025938 Bacteria 2405
369 Ga0207665_10000412 3300025939 Bacteria 29458
370 Ga0207665_10004021 3300025939 Bacteria 9817
371 Ga0207665_10008637 3300025939 Bacteria 6707
372 Ga0207665_10023651 3300025939 Bacteria 4047
373 Ga0207691_10013198 3300025940 Bacteria 7910
374 Ga0207691_10022500 3300025940 Bacteria 5944
375 Ga0207691_10107485 3300025940 Bacteria 2483
376 Ga0207689_10002593 3300025942 Bacteria 16723
377 Ga0207689_10029825 3300025942 Bacteria 4549
378 Ga0207661_10002657 3300025944 Bacteria 12298
379 Ga0207661_10006624 3300025944 Bacteria 8184
380 Ga0207661_10044306 3300025944 Bacteria 3516
381 Ga0207661_10065827 3300025944 Bacteria 2942
382 Ga0207661_10088523 3300025944 Bacteria 2574
383 Ga0207661_10133799 3300025944 Bacteria 2127
384 Ga0207679_10010995 3300025945 Bacteria 5841
385 Ga0207679_10060091 3300025945 Bacteria 2823
386 Ga0207679_10106384 3300025945 Bacteria 2205
387 Ga0207667_10004602 3300025949 Bacteria 16924
388 Ga0207667_10015537 3300025949 Bacteria 8640
389 Ga0207651_10118895 3300025960 Bacteria 2000
390 Ga0207651_10121339 3300025960 Bacteria 1983
391 Ga0207668_10017830 3300025972 Bacteria 4456
392 Ga0207640_10004012 3300025981 Bacteria 7953
393 Ga0207677_10004443 3300026023 Bacteria 7531
394 Ga0207677_10029647 3300026023 Bacteria 3481
395 Ga0207677_10062601 3300026023 Bacteria 2582
396 Ga0207677_10081446 3300026023 Bacteria 2323
397 Ga0207703_10123776 3300026035 Bacteria 2223
398 Ga0207639_10057038 3300026041 Bacteria 2997
399 Ga0207639_10057387 3300026041 Bacteria 2989
400 Ga0207678_10011871 3300026067 Bacteria 7650
401 Ga0207678_10078529 3300026067 Bacteria 2827
402 Ga0207678_10096187 3300026067 Bacteria 2531
403 Ga0207708_10000985 3300026075 Bacteria 21291
404 Ga0207708_10002530 3300026075 Bacteria 13445
405 Ga0207708_10006019 3300026075 Bacteria 8991
406 Ga0207708_10032889 3300026075 Bacteria 3938
407 Ga0207708_10033380 3300026075 Bacteria 3910
408 Ga0207708_10045044 3300026075 Bacteria 3362
409 Ga0207708_10071096 3300026075 Bacteria 2665
410 Ga0207702_10002437 3300026078 Bacteria 17646
411 Ga0207702_10009971 3300026078 Bacteria 7965
412 Ga0207702_10114614 3300026078 Bacteria 2402
413 Ga0207648_10001308 3300026089 Bacteria 27722
414 Ga0207648_10004509 3300026089 Bacteria 14281
415 Ga0207648_10017309 3300026089 Bacteria 6564
416 Ga0207648_10029778 3300026089 Bacteria 4841
417 Ga0207676_10003391 3300026095 Bacteria 11254
418 Ga0207676_10016826 3300026095 Bacteria 5295
419 Ga0207676_10033378 3300026095 Bacteria 3888
420 Ga0207674_10000093 3300026116 Bacteria 99440
421 Ga0207674_10014208 3300026116 Bacteria 8796
422 Ga0207674_10017738 3300026116 Bacteria 7758
423 Ga0207674_10084964 3300026116 Bacteria 3162
424 Ga0207674_10107503 3300026116 Bacteria 2767
425 Ga0207675_100003463 3300026118 Bacteria 15427
426 Ga0207683_10000454 3300026121 Bacteria 38017
427 Ga0207683_10009054 3300026121 Bacteria 8485
428 Ga0207683_10106699 3300026121 Bacteria 2505
429 Ga0207683_10154855 3300026121 Bacteria 2070
430 Ga0207698_10004756 3300026142 Bacteria 8308
431 Ga0207698_10046821 3300026142 Bacteria 3270
432 Ga0207428_10115835 3300027907 Bacteria 2059
433 Ga0207428_10133363 3300027907 Bacteria 1900
434 Ga0268266_10054809 3300028379 Bacteria 3427
435 Ga0268266_10094610 3300028379 Bacteria 2623
436 Ga0268265_10108993 3300028380 Bacteria 2256
437 Ga0268265_10122970 3300028380 Bacteria 2142
438 Ga0268264_10039541 3300028381 Bacteria 3897
439 Ga0307513_10019341 3300031456 Bacteria 8110
440 Ga0307406_10076400 3300031901 Bacteria 2212
441 Ga0307409_100027270 3300031995 Bacteria 4045
442 Ga0307416_100005109 3300032002 Bacteria 8010
443 Ga0307416_100090392 3300032002 Bacteria 2625
444 Ga0307416_100114158 3300032002 Bacteria 2389
445 Ga0307411_10016550 3300032005 Bacteria 4176
446 Ga0307415_100037871 3300032126 Bacteria 3173
447 Ga0373926_0001583 3300035083 Bacteria 6997
448 Ga0373934_0001615 3300035086 Bacteria 8273
449 Ga0373944_0001827 3300035089 Bacteria 5376
450 Ga0373936_0003892 3300035113 Bacteria 5626
451 Ga0373945_0000591 3300035116 Bacteria 10415
452 Ga0373953_0009920 3300035117 Bacteria 3298
453 Ga0373954_0042125 3300035118 Bacteria 2129
454 Ga0373956_0001004 3300035119 Bacteria 11642
455 Ga0373957_0008506 3300035120 Bacteria 3327
456 Ga0373957_0019408 3300035120 Bacteria 2392
457 Ga0373943_0001628 3300035170 Bacteria 10184
458 Ga0373955_0000005 3300035172 Bacteria 108267
459 Ga0373924_0008586 3300035410 Bacteria 3719
460 Ga0373927_0016122 3300035695 Bacteria 4930
461 Ga0373927_0019496 3300035695 Bacteria 4447
462 Ga0373933_0000043 3300035724 Bacteria 78147
463 Ga0373933_0022557 3300035724 Bacteria 3586
464 Ga0373933_0039045 3300035724 Bacteria 2792
465 Ga0373933_0049229 3300035724 Bacteria 2512
466 Ga0373933_0081560 3300035724 Bacteria 1984
467 Ga0373947_0004411 3300035725 Bacteria 8254
468 Ga0373947_0019417 3300035725 Bacteria 3918
469 Ga0373937_0000245 3300036401 Bacteria 53041
470 Ga0373937_0003783 3300036401 Bacteria 12795
471 Ga0373937_0040151 3300036401 Bacteria 4265
472 Ga0373937_0063250 3300036401 Bacteria 3403
473 Ga0373937_0063513 3300036401 Bacteria 3396
474 Ga0373937_0084052 3300036401 Bacteria 2944
475 Ga0373937_0096125 3300036401 Bacteria 2747
476 Ga0373937_0179693 3300036401 Bacteria 1987
477 Ga0373925_0000028 3300037068 Bacteria 149654
478 Ga0373925_0001494 3300037068 Bacteria 20080
479 Ga0373925_0001915 3300037068 Bacteria 17236
480 Ga0373925_0007560 3300037068 Bacteria 7917
481 Ga0373925_0109962 3300037068 Bacteria 2128
482 Ga0395900_0143787 3300037418 Bacteria 2441
483 Ga0395898_0179084 3300037466 Bacteria 2026
484 Ga0395905_0059024 3300037471 Bacteria 3587
485 Ga0451853_0174584 3300041512 Bacteria 2421
486 Ga0451853_2073262 3300041512 Bacteria 3827
487 Ga0439448_0007867 3300042005 Bacteria 3101
488 Ga0439448_0008553 3300042005 Bacteria 3000
489 Ga0439463_002716 3300042016 Bacteria 4473
490 Ga0450902_007704 3300042137 Bacteria 1671
491 Ga0439458_0008012 3300042157 Bacteria 2350
492 Ga0439458_0008711 3300042157 Bacteria 2263
493 Ga0439460_0018107 3300042461 Bacteria 1893
494 Ga0466963_0001267 3300044694 Bacteria 13391
495 Ga0466970_0012932 3300044765 Bacteria 4275
496 Ga0466959_0070396 3300045049 Bacteria 2534
497 Ga0466967_0004137 3300045976 Bacteria 9701
498 Ga0466967_0007021 3300045976 Bacteria 8065
499 Ga0466967_0101822 3300045976 Bacteria 2626
500 Ga0495592_0000092 3300046454 Bacteria 79147
501 Ga0495592_0011277 3300046454 Bacteria 6759
502 Ga0495592_0033973 3300046454 Bacteria 3846
503 Ga0495592_0097787 3300046454 Bacteria 2096
504 Ga0495629_0001088 3300046459 Bacteria 21535
505 Ga0495629_0001429 3300046459 Bacteria 18830
506 Ga0495629_0014399 3300046459 Bacteria 5689
507 Ga0495641_0001952 3300046461 Bacteria 16770
508 Ga0495641_0022859 3300046461 Bacteria 3119
509 Ga0495651_0000066 3300046462 Bacteria 77538
510 Ga0495651_0001498 3300046462 Bacteria 18071
511 Ga0495651_0003513 3300046462 Bacteria 12018
512 Ga0495651_0010231 3300046462 Bacteria 7200
513 Ga0495651_0011712 3300046462 Bacteria 6738
514 Ga0495651_0018918 3300046462 Bacteria 5337
515 Ga0495651_0019855 3300046462 Bacteria 5211
516 Ga0495651_0058460 3300046462 Bacteria 2958
517 Ga0495653_0002166 3300046463 Bacteria 15515
518 Ga0495653_0003794 3300046463 Bacteria 12221
519 Ga0495653_0004422 3300046463 Bacteria 11360
520 Ga0495653_0008124 3300046463 Bacteria 8594
521 Ga0495653_0012547 3300046463 Bacteria 6920
522 Ga0495653_0036173 3300046463 Bacteria 3891
523 Ga0495653_0099119 3300046463 Bacteria 2115
524 Ga0495580_0015030 3300046472 Bacteria 5858
525 Ga0495582_0000078 3300046473 Bacteria 49080
526 Ga0495582_0000338 3300046473 Bacteria 25659
527 Ga0495582_0001399 3300046473 Bacteria 13590
528 Ga0495582_0002910 3300046473 Bacteria 9572
529 Ga0495639_0003784 3300046475 Bacteria 6499
530 Ga0495639_0030093 3300046475 Bacteria 2412
531 Ga0495662_0008850 3300046476 Bacteria 4944
532 Ga0495662_0012129 3300046476 Bacteria 4210
533 Ga0495594_0017675 3300046499 Bacteria 3770
534 Ga0495594_0032192 3300046499 Bacteria 2845
535 Ga0495608_0000070 3300046511 Bacteria 77533
536 Ga0495608_0007499 3300046511 Bacteria 7702
537 Ga0495608_0043756 3300046511 Bacteria 2991
538 Ga0495608_0044263 3300046511 Bacteria 2971
539 Ga0495608_0065762 3300046511 Bacteria 2374
540 Ga0495618_0034995 3300046514 Bacteria 3151
541 Ga0495618_0073762 3300046514 Bacteria 2173
542 Ga0495618_0091766 3300046514 Bacteria 1942
543 Ga0495628_0000624 3300046516 Bacteria 32362
544 Ga0495628_0003918 3300046516 Bacteria 13261
545 Ga0495628_0013221 3300046516 Bacteria 6941
546 Ga0495628_0021322 3300046516 Bacteria 5332
547 Ga0495628_0027893 3300046516 Bacteria 4590
548 Ga0495628_0052056 3300046516 Bacteria 3235
549 Ga0495628_0094001 3300046516 Bacteria 2318
550 Ga0495628_0112248 3300046516 Bacteria 2095
551 Ga0495630_0018348 3300046517 Bacteria 5139
552 Ga0495630_0027780 3300046517 Bacteria 4201
553 Ga0495652_0000679 3300046529 Bacteria 39396
554 Ga0495652_0000769 3300046529 Bacteria 36908
555 Ga0495652_0009984 3300046529 Bacteria 8603
556 Ga0495652_0013266 3300046529 Bacteria 7418
557 Ga0495652_0016891 3300046529 Bacteria 6522
558 Ga0495652_0051756 3300046529 Bacteria 3505
559 Ga0495652_0090925 3300046529 Bacteria 2496
560 Ga0495665_0001371 3300046531 Bacteria 13031
561 Ga0495665_0006507 3300046531 Bacteria 6308
562 Ga0495665_0011482 3300046531 Bacteria 4795
563 Ga0495665_0021638 3300046531 Bacteria 3457
564 Ga0495640_0013066 3300046533 Bacteria 6324
565 Ga0495640_0023414 3300046533 Bacteria 4499
566 Ga0495640_0034424 3300046533 Bacteria 3591
567 Ga0495640_0047829 3300046533 Bacteria 2958
568 Ga0495587_0000077 3300046536 Bacteria 77532
569 Ga0495587_0004198 3300046536 Bacteria 9537
570 Ga0495587_0014003 3300046536 Bacteria 5036
571 Ga0495587_0056171 3300046536 Bacteria 2316
572 Ga0495587_0068029 3300046536 Bacteria 2075
573 Ga0495621_0000572 3300046539 Bacteria 9176
574 Ga0495645_0064304 3300046543 Bacteria 2655
575 Ga0495645_0078985 3300046543 Bacteria 2364
576 Ga0495645_0084253 3300046543 Bacteria 2276
577 Ga0495667_0000071 3300046559 Bacteria 77538
578 Ga0495667_0002937 3300046559 Bacteria 11443
579 Ga0495667_0005115 3300046559 Bacteria 8860
580 Ga0495667_0006824 3300046559 Bacteria 7750
581 Ga0495667_0013560 3300046559 Bacteria 5513
582 Ga0495667_0030210 3300046559 Bacteria 3643
583 Ga0495667_0036047 3300046559 Bacteria 3304
584 Ga0495667_0048750 3300046559 Bacteria 2796
585 Ga0495634_0011952 3300046642 Bacteria 6298
586 Ga0495634_0019468 3300046642 Bacteria 4823
587 Ga0495634_0031304 3300046642 Bacteria 3665
588 Ga0495634_0031861 3300046642 Bacteria 3629
589 Ga0495634_0074759 3300046642 Bacteria 2226
590 Ga0495635_0009283 3300046663 Bacteria 6871
591 Ga0495635_0012304 3300046663 Bacteria 5995
592 Ga0495635_0017230 3300046663 Bacteria 5046
593 Ga0495635_0018757 3300046663 Bacteria 4827
594 Ga0495635_0023243 3300046663 Bacteria 4321
595 Ga0495588_0004695 3300046674 Bacteria 6035
596 Ga0495588_0022616 3300046674 Bacteria 3108
597 Ga0495657_0000095 3300046675 Bacteria 77538
598 Ga0495657_0003888 3300046675 Bacteria 12027
599 Ga0495657_0005793 3300046675 Bacteria 9734
600 Ga0495657_0008653 3300046675 Bacteria 7765
601 Ga0495599_0000155 3300046678 Bacteria 45015
602 Ga0495599_0007643 3300046678 Bacteria 6565
603 Ga0495599_0086353 3300046678 Bacteria 1959
604 Ga0495599_0104857 3300046678 Bacteria 1761
605 Ga0495623_0001673 3300046679 Bacteria 14902
606 Ga0495623_0015929 3300046679 Bacteria 4860
607 Ga0495623_0019635 3300046679 Bacteria 4368
608 Ga0495646_0009024 3300046680 Bacteria 6324
609 Ga0495646_0032465 3300046680 Bacteria 3249
610 Ga0495647_0014609 3300046681 Bacteria 2738
611 Ga0495647_0015267 3300046681 Bacteria 2688
612 Ga0495658_0000236 3300046683 Bacteria 31770
613 Ga0495658_0000726 3300046683 Bacteria 17778
614 Ga0495658_0008286 3300046683 Bacteria 5149
615 Ga0495613_0000207 3300046689 Bacteria 58099
616 Ga0495613_0004518 3300046689 Bacteria 10433
617 Ga0495613_0018030 3300046689 Bacteria 5261
618 Ga0495613_0091729 3300046689 Bacteria 2200
619 Ga0495624_0002604 3300046690 Bacteria 13611
620 Ga0495624_0020231 3300046690 Bacteria 4433
621 Ga0495624_0025322 3300046690 Bacteria 3896
622 Ga0495600_0001750 3300046809 Bacteria 12137
623 Ga0495600_0013426 3300046809 Bacteria 5147
624 Ga0495600_0017470 3300046809 Bacteria 4564
625 Ga0495600_0023354 3300046809 Bacteria 3978
626 Ga0495600_0025724 3300046809 Bacteria 3793
627 Ga0495600_0037480 3300046809 Bacteria 3152
628 Ga0495600_0044659 3300046809 Bacteria 2890
629 Ga0495581_0001112 3300047315 Bacteria 14690
630 Ga0495581_0001409 3300047315 Bacteria 13320
631 Ga0495581_0011427 3300047315 Bacteria 5139
632 Ga0495581_0037896 3300047315 Bacteria 2790
633 Ga0495604_0000087 3300047317 Bacteria 79147
634 Ga0495604_0001649 3300047317 Bacteria 18351
635 Ga0495604_0046959 3300047317 Bacteria 3365
636 Ga0495604_0052269 3300047317 Bacteria 3165
637 Ga0495674_0010613 3300047319 Bacteria 8716
638 Ga0495674_0040756 3300047319 Bacteria 4151
639 Ga0495674_0060103 3300047319 Bacteria 3317
640 Ga0495674_0074405 3300047319 Bacteria 2925
641 Ga0495674_0077342 3300047319 Bacteria 2861
642 Ga0495676_0011573 3300047321 Bacteria 7959
643 Ga0495676_0020754 3300047321 Bacteria 5756
644 Ga0495676_0083124 3300047321 Bacteria 2421
645 Ga0495680_0002287 3300047322 Bacteria 19719
646 Ga0495680_0003033 3300047322 Bacteria 16753
647 Ga0495680_0006516 3300047322 Bacteria 10836
648 Ga0495680_0006570 3300047322 Bacteria 10790
649 Ga0495680_0006733 3300047322 Bacteria 10627
650 Ga0495680_0012893 3300047322 Bacteria 7324
651 Ga0495680_0020012 3300047322 Bacteria 5640
652 Ga0495680_0027766 3300047322 Bacteria 4645
653 Ga0495680_0039139 3300047322 Bacteria 3784
654 Ga0495680_0055223 3300047322 Bacteria 3081
655 Ga0495680_0086991 3300047322 Bacteria 2351
656 Ga0495680_0126468 3300047322 Bacteria 1882
657 Ga0495675_0000157 3300047444 Bacteria 48143
658 Ga0495675_0001850 3300047444 Bacteria 12615
659 Ga0495675_0003497 3300047444 Bacteria 9465
660 Ga0495675_0009503 3300047444 Bacteria 6056
661 Ga0495675_0033710 3300047444 Bacteria 3268
662 Ga0495684_0003809 3300047471 Bacteria 11754
663 Ga0495684_0018295 3300047471 Bacteria 5400
664 Ga0495684_0050461 3300047471 Bacteria 3177
665 Ga0495684_0056981 3300047471 Bacteria 2978
666 Ga0495684_0058330 3300047471 Bacteria 2941
667 Ga0495684_0059009 3300047471 Bacteria 2922
668 Ga0495593_0011846 3300047673 Bacteria 5000
669 Ga0495593_0057053 3300047673 Bacteria 2051
670 Ga0495602_0000461 3300048088 Bacteria 37751
671 Ga0495602_0017632 3300048088 Bacteria 7154
672 Ga0496101_0002239 3300048904 Bacteria 11828
673 Ga0496101_0002703 3300048904 Bacteria 10880
674 Ga0496102_0006157 3300048905 Bacteria 10227
675 Ga0496102_0006613 3300048905 Bacteria 9906
676 Ga0496102_0013799 3300048905 Bacteria 7009
677 Ga0496102_0020367 3300048905 Bacteria 5862
678 Ga0496102_0079312 3300048905 Bacteria 3024
679 Ga0496102_0082024 3300048905 Bacteria 2974
680 Ga0496102_0107632 3300048905 Bacteria 2596
681 Ga0496103_0002293 3300048906 Bacteria 12088
682 Ga0496103_0053099 3300048906 Bacteria 2511
683 Ga0496103_0088633 3300048906 Bacteria 1951
684 Ga0496104_0012420 3300048907 Bacteria 7657
685 Ga0496104_0017300 3300048907 Bacteria 6562
686 Ga0496104_0019218 3300048907 Bacteria 6247
687 Ga0496104_0071383 3300048907 Bacteria 3301
688 Ga0496104_0071625 3300048907 Bacteria 3295
689 Ga0496104_0110864 3300048907 Bacteria 2631
690 Ga0496104_0205506 3300048907 Unclassified 1881
691 Ga0496105_0000756 3300048908 Bacteria 21951
692 Ga0496105_0002305 3300048908 Bacteria 13849
693 Ga0496105_0016330 3300048908 Bacteria 5925
694 Ga0496105_0060205 3300048908 Bacteria 3133
695 Ga0496105_0072332 3300048908 Bacteria 2850
696 Ga0496105_0085683 3300048908 Bacteria 2603
697 Ga0496105_0103220 3300048908 Bacteria 2354
698 Ga0496106_0003648 3300048909 Bacteria 11477
699 Ga0496106_0019313 3300048909 Bacteria 5053
700 Ga0496107_0005385 3300048910 Bacteria 8755
701 Ga0496107_0009138 3300048910 Bacteria 6870
702 Ga0496107_0051083 3300048910 Bacteria 2981
703 Ga0496108_0000337 3300048911 Bacteria 39725
704 Ga0496108_0012789 3300048911 Bacteria 6834
705 Ga0496108_0015456 3300048911 Bacteria 6226
706 Ga0496108_0030880 3300048911 Bacteria 4440
707 Ga0496108_0034247 3300048911 Bacteria 4219
708 Ga0496108_0038524 3300048911 Bacteria 3982
709 Ga0496108_0050752 3300048911 Bacteria 3474
710 Ga0496108_0065856 3300048911 Bacteria 3054
711 Ga0496108_0082633 3300048911 Bacteria 2724
712 Ga0496108_0082690 3300048911 Bacteria 2723
713 Ga0496108_0088572 3300048911 Bacteria 2630
714 Ga0496108_0089272 3300048911 Bacteria 2619
715 Ga0496109_0004142 3300048912 Bacteria 12111
716 Ga0496109_0005796 3300048912 Bacteria 10341
717 Ga0496109_0027124 3300048912 Bacteria 5112
718 Ga0496109_0035131 3300048912 Bacteria 4519
719 Ga0496109_0054063 3300048912 Bacteria 3664
720 Ga0496109_0058506 3300048912 Bacteria 3520
721 Ga0496109_0081171 3300048912 Bacteria 2988
722 Ga0496109_0095421 3300048912 Bacteria 2754
723 Ga0496109_0102338 3300048912 Bacteria 2658
724 Ga0496109_0108886 3300048912 Bacteria 2575
725 Ga0496110_0000249 3300048913 Bacteria 34963
726 Ga0496110_0021412 3300048913 Bacteria 5474
727 Ga0496110_0036269 3300048913 Bacteria 4281
728 Ga0496110_0038608 3300048913 Bacteria 4156
729 Ga0496110_0048234 3300048913 Bacteria 3733
730 Ga0496110_0070893 3300048913 Bacteria 3089
731 Ga0496110_0075476 3300048913 Bacteria 2995
732 Ga0496110_0099095 3300048913 Bacteria 2613
733 Ga0496110_0107222 3300048913 Bacteria 2507
734 Ga0496111_0003049 3300048914 Bacteria 10281
735 Ga0496111_0022383 3300048914 Bacteria 4424
736 Ga0496111_0071066 3300048914 Bacteria 2533
737 Ga0496111_0094521 3300048914 Bacteria 2192
738 Ga0496112_0000620 3300048915 Bacteria 24573
739 Ga0496112_0002834 3300048915 Bacteria 14076
740 Ga0496112_0008758 3300048915 Bacteria 9077
741 Ga0496112_0010866 3300048915 Bacteria 8285
742 Ga0496112_0016419 3300048915 Bacteria 6935
743 Ga0496112_0115326 3300048915 Bacteria 2657
744 Ga0496113_0050528 3300048916 Bacteria 3100
745 Ga0496113_0080845 3300048916 Bacteria 2490
746 Ga0496114_0020614 3300048917 Bacteria 5351
747 Ga0496114_0024825 3300048917 Bacteria 4893
748 Ga0496114_0030283 3300048917 Bacteria 4453
749 Ga0496114_0056320 3300048917 Bacteria 3281
750 Ga0496114_0100339 3300048917 Bacteria 2470
751 Ga0496114_0204919 3300048917 Bacteria 1729
752 Ga0496115_0004134 3300048918 Bacteria 10475
753 Ga0496115_0008063 3300048918 Bacteria 7778
754 Ga0496115_0029753 3300048918 Bacteria 4292
755 Ga0496115_0072365 3300048918 Bacteria 2797
756 Ga0496121_0002166 3300048924 Bacteria 30741
757 Ga0496126_0019805 3300048929 Bacteria 6618
758 Ga0496126_0174840 3300048929 Bacteria 1827
759 Ga0501031_0006295 3300049568 Bacteria 7737
760 Ga0501031_0027487 3300049568 Bacteria 3709
761 Ga0501031_0032255 3300049568 Bacteria 3415
762 Ga0501032_0002022 3300049569 Bacteria 15992
763 Ga0501033_0011445 3300049570 Bacteria 6789
764 Ga0501033_0013928 3300049570 Bacteria 6120
765 Ga0501034_0004204 3300049571 Bacteria 16074
766 Ga0501034_0062091 3300049571 Bacteria 3752
767 Ga0501036_0000582 3300049572 Bacteria 26379
768 Ga0501036_0106033 3300049572 Bacteria 2377
769 Ga0501037_0021309 3300049573 Bacteria 4788
770 Ga0501037_0072555 3300049573 Bacteria 2503
771 Ga0501038_0000732 3300049574 Bacteria 29297
772 Ga0501038_0038074 3300049574 Bacteria 4212
773 Ga0501039_0000391 3300049575 Bacteria 31522
774 Ga0501039_0049987 3300049575 Bacteria 3233
775 Ga0501040_0000516 3300049576 Bacteria 23123
776 Ga0501040_0005371 3300049576 Bacteria 8286
777 Ga0501040_0009161 3300049576 Bacteria 6446
778 Ga0501040_0021756 3300049576 Bacteria 4287
779 Ga0501041_0004140 3300049577 Bacteria 8392
780 Ga0501041_0039901 3300049577 Bacteria 2848
781 Ga0501041_0056794 3300049577 Bacteria 2392
782 Ga0501042_0002049 3300049578 Bacteria 12219
783 Ga0501042_0003403 3300049578 Bacteria 9986
784 Ga0501043_0001992 3300049579 Bacteria 17433
785 Ga0501046_0001108 3300049580 Bacteria 26300
786 Ga0501046_0024415 3300049580 Bacteria 4959
787 Ga0501048_0000495 3300049582 Bacteria 27512
788 Ga0501048_0045452 3300049582 Bacteria 3136
789 Ga0501048_0045918 3300049582 Bacteria 3118
790 Ga0501067_0026266 3300049583 Bacteria 3226
791 Ga0501068_0001135 3300049584 Bacteria 14099
792 Ga0501069_0048019 3300049585 Bacteria 2370
793 Ga0501069_0048322 3300049585 Bacteria 2362
794 Ga0501070_0002476 3300049586 Bacteria 16188
795 Ga0501071_0000731 3300049587 Bacteria 17342
796 Ga0501071_0024018 3300049587 Bacteria 4261
797 Ga0501072_0001629 3300049588 Bacteria 16799
798 Ga0501072_0011031 3300049588 Bacteria 6896
799 Ga0501072_0030265 3300049588 Bacteria 4233
800 Ga0501072_0055103 3300049588 Bacteria 3134
801 Ga0501072_0067248 3300049588 Bacteria 2827
802 Ga0501073_0043786 3300049589 Bacteria 3156
803 Ga0501073_0058246 3300049589 Bacteria 2700
804 Ga0501074_0000958 3300049590 Bacteria 18660
805 Ga0501074_0014082 3300049590 Bacteria 5814
806 Ga0501074_0042949 3300049590 Bacteria 3271
807 Ga0501075_0000672 3300049591 Bacteria 21090
808 Ga0501076_0018257 3300049592 Bacteria 5344
809 Ga0501076_0038716 3300049592 Bacteria 3743
810 Ga0501077_0002810 3300049593 Bacteria 10443
811 Ga0501077_0051458 3300049593 Bacteria 2617
812 Ga0501079_0000214 3300049741 Bacteria 34037
813 Ga0501079_0021008 3300049741 Bacteria 4990
814 Ga0501079_0043254 3300049741 Bacteria 3476
815 Ga0501080_0005478 3300049742 Bacteria 11329
816 Ga0501080_0124125 3300049742 Bacteria 2391
817 Ga0501081_0000596 3300049743 Bacteria 20599
818 Ga0501081_0010424 3300049743 Bacteria 6060
819 Ga0501035_0015257 3300049822 Bacteria 7090
820 Ga0501044_0007168 3300049823 Bacteria 12263
821 Ga0501045_0000417 3300049824 Bacteria 25889
822 Ga0501045_0007946 3300049824 Bacteria 7387
823 nmdc:mga05p37_156892_c1 3300050507 Bacteria 2781
824 nmdc:mga05p37_205530_c1 3300050507 Bacteria 2382
825 nmdc:mga05p37_388566_c1 3300050507 Bacteria 1633
826 nmdc:mga05p37_7880_c1 3300050507 Bacteria 12571
827 nmdc:mga05p37_89312_c1 3300050507 Bacteria 3797
828 nmdc:mga0qj67_228307_c1 3300050509 Bacteria 1511
829 nmdc:mga08y16_183109_c1 3300050511 Bacteria 2174
830 nmdc:mga08y16_33820_c1 3300050511 Bacteria 5369
831 nmdc:mga08y16_33936_c1 3300050511 Bacteria 5361
832 nmdc:mga08y16_56814_c1 3300050511 Bacteria 4090
833 nmdc:mga0n895_10525_c1 3300050512 Bacteria 8180
834 nmdc:mga0n895_198239_c1 3300050512 Bacteria 2039
835 nmdc:mga0n895_2126_c1 3300050512 Bacteria 15301
836 nmdc:mga0n895_43378_c1 3300050512 Bacteria 4383
837 nmdc:mga0n895_47645_c1 3300050512 Bacteria 4191
838 nmdc:mga0n895_825_c1 3300050512 Bacteria 22195
839 nmdc:mga0rr50_41015_c1 3300050513 Bacteria 3369
840 nmdc:mga0rr50_7773_c1 3300050513 Bacteria 6644
841 nmdc:mga0rr50_95517_c1 3300050513 Bacteria 2324
842 nmdc:mga08x19_7539_c1 3300050514 Bacteria 6466
843 nmdc:mga08x19_9178_c1 3300050514 Bacteria 5903
844 nmdc:mga0a205_13608_c1 3300050515 Bacteria 7579
845 nmdc:mga0a205_192441_c1 3300050515 Bacteria 1931
846 nmdc:mga0a205_24936_c1 3300050515 Bacteria 5692
847 nmdc:mga0a205_37118_c1 3300050515 Bacteria 4685
848 nmdc:mga0a205_44872_c1 3300050515 Bacteria 4263
849 nmdc:mga0a205_6248_c1 3300050515 Bacteria 10753
850 Ga0495601_0002354 3300053077 Bacteria 10702
851 Ga0495601_0044793 3300053077 Bacteria 2781
852 Ga0495612_0017888 3300053078 Bacteria 2837
853 Ga0495612_0024350 3300053078 Bacteria 2429
854 Ga0495595_0002737 3300053084 Bacteria 6916
855 Ga0495619_0021469 3300053085 Bacteria 4122
856 Ga0495619_0026491 3300053085 Bacteria 3730
857 Ga0495619_0027064 3300053085 Bacteria 3693
858 Ga0495619_0035391 3300053085 Bacteria 3247
859 Ga0500616_0001517 3300053153 Bacteria 21901
860 Ga0500616_0004633 3300053153 Bacteria 9704
861 Ga0501082_0004602 3300060353 Bacteria 12045
862 Ga0501082_0009312 3300060353 Bacteria 8465
863 Ga0501082_0079914 3300060353 Bacteria 2822
864 Ga0530510_0020513 3300061734 Bacteria 4698
865 Ga0530510_0030155 3300061734 Bacteria 3895
866 2644438961 2643221678 Bacteria 9540101
867 2559432459 2558860280 Bacteria 11429938
868 2753271297 2751185782 Bacteria 11227053
869 2786674696 2786546132 Bacteria 10419719
870 2808847489 2808606359 Bacteria 9866990
871 2819691367 2818991462 Bacteria 4320267
872 2819729263 2818991469 Bacteria 4644110
873 2862387072 2862382967 Bacteria 10317375
874 2862510038 2862507626 Bacteria 9425308
875 2863409549 2863404153 Bacteria 9672205
876 2877677624 2877676314 Bacteria 9512378
877 2919475622 2919468124 Bacteria 9133025
878 2954680706 2954673503 Bacteria 9685905
879 2954683447 2954682443 Bacteria 9862841
880 3002999400 3002998708 Bacteria 11715108
881 8008565007 8008558824 Bacteria 10610750
882 8054474548 8054472261 Bacteria 7464355
883 JGI24738J21930_10002594
884 JGI24738J21930_10007244
885 JGI24744J21845_10000361
886 JGI25406J46586_10001317
887 Ga0070658_10149849
888 Ga0070683_100004234
889 Ga0070683_100012321
890 Ga0070683_100039924
891 Ga0070683_100040738
892 Ga0070683_100060608
893 Ga0070683_100129725
894 Ga0070683_100177975
895 Ga0070670_100011377
896 Ga0068869_100000672
897 Ga0068869_100035330
898 Ga0070680_100000135
899 Ga0070680_100005054
900 Ga0070680_100030659
901 Ga0070680_100061964
902 Ga0070680_100080356
903 Ga0070682_100001129
904 Ga0070682_100006989
905 Ga0070682_100021497
906 Ga0068868_100007548
907 Ga0068868_100034361
908 Ga0068868_100105593
909 Ga0068868_100117303
910 Ga0070660_100009909
911 Ga0070689_100004510
912 Ga0070689_100102416
913 Ga0070687_100021220
914 Ga0070661_100101541
915 Ga0070692_10001374
916 Ga0070692_10005242
917 Ga0070671_100005326
918 Ga0070671_100012639
919 Ga0070674_100005664
920 Ga0070673_100024595
921 Ga0070659_100013914
922 Ga0070659_100049618
923 Ga0070659_100049664
924 Ga0070709_10005337
925 Ga0070709_10022372
926 Ga0070714_100000974
927 Ga0070714_100002168
928 Ga0070714_100002616
929 Ga0070714_100007815
930 Ga0070714_100013040
931 Ga0070714_100017478
932 Ga0070714_100046678
933 Ga0070714_100068894
934 Ga0070714_100101202
935 Ga0070713_100003754
936 Ga0070713_100023202
937 Ga0070713_100029057
938 Ga0070713_100041203
939 Ga0070713_100061707
940 Ga0070713_100085957
941 Ga0070710_10007083
942 Ga0070710_10020055
943 Ga0070710_10032808
944 Ga0070701_10005335
945 Ga0070701_10013604
946 Ga0070701_10023749
947 Ga0070711_100007610
948 Ga0070711_100020370
949 Ga0070711_100042360
950 Ga0070711_100071560
951 Ga0070700_100004148
952 Ga0070700_100007174
953 Ga0070700_100012601
954 Ga0070700_100021607
955 Ga0070694_100006385
956 Ga0070663_100029447
957 Ga0070663_100029835
958 Ga0070678_100003700
959 Ga0070662_100017767
960 Ga0070681_10000020
961 Ga0070681_10026083
962 Ga0070681_10032436
963 Ga0070681_10036883
964 Ga0070681_10055574
965 Ga0068867_100019015
966 Ga0068867_100021874
967 Ga0068867_100044464
968 Ga0070685_10002662
969 Ga0070706_100004208
970 Ga0070706_100012140
971 Ga0070707_100012396
972 Ga0070707_100080485
973 Ga0070698_100104833
974 Ga0070699_100002823
975 Ga0070679_100000044
976 Ga0070679_100033742
977 Ga0070679_100037668
978 Ga0070679_100085799
979 Ga0070679_100102225
980 Ga0070679_100167816
981 Ga0070684_100000622
982 Ga0070684_100020042
983 Ga0070684_100022148
984 Ga0070684_100037755
985 Ga0070684_100049238
986 Ga0070684_100055477
987 Ga0070697_100005200
988 Ga0070672_100039743
989 Ga0070672_100072106
990 Ga0070672_100120348
991 Ga0070686_100122995
992 Ga0070693_100010163
993 Ga0070693_100060028
994 Ga0070665_100012542
995 Ga0070665_100042412
996 Ga0070665_100062706
997 Ga0070665_100126293
998 Ga0068855_100002117
999 Ga0068855_100005045
1000 Ga0068855_100181217
1001 Ga0070664_100034953
1002 Ga0070664_100054431
1003 Ga0068857_100005707
1004 Ga0068857_100022308
1005 Ga0068857_100140635
1006 Ga0068854_100002147
1007 Ga0068856_100006035
1008 Ga0068856_100013804
1009 Ga0068856_100076180
1010 Ga0068856_100136322
1011 Ga0070702_100005662
1012 Ga0070702_100009743
1013 Ga0070702_100059838
1014 Ga0070702_100092737
1015 Ga0068852_100005875
1016 Ga0068852_100009233
1017 Ga0068852_100037992
1018 Ga0068852_100084755
1019 Ga0068852_100110271
1020 Ga0068859_100046929
1021 Ga0068859_100082194
1022 Ga0068864_100003975
1023 Ga0068866_10025248
1024 Ga0068861_100002408
1025 Ga0068851_10012207
1026 Ga0068851_10020541
1027 Ga0068870_10003481
1028 Ga0068863_100006471
1029 Ga0068863_100081257
1030 Ga0068858_100068777
1031 Ga0068860_100045967
1032 Ga0081455_10000123
1033 Ga0081455_10001506
1034 Ga0081539_10000919
1035 Ga0070717_10011176
1036 Ga0070717_10013777
1037 Ga0070717_10025313
1038 Ga0070717_10041275
1039 Ga0070717_10047747
1040 Ga0070717_10084741
1041 Ga0075365_10013836
1042 Ga0075368_10006845
1043 Ga0075363_100025841
1044 Ga0070715_10001284
1045 Ga0070716_100004409
1046 Ga0070716_100012672
1047 Ga0070716_100046609
1048 Ga0070716_100074208
1049 Ga0070712_100012909
1050 Ga0070712_100017813
1051 Ga0070712_100031738
1052 Ga0070712_100042643
1053 Ga0070712_100046323
1054 Ga0070712_100055682
1055 Ga0097621_100007462
1056 Ga0097621_100117148
1057 Ga0068871_100009216
1058 Ga0068871_100075614
1059 Ga0075428_100134410
1060 Ga0075428_100167834
1061 Ga0075431_100025422
1062 Ga0075431_100085037
1063 Ga0075431_100097074
1064 Ga0075433_10011613
1065 Ga0075433_10024336
1066 Ga0075433_10025055
1067 Ga0075433_10038978
1068 Ga0075433_10105672
1069 Ga0075434_100012332
1070 Ga0075434_100026109
1071 Ga0075434_100084553
1072 Ga0075434_100119422
1073 Ga0075434_100180303
1074 Ga0075429_100047159
1075 Ga0075429_100082607
1076 Ga0068865_100003709
1077 Ga0068865_100031231
1078 Ga0068865_100066120
1079 Ga0075436_100010143
1080 Ga0075436_100017185
1081 Ga0075436_100049588
1082 Ga0097620_100046929
1083 Ga0097620_100082193
1084 Ga0075435_100000523
1085 Ga0075435_100005298
1086 Ga0075435_100058051
1087 Ga0105251_10016259
1088 Ga0105240_10015709
1089 Ga0105240_10072227
1090 Ga0105240_10094129
1091 Ga0105240_10114985
1092 Ga0111539_10019426
1093 Ga0111539_10148357
1094 Ga0111539_10178312
1095 Ga0111539_10234046
1096 Ga0105245_10005589
1097 Ga0105245_10011825
1098 Ga0105245_10036074
1099 Ga0105245_10125346
1100 Ga0105247_10009645
1101 Ga0105247_10039178
1102 Ga0114129_10015764
1103 Ga0114129_10040454
1104 Ga0114129_10046739
1105 Ga0114129_10055068
1106 Ga0114129_10314640
1107 Ga0105243_10002387
1108 Ga0105243_10009903
1109 Ga0105243_10094380
1110 Ga0105241_10001988
1111 Ga0105241_10005381
1112 Ga0105241_10019360
1113 Ga0105242_10027713
1114 Ga0105248_10067072
1115 Ga0105248_10068314
1116 Ga0105237_10008550
1117 Ga0105237_10021863
1118 Ga0105238_10004485
1119 Ga0105238_10013378
1120 Ga0105238_10015810
1121 Ga0105238_10030996
1122 Ga0105238_10044458
1123 Ga0105249_10008050
1124 Ga0105249_10010209
1125 Ga0105249_10036681
1126 Ga0105249_10046632
1127 Ga0105249_10055325
1128 Ga0105239_10028892
1129 Ga0105239_10032423
1130 Ga0105239_10041232
1131 Ga0105239_10054291
1132 Ga0105239_10081713
1133 Ga0105246_10002583
1134 Ga0105246_10010935
1135 Ga0105246_10017620
1136 Ga0105246_10038000
1137 Ga0105246_10050252
1138 Ga0105246_10050500
1139 Ga0157373_10047373
1140 Ga0157369_10001889
1141 Ga0157369_10011108
1142 Ga0157369_10018141
1143 Ga0157369_10157007
1144 Ga0157369_10250643
1145 Ga0157374_10008821
1146 Ga0157374_10040301
1147 Ga0157374_10094403
1148 Ga0163162_10033665
1149 Ga0163162_10068450
1150 Ga0157372_10017094
1151 Ga0157372_10077393
1152 Ga0157372_10112101
1153 Ga0157372_10129147
1154 Ga0157372_10209447
1155 Ga0157375_10030166
1156 Ga0157375_10042902
1157 Ga0157375_10134302
1158 Ga0163163_10009952
1159 Ga0163163_10061935
1160 Ga0163163_10115834
1161 Ga0157380_10009185
1162 Ga0157380_10038542
1163 Ga0182008_10025926
1164 Ga0157377_10009848
1165 Ga0157377_10010375
1166 Ga0157377_10014394
1167 Ga0157376_10017650
1168 Ga0157376_10022075
1169 Ga0206353_11878011
1170 Ga0224712_10025006
1171 Ga0224572_1002365
1172 Ga0207656_10012516
1173 Ga0207656_10021898
1174 Ga0207692_10006172
1175 Ga0207692_10042480
1176 Ga0207642_10012998
1177 Ga0207710_10006639
1178 Ga0207688_10000213
1179 Ga0207688_10002494
1180 Ga0207688_10044282
1181 Ga0207647_10005252
1182 Ga0207699_10000619
1183 Ga0207699_10001901
1184 Ga0207699_10004489
1185 Ga0207699_10004492
1186 Ga0207645_10044425
1187 Ga0207643_10000218
1188 Ga0207643_10007267
1189 Ga0207643_10007735
1190 Ga0207705_10037063
1191 Ga0207684_10001508
1192 Ga0207684_10005740
1193 Ga0207654_10003770
1194 Ga0207707_10000090
1195 Ga0207707_10007781
1196 Ga0207707_10035007
1197 Ga0207695_10002866
1198 Ga0207671_10003461
1199 Ga0207671_10035151
1200 Ga0207693_10010102
1201 Ga0207693_10027829
1202 Ga0207693_10081784
1203 Ga0207663_10035938
1204 Ga0207663_10122751
1205 Ga0207660_10000219
1206 Ga0207660_10043409
1207 Ga0207660_10059241
1208 Ga0207662_10016436
1209 Ga0207657_10008572
1210 Ga0207657_10010945
1211 Ga0207657_10013651
1212 Ga0207657_10102038
1213 Ga0207649_10007987
1214 Ga0207652_10000485
1215 Ga0207652_10016208
1216 Ga0207646_10012024
1217 Ga0207694_10000843
1218 Ga0207694_10114250
1219 Ga0207650_10009927
1220 Ga0207687_10000842
1221 Ga0207687_10031812
1222 Ga0207700_10004656
1223 Ga0207700_10008259
1224 Ga0207700_10011992
1225 Ga0207700_10024576
1226 Ga0207700_10025233
1227 Ga0207700_10035520
1228 Ga0207700_10048897
1229 Ga0207700_10058256
1230 Ga0207700_10066774
1231 Ga0207700_10072356
1232 Ga0207664_10003669
1233 Ga0207664_10003919
1234 Ga0207664_10004524
1235 Ga0207664_10010352
1236 Ga0207664_10017382
1237 Ga0207664_10025480
1238 Ga0207664_10026630
1239 Ga0207664_10039346
1240 Ga0207644_10008003
1241 Ga0207644_10012375
1242 Ga0207690_10004202
1243 Ga0207690_10090184
1244 Ga0207706_10076573
1245 Ga0207706_10106804
1246 Ga0207709_10008686
1247 Ga0207709_10029106
1248 Ga0207670_10097738
1249 Ga0207669_10105408
1250 Ga0207704_10056512
1251 Ga0207665_10000412
1252 Ga0207665_10004021
1253 Ga0207665_10008637
1254 Ga0207665_10023651
1255 Ga0207691_10013198
1256 Ga0207691_10022500
1257 Ga0207691_10107485
1258 Ga0207689_10002593
1259 Ga0207689_10029825
1260 Ga0207661_10002657
1261 Ga0207661_10006624
1262 Ga0207661_10044306
1263 Ga0207661_10065827
1264 Ga0207661_10088523
1265 Ga0207661_10133799
1266 Ga0207679_10010995
1267 Ga0207679_10060091
1268 Ga0207679_10106384
1269 Ga0207667_10004602
1270 Ga0207667_10015537
1271 Ga0207651_10118895
1272 Ga0207651_10121339
1273 Ga0207668_10017830
1274 Ga0207640_10004012
1275 Ga0207677_10004443
1276 Ga0207677_10029647
1277 Ga0207677_10062601
1278 Ga0207677_10081446
1279 Ga0207703_10123776
1280 Ga0207639_10057038
1281 Ga0207639_10057387
1282 Ga0207678_10011871
1283 Ga0207678_10078529
1284 Ga0207678_10096187
1285 Ga0207708_10000985
1286 Ga0207708_10002530
1287 Ga0207708_10006019
1288 Ga0207708_10032889
1289 Ga0207708_10033380
1290 Ga0207708_10045044
1291 Ga0207708_10071096
1292 Ga0207702_10002437
1293 Ga0207702_10009971
1294 Ga0207702_10114614
1295 Ga0207648_10001308
1296 Ga0207648_10004509
1297 Ga0207648_10017309
1298 Ga0207648_10029778
1299 Ga0207676_10003391
1300 Ga0207676_10016826
1301 Ga0207676_10033378
1302 Ga0207674_10000093
1303 Ga0207674_10014208
1304 Ga0207674_10017738
1305 Ga0207674_10084964
1306 Ga0207674_10107503
1307 Ga0207675_100003463
1308 Ga0207683_10000454
1309 Ga0207683_10009054
1310 Ga0207683_10106699
1311 Ga0207683_10154855
1312 Ga0207698_10004756
1313 Ga0207698_10046821
1314 Ga0207428_10115835
1315 Ga0207428_10133363
1316 Ga0268266_10054809
1317 Ga0268266_10094610
1318 Ga0268265_10108993
1319 Ga0268265_10122970
1320 Ga0268264_10039541
1321 Ga0307513_10019341
1322 Ga0307406_10076400
1323 Ga0307409_100027270
1324 Ga0307416_100005109
1325 Ga0307416_100090392
1326 Ga0307416_100114158
1327 Ga0307411_10016550
1328 Ga0307415_100037871
1329 Ga0373926_0001583
1330 Ga0373934_0001615
1331 Ga0373944_0001827
1332 Ga0373936_0003892
1333 Ga0373945_0000591
1334 Ga0373953_0009920
1335 Ga0373954_0042125
1336 Ga0373956_0001004
1337 Ga0373957_0008506
1338 Ga0373957_0019408
1339 Ga0373943_0001628
1340 Ga0373955_0000005
1341 Ga0373924_0008586
1342 Ga0373927_0016122
1343 Ga0373927_0019496
1344 Ga0373933_0000043
1345 Ga0373933_0022557
1346 Ga0373933_0039045
1347 Ga0373933_0049229
1348 Ga0373933_0081560
1349 Ga0373947_0004411
1350 Ga0373947_0019417
1351 Ga0373937_0000245
1352 Ga0373937_0003783
1353 Ga0373937_0040151
1354 Ga0373937_0063250
1355 Ga0373937_0063513
1356 Ga0373937_0084052
1357 Ga0373937_0096125
1358 Ga0373937_0179693
1359 Ga0373925_0000028
1360 Ga0373925_0001494
1361 Ga0373925_0001915
1362 Ga0373925_0007560
1363 Ga0373925_0109962
1364 Ga0395900_0143787
1365 Ga0395898_0179084
1366 Ga0395905_0059024
1367 Ga0451853_0174584
1368 Ga0451853_2073262
1369 Ga0439448_0007867
1370 Ga0439448_0008553
1371 Ga0439463_002716
1372 Ga0450902_007704
1373 Ga0439458_0008012
1374 Ga0439458_0008711
1375 Ga0439460_0018107
1376 Ga0466963_0001267
1377 Ga0466970_0012932
1378 Ga0466959_0070396
1379 Ga0466967_0004137
1380 Ga0466967_0007021
1381 Ga0466967_0101822
1382 Ga0495592_0000092
1383 Ga0495592_0011277
1384 Ga0495592_0033973
1385 Ga0495592_0097787
1386 Ga0495629_0001088
1387 Ga0495629_0001429
1388 Ga0495629_0014399
1389 Ga0495641_0001952
1390 Ga0495641_0022859
1391 Ga0495651_0000066
1392 Ga0495651_0001498
1393 Ga0495651_0003513
1394 Ga0495651_0010231
1395 Ga0495651_0011712
1396 Ga0495651_0018918
1397 Ga0495651_0019855
1398 Ga0495651_0058460
1399 Ga0495653_0002166
1400 Ga0495653_0003794
1401 Ga0495653_0004422
1402 Ga0495653_0008124
1403 Ga0495653_0012547
1404 Ga0495653_0036173
1405 Ga0495653_0099119
1406 Ga0495580_0015030
1407 Ga0495582_0000078
1408 Ga0495582_0000338
1409 Ga0495582_0001399
1410 Ga0495582_0002910
1411 Ga0495639_0003784
1412 Ga0495639_0030093
1413 Ga0495662_0008850
1414 Ga0495662_0012129
1415 Ga0495594_0017675
1416 Ga0495594_0032192
1417 Ga0495608_0000070
1418 Ga0495608_0007499
1419 Ga0495608_0043756
1420 Ga0495608_0044263
1421 Ga0495608_0065762
1422 Ga0495618_0034995
1423 Ga0495618_0073762
1424 Ga0495618_0091766
1425 Ga0495628_0000624
1426 Ga0495628_0003918
1427 Ga0495628_0013221
1428 Ga0495628_0021322
1429 Ga0495628_0027893
1430 Ga0495628_0052056
1431 Ga0495628_0094001
1432 Ga0495628_0112248
1433 Ga0495630_0018348
1434 Ga0495630_0027780
1435 Ga0495652_0000679
1436 Ga0495652_0000769
1437 Ga0495652_0009984
1438 Ga0495652_0013266
1439 Ga0495652_0016891
1440 Ga0495652_0051756
1441 Ga0495652_0090925
1442 Ga0495665_0001371
1443 Ga0495665_0006507
1444 Ga0495665_0011482
1445 Ga0495665_0021638
1446 Ga0495640_0013066
1447 Ga0495640_0023414
1448 Ga0495640_0034424
1449 Ga0495640_0047829
1450 Ga0495587_0000077
1451 Ga0495587_0004198
1452 Ga0495587_0014003
1453 Ga0495587_0056171
1454 Ga0495587_0068029
1455 Ga0495621_0000572
1456 Ga0495645_0064304
1457 Ga0495645_0078985
1458 Ga0495645_0084253
1459 Ga0495667_0000071
1460 Ga0495667_0002937
1461 Ga0495667_0005115
1462 Ga0495667_0006824
1463 Ga0495667_0013560
1464 Ga0495667_0030210
1465 Ga0495667_0036047
1466 Ga0495667_0048750
1467 Ga0495634_0011952
1468 Ga0495634_0019468
1469 Ga0495634_0031304
1470 Ga0495634_0031861
1471 Ga0495634_0074759
1472 Ga0495635_0009283
1473 Ga0495635_0012304
1474 Ga0495635_0017230
1475 Ga0495635_0018757
1476 Ga0495635_0023243
1477 Ga0495588_0004695
1478 Ga0495588_0022616
1479 Ga0495657_0000095
1480 Ga0495657_0003888
1481 Ga0495657_0005793
1482 Ga0495657_0008653
1483 Ga0495599_0000155
1484 Ga0495599_0007643
1485 Ga0495599_0086353
1486 Ga0495599_0104857
1487 Ga0495623_0001673
1488 Ga0495623_0015929
1489 Ga0495623_0019635
1490 Ga0495646_0009024
1491 Ga0495646_0032465
1492 Ga0495647_0014609
1493 Ga0495647_0015267
1494 Ga0495658_0000236
1495 Ga0495658_0000726
1496 Ga0495658_0008286
1497 Ga0495613_0000207
1498 Ga0495613_0004518
1499 Ga0495613_0018030
1500 Ga0495613_0091729
1501 Ga0495624_0002604
1502 Ga0495624_0020231
1503 Ga0495624_0025322
1504 Ga0495600_0001750
1505 Ga0495600_0013426
1506 Ga0495600_0017470
1507 Ga0495600_0023354
1508 Ga0495600_0025724
1509 Ga0495600_0037480
1510 Ga0495600_0044659
1511 Ga0495581_0001112
1512 Ga0495581_0001409
1513 Ga0495581_0011427
1514 Ga0495581_0037896
1515 Ga0495604_0000087
1516 Ga0495604_0001649
1517 Ga0495604_0046959
1518 Ga0495604_0052269
1519 Ga0495674_0010613
1520 Ga0495674_0040756
1521 Ga0495674_0060103
1522 Ga0495674_0074405
1523 Ga0495674_0077342
1524 Ga0495676_0011573
1525 Ga0495676_0020754
1526 Ga0495676_0083124
1527 Ga0495680_0002287
1528 Ga0495680_0003033
1529 Ga0495680_0006516
1530 Ga0495680_0006570
1531 Ga0495680_0006733
1532 Ga0495680_0012893
1533 Ga0495680_0020012
1534 Ga0495680_0027766
1535 Ga0495680_0039139
1536 Ga0495680_0055223
1537 Ga0495680_0086991
1538 Ga0495680_0126468
1539 Ga0495675_0000157
1540 Ga0495675_0001850
1541 Ga0495675_0003497
1542 Ga0495675_0009503
1543 Ga0495675_0033710
1544 Ga0495684_0003809
1545 Ga0495684_0018295
1546 Ga0495684_0050461
1547 Ga0495684_0056981
1548 Ga0495684_0058330
1549 Ga0495684_0059009
1550 Ga0495593_0011846
1551 Ga0495593_0057053
1552 Ga0495602_0000461
1553 Ga0495602_0017632
1554 Ga0496101_0002239
1555 Ga0496101_0002703
1556 Ga0496102_0006157
1557 Ga0496102_0006613
1558 Ga0496102_0013799
1559 Ga0496102_0020367
1560 Ga0496102_0079312
1561 Ga0496102_0082024
1562 Ga0496102_0107632
1563 Ga0496103_0002293
1564 Ga0496103_0053099
1565 Ga0496103_0088633
1566 Ga0496104_0012420
1567 Ga0496104_0017300
1568 Ga0496104_0019218
1569 Ga0496104_0071383
1570 Ga0496104_0071625
1571 Ga0496104_0110864
1572 Ga0496104_0205506
1573 Ga0496105_0000756
1574 Ga0496105_0002305
1575 Ga0496105_0016330
1576 Ga0496105_0060205
1577 Ga0496105_0072332
1578 Ga0496105_0085683
1579 Ga0496105_0103220
1580 Ga0496106_0003648
1581 Ga0496106_0019313
1582 Ga0496107_0005385
1583 Ga0496107_0009138
1584 Ga0496107_0051083
1585 Ga0496108_0000337
1586 Ga0496108_0012789
1587 Ga0496108_0015456
1588 Ga0496108_0030880
1589 Ga0496108_0034247
1590 Ga0496108_0038524
1591 Ga0496108_0050752
1592 Ga0496108_0065856
1593 Ga0496108_0082633
1594 Ga0496108_0082690
1595 Ga0496108_0088572
1596 Ga0496108_0089272
1597 Ga0496109_0004142
1598 Ga0496109_0005796
1599 Ga0496109_0027124
1600 Ga0496109_0035131
1601 Ga0496109_0054063
1602 Ga0496109_0058506
1603 Ga0496109_0081171
1604 Ga0496109_0095421
1605 Ga0496109_0102338
1606 Ga0496109_0108886
1607 Ga0496110_0000249
1608 Ga0496110_0021412
1609 Ga0496110_0036269
1610 Ga0496110_0038608
1611 Ga0496110_0048234
1612 Ga0496110_0070893
1613 Ga0496110_0075476
1614 Ga0496110_0099095
1615 Ga0496110_0107222
1616 Ga0496111_0003049
1617 Ga0496111_0022383
1618 Ga0496111_0071066
1619 Ga0496111_0094521
1620 Ga0496112_0000620
1621 Ga0496112_0002834
1622 Ga0496112_0008758
1623 Ga0496112_0010866
1624 Ga0496112_0016419
1625 Ga0496112_0115326
1626 Ga0496113_0050528
1627 Ga0496113_0080845
1628 Ga0496114_0020614
1629 Ga0496114_0024825
1630 Ga0496114_0030283
1631 Ga0496114_0056320
1632 Ga0496114_0100339
1633 Ga0496114_0204919
1634 Ga0496115_0004134
1635 Ga0496115_0008063
1636 Ga0496115_0029753
1637 Ga0496115_0072365
1638 Ga0496121_0002166
1639 Ga0496126_0019805
1640 Ga0496126_0174840
1641 Ga0501031_0006295
1642 Ga0501031_0027487
1643 Ga0501031_0032255
1644 Ga0501032_0002022
1645 Ga0501033_0011445
1646 Ga0501033_0013928
1647 Ga0501034_0004204
1648 Ga0501034_0062091
1649 Ga0501036_0000582
1650 Ga0501036_0106033
1651 Ga0501037_0021309
1652 Ga0501037_0072555
1653 Ga0501038_0000732
1654 Ga0501038_0038074
1655 Ga0501039_0000391
1656 Ga0501039_0049987
1657 Ga0501040_0000516
1658 Ga0501040_0005371
1659 Ga0501040_0009161
1660 Ga0501040_0021756
1661 Ga0501041_0004140
1662 Ga0501041_0039901
1663 Ga0501041_0056794
1664 Ga0501042_0002049
1665 Ga0501042_0003403
1666 Ga0501043_0001992
1667 Ga0501046_0001108
1668 Ga0501046_0024415
1669 Ga0501048_0000495
1670 Ga0501048_0045452
1671 Ga0501048_0045918
1672 Ga0501067_0026266
1673 Ga0501068_0001135
1674 Ga0501069_0048019
1675 Ga0501069_0048322
1676 Ga0501070_0002476
1677 Ga0501071_0000731
1678 Ga0501071_0024018
1679 Ga0501072_0001629
1680 Ga0501072_0011031
1681 Ga0501072_0030265
1682 Ga0501072_0055103
1683 Ga0501072_0067248
1684 Ga0501073_0043786
1685 Ga0501073_0058246
1686 Ga0501074_0000958
1687 Ga0501074_0014082
1688 Ga0501074_0042949
1689 Ga0501075_0000672
1690 Ga0501076_0018257
1691 Ga0501076_0038716
1692 Ga0501077_0002810
1693 Ga0501077_0051458
1694 Ga0501079_0000214
1695 Ga0501079_0021008
1696 Ga0501079_0043254
1697 Ga0501080_0005478
1698 Ga0501080_0124125
1699 Ga0501081_0000596
1700 Ga0501081_0010424
1701 Ga0501035_0015257
1702 Ga0501044_0007168
1703 Ga0501045_0000417
1704 Ga0501045_0007946
1705 nmdc:mga05p37_156892_c1
1706 nmdc:mga05p37_205530_c1
1707 nmdc:mga05p37_388566_c1
1708 nmdc:mga05p37_7880_c1
1709 nmdc:mga05p37_89312_c1
1710 nmdc:mga0qj67_228307_c1
1711 nmdc:mga08y16_183109_c1
1712 nmdc:mga08y16_33820_c1
1713 nmdc:mga08y16_33936_c1
1714 nmdc:mga08y16_56814_c1
1715 nmdc:mga0n895_10525_c1
1716 nmdc:mga0n895_198239_c1
1717 nmdc:mga0n895_2126_c1
1718 nmdc:mga0n895_43378_c1
1719 nmdc:mga0n895_47645_c1
1720 nmdc:mga0n895_825_c1
1721 nmdc:mga0rr50_41015_c1
1722 nmdc:mga0rr50_7773_c1
1723 nmdc:mga0rr50_95517_c1
1724 nmdc:mga08x19_7539_c1
1725 nmdc:mga08x19_9178_c1
1726 nmdc:mga0a205_13608_c1
1727 nmdc:mga0a205_192441_c1
1728 nmdc:mga0a205_24936_c1
1729 nmdc:mga0a205_37118_c1
1730 nmdc:mga0a205_44872_c1
1731 nmdc:mga0a205_6248_c1
1732 Ga0495601_0002354
1733 Ga0495601_0044793
1734 Ga0495612_0017888
1735 Ga0495612_0024350
1736 Ga0495595_0002737
1737 Ga0495619_0021469
1738 Ga0495619_0026491
1739 Ga0495619_0027064
1740 Ga0495619_0035391
1741 Ga0500616_0001517
1742 Ga0500616_0004633
1743 Ga0501082_0004602
1744 Ga0501082_0009312
1745 Ga0501082_0079914
1746 Ga0530510_0020513
1747 Ga0530510_0030155
1748 2644438961
1749 2559432459
1750 2753271297
1751 2786674696
1752 2808847489
1753 2819691367
1754 2819729263
1755 2862387072
1756 2862510038
1757 2863409549
1758 2877677624
1759 2919475622
1760 2954680706
1761 2954683447
1762 3002999400
1763 8008565007
1764 8054474548

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

441

550

0.98

PF00916

Sulfate_transp

Sulfate permease family

19

390

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ezb-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9099 395 525
7v73-assembly1.cif.gz_A thermostabilized human prestin in complex with chloride 0.8865 2 531
7lhv-assembly1.cif.gz_B structure of arabidopsis thaliana sulfate transporter atsultr4;1 0.8862 2 526
8opq-assembly1.cif.gz_A structure of human solute carrier 26 family member a6 (slc26a6) anion transporter in an inward-facing state 0.8832 2 530
7s9d-assembly1.cif.gz_B cryo-em structure of dolphin prestin: intermediate state 0.8814 7 531
ID Description Score Start End Superfamily
af_P9WGF7_437_560_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9451 409 528 3.30.750.24
af_Q942E2_508_653_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9224 394 526 3.30.750.24
af_Q94LW6_488_626_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9189 394 528 3.30.750.24
af_I1KA21_504_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9182 394 528 3.30.750.24
af_Q10QI4_508_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9154 393 529 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A2U1BMN8-F1-model_v4 deleted 0.9522 1 532
AF-A0A521THE0-F1-model_v4 Sulfate permease 0.9491 1 529 GO:0008509
GO:0016020
GO:0098661
AF-A0A2V5KGL9-F1-model_v4 Sodium-independent anion transporter 0.9446 2 358 GO:0016020
GO:0055085
AF-A0A495K0Q3-F1-model_v4 High affinity sulfate transporter 1 0.9399 1 531 GO:0008509
GO:0016020
GO:0098661
AF-A0A656TQD3-F1-model_v4 deleted 0.9373 2 345

Map