F484569
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 882 | 326 | 1764 | 555 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221678|2644438961 |
| Length | 604 |
| Sequence | RLRAVPGIRAVSTYRREWLVKDLVAGVVLTTLLVPQGMAYAELAGLPAITGLYTSILCLLGYAVCGPSRVLVLGPDSSLGPMIAATVLPLVVADGDPDRAVALASVLALMVAAVMILASVAKLGFIADLISKPTMIGYMNGLALTILIGQLPKLLGFKVEADNLIGECAGLVRKLADGAAVPAAATVGGCGIVLILVLQRLLPKIPAVLVMVVLAIAATAVFDLGAHGVDLVGELPEGFPPFTVPDVRLADLAPLFGGALGIALVSLADTISNASAFAARSGQEVRGNQEMAGVGAANLAAGLFQGFPVSASGSRTAVAERAGARSQLTGVVGAALIVLMLVLVPGLFRDLPQPALAAVVITASLSLADIPGAVRLWRQRRAEFLLCLAAFVGVALLGVLPGIAVAVALSVLNVFRRAWWPYNTVLGRVQDLEGYHDVRSYPQARQLPGLVIHRFDAPLIFANAKAFRDEIRRLADVDPRPTWIVIAAEPITDVDTTAADVLQELDENLNAQGVHLVFAELKDPVRRKIERYELTRTIDPRHFFPTVEAAVDAFRLRTGAEWAPRRPPPDIAPPPADTAPPPLDIASPPPADDGHHDGAEDRTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 177 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 198 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 199 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 200 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 201 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 310 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 311 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 312 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 313 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 314 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 315 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 316 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 317 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 318 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 319 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 320 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 321 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 322 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 323 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 324 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 325 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 326 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.85 |
| Metatranscriptomes | 0.23 |
| Isolates | 1.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.57 |
| Nodule | 0.23 |
| Rhizoplane | 9.52 |
| Rhizosphere | 88.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10002594 | 3300002075 | Bacteria | 4675 |
| 2 | JGI24738J21930_10007244 | 3300002075 | Bacteria | 2570 |
| 3 | JGI24744J21845_10000361 | 3300002077 | Bacteria | 7757 |
| 4 | JGI25406J46586_10001317 | 3300003203 | Bacteria | 11674 |
| 5 | Ga0070658_10149849 | 3300005327 | Bacteria | 1952 |
| 6 | Ga0070683_100004234 | 3300005329 | Bacteria | 11763 |
| 7 | Ga0070683_100012321 | 3300005329 | Bacteria | 7428 |
| 8 | Ga0070683_100039924 | 3300005329 | Bacteria | 4312 |
| 9 | Ga0070683_100040738 | 3300005329 | Bacteria | 4271 |
| 10 | Ga0070683_100060608 | 3300005329 | Bacteria | 3517 |
| 11 | Ga0070683_100129725 | 3300005329 | Bacteria | 2385 |
| 12 | Ga0070683_100177975 | 3300005329 | Bacteria | 2019 |
| 13 | Ga0070670_100011377 | 3300005331 | Bacteria | 7608 |
| 14 | Ga0068869_100000672 | 3300005334 | Bacteria | 19319 |
| 15 | Ga0068869_100035330 | 3300005334 | Bacteria | 3541 |
| 16 | Ga0070680_100000135 | 3300005336 | Bacteria | 44656 |
| 17 | Ga0070680_100005054 | 3300005336 | Bacteria | 9949 |
| 18 | Ga0070680_100030659 | 3300005336 | Bacteria | 4321 |
| 19 | Ga0070680_100061964 | 3300005336 | Bacteria | 3062 |
| 20 | Ga0070680_100080356 | 3300005336 | Unclassified | 2688 |
| 21 | Ga0070682_100001129 | 3300005337 | Bacteria | 15254 |
| 22 | Ga0070682_100006989 | 3300005337 | Bacteria | 6347 |
| 23 | Ga0070682_100021497 | 3300005337 | Bacteria | 3808 |
| 24 | Ga0068868_100007548 | 3300005338 | Bacteria | 7747 |
| 25 | Ga0068868_100034361 | 3300005338 | Bacteria | 3914 |
| 26 | Ga0068868_100105593 | 3300005338 | Bacteria | 2284 |
| 27 | Ga0068868_100117303 | 3300005338 | Bacteria | 2168 |
| 28 | Ga0070660_100009909 | 3300005339 | Bacteria | 6721 |
| 29 | Ga0070689_100004510 | 3300005340 | Bacteria | 9430 |
| 30 | Ga0070689_100102416 | 3300005340 | Bacteria | 2268 |
| 31 | Ga0070687_100021220 | 3300005343 | Bacteria | 3049 |
| 32 | Ga0070661_100101541 | 3300005344 | Bacteria | 2140 |
| 33 | Ga0070692_10001374 | 3300005345 | Bacteria | 8788 |
| 34 | Ga0070692_10005242 | 3300005345 | Bacteria | 5500 |
| 35 | Ga0070671_100005326 | 3300005355 | Bacteria | 10264 |
| 36 | Ga0070671_100012639 | 3300005355 | Bacteria | 6803 |
| 37 | Ga0070674_100005664 | 3300005356 | Bacteria | 7238 |
| 38 | Ga0070673_100024595 | 3300005364 | Bacteria | 4420 |
| 39 | Ga0070659_100013914 | 3300005366 | Bacteria | 6004 |
| 40 | Ga0070659_100049618 | 3300005366 | Bacteria | 3301 |
| 41 | Ga0070659_100049664 | 3300005366 | Bacteria | 3299 |
| 42 | Ga0070709_10005337 | 3300005434 | Bacteria | 6960 |
| 43 | Ga0070709_10022372 | 3300005434 | Bacteria | 3696 |
| 44 | Ga0070714_100000974 | 3300005435 | Bacteria | 20448 |
| 45 | Ga0070714_100002168 | 3300005435 | Bacteria | 14424 |
| 46 | Ga0070714_100002616 | 3300005435 | Bacteria | 13269 |
| 47 | Ga0070714_100007815 | 3300005435 | Bacteria | 8332 |
| 48 | Ga0070714_100013040 | 3300005435 | Bacteria | 6650 |
| 49 | Ga0070714_100017478 | 3300005435 | Bacteria | 5809 |
| 50 | Ga0070714_100046678 | 3300005435 | Unclassified | 3676 |
| 51 | Ga0070714_100068894 | 3300005435 | Bacteria | 3054 |
| 52 | Ga0070714_100101202 | 3300005435 | Bacteria | 2539 |
| 53 | Ga0070713_100003754 | 3300005436 | Bacteria | 10050 |
| 54 | Ga0070713_100023202 | 3300005436 | Bacteria | 4811 |
| 55 | Ga0070713_100029057 | 3300005436 | Bacteria | 4372 |
| 56 | Ga0070713_100041203 | 3300005436 | Bacteria | 3761 |
| 57 | Ga0070713_100061707 | 3300005436 | Bacteria | 3137 |
| 58 | Ga0070713_100085957 | 3300005436 | Bacteria | 2695 |
| 59 | Ga0070710_10007083 | 3300005437 | Bacteria | 5414 |
| 60 | Ga0070710_10020055 | 3300005437 | Bacteria | 3464 |
| 61 | Ga0070710_10032808 | 3300005437 | Bacteria | 2815 |
| 62 | Ga0070701_10005335 | 3300005438 | Bacteria | 5296 |
| 63 | Ga0070701_10013604 | 3300005438 | Bacteria | 3707 |
| 64 | Ga0070701_10023749 | 3300005438 | Bacteria | 2958 |
| 65 | Ga0070711_100007610 | 3300005439 | Bacteria | 6594 |
| 66 | Ga0070711_100020370 | 3300005439 | Bacteria | 4274 |
| 67 | Ga0070711_100042360 | 3300005439 | Bacteria | 3077 |
| 68 | Ga0070711_100071560 | 3300005439 | Bacteria | 2444 |
| 69 | Ga0070700_100004148 | 3300005441 | Bacteria | 7557 |
| 70 | Ga0070700_100007174 | 3300005441 | Bacteria | 6002 |
| 71 | Ga0070700_100012601 | 3300005441 | Bacteria | 4725 |
| 72 | Ga0070700_100021607 | 3300005441 | Bacteria | 3742 |
| 73 | Ga0070694_100006385 | 3300005444 | Bacteria | 7152 |
| 74 | Ga0070663_100029447 | 3300005455 | Bacteria | 3753 |
| 75 | Ga0070663_100029835 | 3300005455 | Bacteria | 3731 |
| 76 | Ga0070678_100003700 | 3300005456 | Bacteria | 8557 |
| 77 | Ga0070662_100017767 | 3300005457 | Bacteria | 4799 |
| 78 | Ga0070681_10000020 | 3300005458 | Bacteria | 123918 |
| 79 | Ga0070681_10026083 | 3300005458 | Bacteria | 5876 |
| 80 | Ga0070681_10032436 | 3300005458 | Bacteria | 5242 |
| 81 | Ga0070681_10036883 | 3300005458 | Bacteria | 4907 |
| 82 | Ga0070681_10055574 | 3300005458 | Bacteria | 3941 |
| 83 | Ga0068867_100019015 | 3300005459 | Bacteria | 4891 |
| 84 | Ga0068867_100021874 | 3300005459 | Bacteria | 4566 |
| 85 | Ga0068867_100044464 | 3300005459 | Bacteria | 3254 |
| 86 | Ga0070685_10002662 | 3300005466 | Bacteria | 9150 |
| 87 | Ga0070706_100004208 | 3300005467 | Bacteria | 13977 |
| 88 | Ga0070706_100012140 | 3300005467 | Bacteria | 7990 |
| 89 | Ga0070707_100012396 | 3300005468 | Bacteria | 7960 |
| 90 | Ga0070707_100080485 | 3300005468 | Unclassified | 3144 |
| 91 | Ga0070698_100104833 | 3300005471 | Bacteria | 2797 |
| 92 | Ga0070699_100002823 | 3300005518 | Bacteria | 15504 |
| 93 | Ga0070679_100000044 | 3300005530 | Bacteria | 94029 |
| 94 | Ga0070679_100033742 | 3300005530 | Bacteria | 5068 |
| 95 | Ga0070679_100037668 | 3300005530 | Bacteria | 4805 |
| 96 | Ga0070679_100085799 | 3300005530 | Bacteria | 3135 |
| 97 | Ga0070679_100102225 | 3300005530 | Bacteria | 2852 |
| 98 | Ga0070679_100167816 | 3300005530 | Bacteria | 2168 |
| 99 | Ga0070684_100000622 | 3300005535 | Bacteria | 24475 |
| 100 | Ga0070684_100020042 | 3300005535 | Bacteria | 5544 |
| 101 | Ga0070684_100022148 | 3300005535 | Bacteria | 5296 |
| 102 | Ga0070684_100037755 | 3300005535 | Bacteria | 4146 |
| 103 | Ga0070684_100049238 | 3300005535 | Bacteria | 3657 |
| 104 | Ga0070684_100055477 | 3300005535 | Bacteria | 3454 |
| 105 | Ga0070697_100005200 | 3300005536 | Bacteria | 9996 |
| 106 | Ga0070672_100039743 | 3300005543 | Bacteria | 3605 |
| 107 | Ga0070672_100072106 | 3300005543 | Bacteria | 2750 |
| 108 | Ga0070672_100120348 | 3300005543 | Bacteria | 2148 |
| 109 | Ga0070686_100122995 | 3300005544 | Bacteria | 1784 |
| 110 | Ga0070693_100010163 | 3300005547 | Bacteria | 4704 |
| 111 | Ga0070693_100060028 | 3300005547 | Bacteria | 2206 |
| 112 | Ga0070665_100012542 | 3300005548 | Bacteria | 8537 |
| 113 | Ga0070665_100042412 | 3300005548 | Bacteria | 4573 |
| 114 | Ga0070665_100062706 | 3300005548 | Bacteria | 3727 |
| 115 | Ga0070665_100126293 | 3300005548 | Bacteria | 2560 |
| 116 | Ga0068855_100002117 | 3300005563 | Bacteria | 24552 |
| 117 | Ga0068855_100005045 | 3300005563 | Bacteria | 16111 |
| 118 | Ga0068855_100181217 | 3300005563 | Bacteria | 2381 |
| 119 | Ga0070664_100034953 | 3300005564 | Bacteria | 4217 |
| 120 | Ga0070664_100054431 | 3300005564 | Bacteria | 3394 |
| 121 | Ga0068857_100005707 | 3300005577 | Bacteria | 10644 |
| 122 | Ga0068857_100022308 | 3300005577 | Bacteria | 5570 |
| 123 | Ga0068857_100140635 | 3300005577 | Bacteria | 2181 |
| 124 | Ga0068854_100002147 | 3300005578 | Bacteria | 12110 |
| 125 | Ga0068856_100006035 | 3300005614 | Bacteria | 11916 |
| 126 | Ga0068856_100013804 | 3300005614 | Bacteria | 7809 |
| 127 | Ga0068856_100076180 | 3300005614 | Bacteria | 3323 |
| 128 | Ga0068856_100136322 | 3300005614 | Bacteria | 2460 |
| 129 | Ga0070702_100005662 | 3300005615 | Bacteria | 5848 |
| 130 | Ga0070702_100009743 | 3300005615 | Bacteria | 4711 |
| 131 | Ga0070702_100059838 | 3300005615 | Bacteria | 2212 |
| 132 | Ga0070702_100092737 | 3300005615 | Bacteria | 1835 |
| 133 | Ga0068852_100005875 | 3300005616 | Bacteria | 8820 |
| 134 | Ga0068852_100009233 | 3300005616 | Bacteria | 7306 |
| 135 | Ga0068852_100037992 | 3300005616 | Bacteria | 4043 |
| 136 | Ga0068852_100084755 | 3300005616 | Bacteria | 2821 |
| 137 | Ga0068852_100110271 | 3300005616 | Bacteria | 2500 |
| 138 | Ga0068859_100046929 | 3300005617 | Bacteria | 4338 |
| 139 | Ga0068859_100082194 | 3300005617 | Bacteria | 3264 |
| 140 | Ga0068864_100003975 | 3300005618 | Bacteria | 12171 |
| 141 | Ga0068866_10025248 | 3300005718 | Bacteria | 2791 |
| 142 | Ga0068861_100002408 | 3300005719 | Bacteria | 12180 |
| 143 | Ga0068851_10012207 | 3300005834 | Bacteria | 4045 |
| 144 | Ga0068851_10020541 | 3300005834 | Bacteria | 3199 |
| 145 | Ga0068870_10003481 | 3300005840 | Bacteria | 6675 |
| 146 | Ga0068863_100006471 | 3300005841 | Bacteria | 11485 |
| 147 | Ga0068863_100081257 | 3300005841 | Bacteria | 3070 |
| 148 | Ga0068858_100068777 | 3300005842 | Bacteria | 3282 |
| 149 | Ga0068860_100045967 | 3300005843 | Bacteria | 4164 |
| 150 | Ga0081455_10000123 | 3300005937 | Bacteria | 89254 |
| 151 | Ga0081455_10001506 | 3300005937 | Bacteria | 28768 |
| 152 | Ga0081539_10000919 | 3300005985 | Bacteria | 55491 |
| 153 | Ga0070717_10011176 | 3300006028 | Bacteria | 6805 |
| 154 | Ga0070717_10013777 | 3300006028 | Bacteria | 6205 |
| 155 | Ga0070717_10025313 | 3300006028 | Bacteria | 4718 |
| 156 | Ga0070717_10041275 | 3300006028 | Bacteria | 3762 |
| 157 | Ga0070717_10047747 | 3300006028 | Bacteria | 3509 |
| 158 | Ga0070717_10084741 | 3300006028 | Bacteria | 2666 |
| 159 | Ga0075365_10013836 | 3300006038 | Bacteria | 4840 |
| 160 | Ga0075368_10006845 | 3300006042 | Bacteria | 4005 |
| 161 | Ga0075363_100025841 | 3300006048 | Bacteria | 2999 |
| 162 | Ga0070715_10001284 | 3300006163 | Bacteria | 7195 |
| 163 | Ga0070716_100004409 | 3300006173 | Bacteria | 6728 |
| 164 | Ga0070716_100012672 | 3300006173 | Bacteria | 4279 |
| 165 | Ga0070716_100046609 | 3300006173 | Bacteria | 2440 |
| 166 | Ga0070716_100074208 | 3300006173 | Bacteria | 2009 |
| 167 | Ga0070712_100012909 | 3300006175 | Bacteria | 5322 |
| 168 | Ga0070712_100017813 | 3300006175 | Bacteria | 4601 |
| 169 | Ga0070712_100031738 | 3300006175 | Bacteria | 3561 |
| 170 | Ga0070712_100042643 | 3300006175 | Bacteria | 3121 |
| 171 | Ga0070712_100046323 | 3300006175 | Bacteria | 3006 |
| 172 | Ga0070712_100055682 | 3300006175 | Bacteria | 2770 |
| 173 | Ga0097621_100007462 | 3300006237 | Bacteria | 7822 |
| 174 | Ga0097621_100117148 | 3300006237 | Bacteria | 2256 |
| 175 | Ga0068871_100009216 | 3300006358 | Bacteria | 7139 |
| 176 | Ga0068871_100075614 | 3300006358 | Bacteria | 2781 |
| 177 | Ga0075428_100134410 | 3300006844 | Bacteria | 2689 |
| 178 | Ga0075428_100167834 | 3300006844 | Bacteria | 2380 |
| 179 | Ga0075431_100025422 | 3300006847 | Bacteria | 6069 |
| 180 | Ga0075431_100085037 | 3300006847 | Bacteria | 3265 |
| 181 | Ga0075431_100097074 | 3300006847 | Bacteria | 3042 |
| 182 | Ga0075433_10011613 | 3300006852 | Bacteria | 7095 |
| 183 | Ga0075433_10024336 | 3300006852 | Bacteria | 5108 |
| 184 | Ga0075433_10025055 | 3300006852 | Bacteria | 5042 |
| 185 | Ga0075433_10038978 | 3300006852 | Bacteria | 4106 |
| 186 | Ga0075433_10105672 | 3300006852 | Bacteria | 2495 |
| 187 | Ga0075434_100012332 | 3300006871 | Bacteria | 8098 |
| 188 | Ga0075434_100026109 | 3300006871 | Bacteria | 5721 |
| 189 | Ga0075434_100084553 | 3300006871 | Bacteria | 3172 |
| 190 | Ga0075434_100119422 | 3300006871 | Bacteria | 2650 |
| 191 | Ga0075434_100180303 | 3300006871 | Bacteria | 2132 |
| 192 | Ga0075429_100047159 | 3300006880 | Bacteria | 3749 |
| 193 | Ga0075429_100082607 | 3300006880 | Bacteria | 2800 |
| 194 | Ga0068865_100003709 | 3300006881 | Bacteria | 9176 |
| 195 | Ga0068865_100031231 | 3300006881 | Bacteria | 3551 |
| 196 | Ga0068865_100066120 | 3300006881 | Bacteria | 2550 |
| 197 | Ga0075436_100010143 | 3300006914 | Bacteria | 6450 |
| 198 | Ga0075436_100017185 | 3300006914 | Bacteria | 4951 |
| 199 | Ga0075436_100049588 | 3300006914 | Bacteria | 2897 |
| 200 | Ga0097620_100046929 | 3300006931 | Bacteria | 4338 |
| 201 | Ga0097620_100082193 | 3300006931 | Bacteria | 3264 |
| 202 | Ga0075435_100000523 | 3300007076 | Bacteria | 23542 |
| 203 | Ga0075435_100005298 | 3300007076 | Bacteria | 8981 |
| 204 | Ga0075435_100058051 | 3300007076 | Bacteria | 3133 |
| 205 | Ga0105251_10016259 | 3300009011 | Bacteria | 4028 |
| 206 | Ga0105240_10015709 | 3300009093 | Bacteria | 10273 |
| 207 | Ga0105240_10072227 | 3300009093 | Bacteria | 4265 |
| 208 | Ga0105240_10094129 | 3300009093 | Bacteria | 3655 |
| 209 | Ga0105240_10114985 | 3300009093 | Bacteria | 3249 |
| 210 | Ga0111539_10019426 | 3300009094 | Bacteria | 8387 |
| 211 | Ga0111539_10148357 | 3300009094 | Bacteria | 2746 |
| 212 | Ga0111539_10178312 | 3300009094 | Bacteria | 2482 |
| 213 | Ga0111539_10234046 | 3300009094 | Bacteria | 2139 |
| 214 | Ga0105245_10005589 | 3300009098 | Bacteria | 11043 |
| 215 | Ga0105245_10011825 | 3300009098 | Bacteria | 7592 |
| 216 | Ga0105245_10036074 | 3300009098 | Bacteria | 4390 |
| 217 | Ga0105245_10125346 | 3300009098 | Bacteria | 2404 |
| 218 | Ga0105247_10009645 | 3300009101 | Bacteria | 5857 |
| 219 | Ga0105247_10039178 | 3300009101 | Bacteria | 2895 |
| 220 | Ga0114129_10015764 | 3300009147 | Bacteria | 10745 |
| 221 | Ga0114129_10040454 | 3300009147 | Bacteria | 6571 |
| 222 | Ga0114129_10046739 | 3300009147 | Bacteria | 6083 |
| 223 | Ga0114129_10055068 | 3300009147 | Bacteria | 5575 |
| 224 | Ga0114129_10314640 | 3300009147 | Bacteria | 2083 |
| 225 | Ga0105243_10002387 | 3300009148 | Bacteria | 15737 |
| 226 | Ga0105243_10009903 | 3300009148 | Bacteria | 7248 |
| 227 | Ga0105243_10094380 | 3300009148 | Bacteria | 2470 |
| 228 | Ga0105241_10001988 | 3300009174 | Bacteria | 15474 |
| 229 | Ga0105241_10005381 | 3300009174 | Bacteria | 9465 |
| 230 | Ga0105241_10019360 | 3300009174 | Bacteria | 5019 |
| 231 | Ga0105242_10027713 | 3300009176 | Bacteria | 4503 |
| 232 | Ga0105248_10067072 | 3300009177 | Bacteria | 4029 |
| 233 | Ga0105248_10068314 | 3300009177 | Bacteria | 3990 |
| 234 | Ga0105237_10008550 | 3300009545 | Bacteria | 11066 |
| 235 | Ga0105237_10021863 | 3300009545 | Bacteria | 6570 |
| 236 | Ga0105238_10004485 | 3300009551 | Bacteria | 13832 |
| 237 | Ga0105238_10013378 | 3300009551 | Bacteria | 8281 |
| 238 | Ga0105238_10015810 | 3300009551 | Bacteria | 7638 |
| 239 | Ga0105238_10030996 | 3300009551 | Bacteria | 5443 |
| 240 | Ga0105238_10044458 | 3300009551 | Bacteria | 4489 |
| 241 | Ga0105249_10008050 | 3300009553 | Bacteria | 9190 |
| 242 | Ga0105249_10010209 | 3300009553 | Bacteria | 8248 |
| 243 | Ga0105249_10036681 | 3300009553 | Bacteria | 4448 |
| 244 | Ga0105249_10046632 | 3300009553 | Bacteria | 3945 |
| 245 | Ga0105249_10055325 | 3300009553 | Bacteria | 3629 |
| 246 | Ga0105239_10028892 | 3300010375 | Bacteria | 6095 |
| 247 | Ga0105239_10032423 | 3300010375 | Bacteria | 5741 |
| 248 | Ga0105239_10041232 | 3300010375 | Bacteria | 5059 |
| 249 | Ga0105239_10054291 | 3300010375 | Bacteria | 4394 |
| 250 | Ga0105239_10081713 | 3300010375 | Bacteria | 3557 |
| 251 | Ga0105246_10002583 | 3300011119 | Bacteria | 10949 |
| 252 | Ga0105246_10010935 | 3300011119 | Bacteria | 5626 |
| 253 | Ga0105246_10017620 | 3300011119 | Bacteria | 4543 |
| 254 | Ga0105246_10038000 | 3300011119 | Bacteria | 3233 |
| 255 | Ga0105246_10050252 | 3300011119 | Bacteria | 2859 |
| 256 | Ga0105246_10050500 | 3300011119 | Bacteria | 2853 |
| 257 | Ga0157373_10047373 | 3300013100 | Bacteria | 3066 |
| 258 | Ga0157369_10001889 | 3300013105 | Bacteria | 25266 |
| 259 | Ga0157369_10011108 | 3300013105 | Bacteria | 10244 |
| 260 | Ga0157369_10018141 | 3300013105 | Bacteria | 7893 |
| 261 | Ga0157369_10157007 | 3300013105 | Bacteria | 2402 |
| 262 | Ga0157369_10250643 | 3300013105 | Bacteria | 1848 |
| 263 | Ga0157374_10008821 | 3300013296 | Bacteria | 8631 |
| 264 | Ga0157374_10040301 | 3300013296 | Bacteria | 4301 |
| 265 | Ga0157374_10094403 | 3300013296 | Bacteria | 2858 |
| 266 | Ga0163162_10033665 | 3300013306 | Bacteria | 5092 |
| 267 | Ga0163162_10068450 | 3300013306 | Bacteria | 3602 |
| 268 | Ga0157372_10017094 | 3300013307 | Bacteria | 7786 |
| 269 | Ga0157372_10077393 | 3300013307 | Bacteria | 3757 |
| 270 | Ga0157372_10112101 | 3300013307 | Bacteria | 3125 |
| 271 | Ga0157372_10129147 | 3300013307 | Bacteria | 2907 |
| 272 | Ga0157372_10209447 | 3300013307 | Bacteria | 2259 |
| 273 | Ga0157375_10030166 | 3300013308 | Bacteria | 5110 |
| 274 | Ga0157375_10042902 | 3300013308 | Bacteria | 4382 |
| 275 | Ga0157375_10134302 | 3300013308 | Bacteria | 2596 |
| 276 | Ga0163163_10009952 | 3300014325 | Bacteria | 8526 |
| 277 | Ga0163163_10061935 | 3300014325 | Bacteria | 3707 |
| 278 | Ga0163163_10115834 | 3300014325 | Bacteria | 2711 |
| 279 | Ga0157380_10009185 | 3300014326 | Bacteria | 7072 |
| 280 | Ga0157380_10038542 | 3300014326 | Bacteria | 3712 |
| 281 | Ga0182008_10025926 | 3300014497 | Bacteria | 2974 |
| 282 | Ga0157377_10009848 | 3300014745 | Bacteria | 4708 |
| 283 | Ga0157377_10010375 | 3300014745 | Bacteria | 4606 |
| 284 | Ga0157377_10014394 | 3300014745 | Bacteria | 4025 |
| 285 | Ga0157376_10017650 | 3300014969 | Bacteria | 5450 |
| 286 | Ga0157376_10022075 | 3300014969 | Bacteria | 4954 |
| 287 | Ga0206353_11878011 | 3300020082 | Bacteria | 5824 |
| 288 | Ga0224712_10025006 | 3300022467 | Bacteria | 2094 |
| 289 | Ga0224572_1002365 | 3300024225 | Bacteria | 3028 |
| 290 | Ga0207656_10012516 | 3300025321 | Bacteria | 3227 |
| 291 | Ga0207656_10021898 | 3300025321 | Bacteria | 2559 |
| 292 | Ga0207692_10006172 | 3300025898 | Bacteria | 4853 |
| 293 | Ga0207692_10042480 | 3300025898 | Bacteria | 2257 |
| 294 | Ga0207642_10012998 | 3300025899 | Bacteria | 3023 |
| 295 | Ga0207710_10006639 | 3300025900 | Bacteria | 4931 |
| 296 | Ga0207688_10000213 | 3300025901 | Bacteria | 25981 |
| 297 | Ga0207688_10002494 | 3300025901 | Bacteria | 9907 |
| 298 | Ga0207688_10044282 | 3300025901 | Bacteria | 2480 |
| 299 | Ga0207647_10005252 | 3300025904 | Bacteria | 9533 |
| 300 | Ga0207699_10000619 | 3300025906 | Bacteria | 17260 |
| 301 | Ga0207699_10001901 | 3300025906 | Bacteria | 9839 |
| 302 | Ga0207699_10004489 | 3300025906 | Bacteria | 6669 |
| 303 | Ga0207699_10004492 | 3300025906 | Bacteria | 6666 |
| 304 | Ga0207645_10044425 | 3300025907 | Bacteria | 2843 |
| 305 | Ga0207643_10000218 | 3300025908 | Bacteria | 40287 |
| 306 | Ga0207643_10007267 | 3300025908 | Bacteria | 5942 |
| 307 | Ga0207643_10007735 | 3300025908 | Bacteria | 5773 |
| 308 | Ga0207705_10037063 | 3300025909 | Bacteria | 3489 |
| 309 | Ga0207684_10001508 | 3300025910 | Bacteria | 24953 |
| 310 | Ga0207684_10005740 | 3300025910 | Bacteria | 11395 |
| 311 | Ga0207654_10003770 | 3300025911 | Bacteria | 7638 |
| 312 | Ga0207707_10000090 | 3300025912 | Bacteria | 90918 |
| 313 | Ga0207707_10007781 | 3300025912 | Bacteria | 9328 |
| 314 | Ga0207707_10035007 | 3300025912 | Bacteria | 4391 |
| 315 | Ga0207695_10002866 | 3300025913 | Bacteria | 25047 |
| 316 | Ga0207671_10003461 | 3300025914 | Bacteria | 15716 |
| 317 | Ga0207671_10035151 | 3300025914 | Bacteria | 3720 |
| 318 | Ga0207693_10010102 | 3300025915 | Bacteria | 7668 |
| 319 | Ga0207693_10027829 | 3300025915 | Bacteria | 4468 |
| 320 | Ga0207693_10081784 | 3300025915 | Bacteria | 2529 |
| 321 | Ga0207663_10035938 | 3300025916 | Bacteria | 2976 |
| 322 | Ga0207663_10122751 | 3300025916 | Bacteria | 1782 |
| 323 | Ga0207660_10000219 | 3300025917 | Bacteria | 36887 |
| 324 | Ga0207660_10043409 | 3300025917 | Bacteria | 3160 |
| 325 | Ga0207660_10059241 | 3300025917 | Bacteria | 2748 |
| 326 | Ga0207662_10016436 | 3300025918 | Bacteria | 4176 |
| 327 | Ga0207657_10008572 | 3300025919 | Bacteria | 10359 |
| 328 | Ga0207657_10010945 | 3300025919 | Bacteria | 9024 |
| 329 | Ga0207657_10013651 | 3300025919 | Bacteria | 7961 |
| 330 | Ga0207657_10102038 | 3300025919 | Bacteria | 2380 |
| 331 | Ga0207649_10007987 | 3300025920 | Bacteria | 5756 |
| 332 | Ga0207652_10000485 | 3300025921 | Bacteria | 40829 |
| 333 | Ga0207652_10016208 | 3300025921 | Bacteria | 6080 |
| 334 | Ga0207646_10012024 | 3300025922 | Bacteria | 8341 |
| 335 | Ga0207694_10000843 | 3300025924 | Bacteria | 27292 |
| 336 | Ga0207694_10114250 | 3300025924 | Bacteria | 2150 |
| 337 | Ga0207650_10009927 | 3300025925 | Bacteria | 6513 |
| 338 | Ga0207687_10000842 | 3300025927 | Bacteria | 20740 |
| 339 | Ga0207687_10031812 | 3300025927 | Bacteria | 3569 |
| 340 | Ga0207700_10004656 | 3300025928 | Bacteria | 8128 |
| 341 | Ga0207700_10008259 | 3300025928 | Bacteria | 6434 |
| 342 | Ga0207700_10011992 | 3300025928 | Bacteria | 5562 |
| 343 | Ga0207700_10024576 | 3300025928 | Bacteria | 4172 |
| 344 | Ga0207700_10025233 | 3300025928 | Bacteria | 4125 |
| 345 | Ga0207700_10035520 | 3300025928 | Bacteria | 3591 |
| 346 | Ga0207700_10048897 | 3300025928 | Bacteria | 3143 |
| 347 | Ga0207700_10058256 | 3300025928 | Bacteria | 2917 |
| 348 | Ga0207700_10066774 | 3300025928 | Bacteria | 2750 |
| 349 | Ga0207700_10072356 | 3300025928 | Bacteria | 2658 |
| 350 | Ga0207664_10003669 | 3300025929 | Bacteria | 10285 |
| 351 | Ga0207664_10003919 | 3300025929 | Bacteria | 10001 |
| 352 | Ga0207664_10004524 | 3300025929 | Bacteria | 9421 |
| 353 | Ga0207664_10010352 | 3300025929 | Bacteria | 6586 |
| 354 | Ga0207664_10017382 | 3300025929 | Bacteria | 5271 |
| 355 | Ga0207664_10025480 | 3300025929 | Bacteria | 4457 |
| 356 | Ga0207664_10026630 | 3300025929 | Unclassified | 4373 |
| 357 | Ga0207664_10039346 | 3300025929 | Bacteria | 3672 |
| 358 | Ga0207644_10008003 | 3300025931 | Bacteria | 6912 |
| 359 | Ga0207644_10012375 | 3300025931 | Bacteria | 5664 |
| 360 | Ga0207690_10004202 | 3300025932 | Bacteria | 8512 |
| 361 | Ga0207690_10090184 | 3300025932 | Bacteria | 2163 |
| 362 | Ga0207706_10076573 | 3300025933 | Bacteria | 2942 |
| 363 | Ga0207706_10106804 | 3300025933 | Bacteria | 2464 |
| 364 | Ga0207709_10008686 | 3300025935 | Bacteria | 5606 |
| 365 | Ga0207709_10029106 | 3300025935 | Bacteria | 3200 |
| 366 | Ga0207670_10097738 | 3300025936 | Bacteria | 2091 |
| 367 | Ga0207669_10105408 | 3300025937 | Bacteria | 1875 |
| 368 | Ga0207704_10056512 | 3300025938 | Bacteria | 2405 |
| 369 | Ga0207665_10000412 | 3300025939 | Bacteria | 29458 |
| 370 | Ga0207665_10004021 | 3300025939 | Bacteria | 9817 |
| 371 | Ga0207665_10008637 | 3300025939 | Bacteria | 6707 |
| 372 | Ga0207665_10023651 | 3300025939 | Bacteria | 4047 |
| 373 | Ga0207691_10013198 | 3300025940 | Bacteria | 7910 |
| 374 | Ga0207691_10022500 | 3300025940 | Bacteria | 5944 |
| 375 | Ga0207691_10107485 | 3300025940 | Bacteria | 2483 |
| 376 | Ga0207689_10002593 | 3300025942 | Bacteria | 16723 |
| 377 | Ga0207689_10029825 | 3300025942 | Bacteria | 4549 |
| 378 | Ga0207661_10002657 | 3300025944 | Bacteria | 12298 |
| 379 | Ga0207661_10006624 | 3300025944 | Bacteria | 8184 |
| 380 | Ga0207661_10044306 | 3300025944 | Bacteria | 3516 |
| 381 | Ga0207661_10065827 | 3300025944 | Bacteria | 2942 |
| 382 | Ga0207661_10088523 | 3300025944 | Bacteria | 2574 |
| 383 | Ga0207661_10133799 | 3300025944 | Bacteria | 2127 |
| 384 | Ga0207679_10010995 | 3300025945 | Bacteria | 5841 |
| 385 | Ga0207679_10060091 | 3300025945 | Bacteria | 2823 |
| 386 | Ga0207679_10106384 | 3300025945 | Bacteria | 2205 |
| 387 | Ga0207667_10004602 | 3300025949 | Bacteria | 16924 |
| 388 | Ga0207667_10015537 | 3300025949 | Bacteria | 8640 |
| 389 | Ga0207651_10118895 | 3300025960 | Bacteria | 2000 |
| 390 | Ga0207651_10121339 | 3300025960 | Bacteria | 1983 |
| 391 | Ga0207668_10017830 | 3300025972 | Bacteria | 4456 |
| 392 | Ga0207640_10004012 | 3300025981 | Bacteria | 7953 |
| 393 | Ga0207677_10004443 | 3300026023 | Bacteria | 7531 |
| 394 | Ga0207677_10029647 | 3300026023 | Bacteria | 3481 |
| 395 | Ga0207677_10062601 | 3300026023 | Bacteria | 2582 |
| 396 | Ga0207677_10081446 | 3300026023 | Bacteria | 2323 |
| 397 | Ga0207703_10123776 | 3300026035 | Bacteria | 2223 |
| 398 | Ga0207639_10057038 | 3300026041 | Bacteria | 2997 |
| 399 | Ga0207639_10057387 | 3300026041 | Bacteria | 2989 |
| 400 | Ga0207678_10011871 | 3300026067 | Bacteria | 7650 |
| 401 | Ga0207678_10078529 | 3300026067 | Bacteria | 2827 |
| 402 | Ga0207678_10096187 | 3300026067 | Bacteria | 2531 |
| 403 | Ga0207708_10000985 | 3300026075 | Bacteria | 21291 |
| 404 | Ga0207708_10002530 | 3300026075 | Bacteria | 13445 |
| 405 | Ga0207708_10006019 | 3300026075 | Bacteria | 8991 |
| 406 | Ga0207708_10032889 | 3300026075 | Bacteria | 3938 |
| 407 | Ga0207708_10033380 | 3300026075 | Bacteria | 3910 |
| 408 | Ga0207708_10045044 | 3300026075 | Bacteria | 3362 |
| 409 | Ga0207708_10071096 | 3300026075 | Bacteria | 2665 |
| 410 | Ga0207702_10002437 | 3300026078 | Bacteria | 17646 |
| 411 | Ga0207702_10009971 | 3300026078 | Bacteria | 7965 |
| 412 | Ga0207702_10114614 | 3300026078 | Bacteria | 2402 |
| 413 | Ga0207648_10001308 | 3300026089 | Bacteria | 27722 |
| 414 | Ga0207648_10004509 | 3300026089 | Bacteria | 14281 |
| 415 | Ga0207648_10017309 | 3300026089 | Bacteria | 6564 |
| 416 | Ga0207648_10029778 | 3300026089 | Bacteria | 4841 |
| 417 | Ga0207676_10003391 | 3300026095 | Bacteria | 11254 |
| 418 | Ga0207676_10016826 | 3300026095 | Bacteria | 5295 |
| 419 | Ga0207676_10033378 | 3300026095 | Bacteria | 3888 |
| 420 | Ga0207674_10000093 | 3300026116 | Bacteria | 99440 |
| 421 | Ga0207674_10014208 | 3300026116 | Bacteria | 8796 |
| 422 | Ga0207674_10017738 | 3300026116 | Bacteria | 7758 |
| 423 | Ga0207674_10084964 | 3300026116 | Bacteria | 3162 |
| 424 | Ga0207674_10107503 | 3300026116 | Bacteria | 2767 |
| 425 | Ga0207675_100003463 | 3300026118 | Bacteria | 15427 |
| 426 | Ga0207683_10000454 | 3300026121 | Bacteria | 38017 |
| 427 | Ga0207683_10009054 | 3300026121 | Bacteria | 8485 |
| 428 | Ga0207683_10106699 | 3300026121 | Bacteria | 2505 |
| 429 | Ga0207683_10154855 | 3300026121 | Bacteria | 2070 |
| 430 | Ga0207698_10004756 | 3300026142 | Bacteria | 8308 |
| 431 | Ga0207698_10046821 | 3300026142 | Bacteria | 3270 |
| 432 | Ga0207428_10115835 | 3300027907 | Bacteria | 2059 |
| 433 | Ga0207428_10133363 | 3300027907 | Bacteria | 1900 |
| 434 | Ga0268266_10054809 | 3300028379 | Bacteria | 3427 |
| 435 | Ga0268266_10094610 | 3300028379 | Bacteria | 2623 |
| 436 | Ga0268265_10108993 | 3300028380 | Bacteria | 2256 |
| 437 | Ga0268265_10122970 | 3300028380 | Bacteria | 2142 |
| 438 | Ga0268264_10039541 | 3300028381 | Bacteria | 3897 |
| 439 | Ga0307513_10019341 | 3300031456 | Bacteria | 8110 |
| 440 | Ga0307406_10076400 | 3300031901 | Bacteria | 2212 |
| 441 | Ga0307409_100027270 | 3300031995 | Bacteria | 4045 |
| 442 | Ga0307416_100005109 | 3300032002 | Bacteria | 8010 |
| 443 | Ga0307416_100090392 | 3300032002 | Bacteria | 2625 |
| 444 | Ga0307416_100114158 | 3300032002 | Bacteria | 2389 |
| 445 | Ga0307411_10016550 | 3300032005 | Bacteria | 4176 |
| 446 | Ga0307415_100037871 | 3300032126 | Bacteria | 3173 |
| 447 | Ga0373926_0001583 | 3300035083 | Bacteria | 6997 |
| 448 | Ga0373934_0001615 | 3300035086 | Bacteria | 8273 |
| 449 | Ga0373944_0001827 | 3300035089 | Bacteria | 5376 |
| 450 | Ga0373936_0003892 | 3300035113 | Bacteria | 5626 |
| 451 | Ga0373945_0000591 | 3300035116 | Bacteria | 10415 |
| 452 | Ga0373953_0009920 | 3300035117 | Bacteria | 3298 |
| 453 | Ga0373954_0042125 | 3300035118 | Bacteria | 2129 |
| 454 | Ga0373956_0001004 | 3300035119 | Bacteria | 11642 |
| 455 | Ga0373957_0008506 | 3300035120 | Bacteria | 3327 |
| 456 | Ga0373957_0019408 | 3300035120 | Bacteria | 2392 |
| 457 | Ga0373943_0001628 | 3300035170 | Bacteria | 10184 |
| 458 | Ga0373955_0000005 | 3300035172 | Bacteria | 108267 |
| 459 | Ga0373924_0008586 | 3300035410 | Bacteria | 3719 |
| 460 | Ga0373927_0016122 | 3300035695 | Bacteria | 4930 |
| 461 | Ga0373927_0019496 | 3300035695 | Bacteria | 4447 |
| 462 | Ga0373933_0000043 | 3300035724 | Bacteria | 78147 |
| 463 | Ga0373933_0022557 | 3300035724 | Bacteria | 3586 |
| 464 | Ga0373933_0039045 | 3300035724 | Bacteria | 2792 |
| 465 | Ga0373933_0049229 | 3300035724 | Bacteria | 2512 |
| 466 | Ga0373933_0081560 | 3300035724 | Bacteria | 1984 |
| 467 | Ga0373947_0004411 | 3300035725 | Bacteria | 8254 |
| 468 | Ga0373947_0019417 | 3300035725 | Bacteria | 3918 |
| 469 | Ga0373937_0000245 | 3300036401 | Bacteria | 53041 |
| 470 | Ga0373937_0003783 | 3300036401 | Bacteria | 12795 |
| 471 | Ga0373937_0040151 | 3300036401 | Bacteria | 4265 |
| 472 | Ga0373937_0063250 | 3300036401 | Bacteria | 3403 |
| 473 | Ga0373937_0063513 | 3300036401 | Bacteria | 3396 |
| 474 | Ga0373937_0084052 | 3300036401 | Bacteria | 2944 |
| 475 | Ga0373937_0096125 | 3300036401 | Bacteria | 2747 |
| 476 | Ga0373937_0179693 | 3300036401 | Bacteria | 1987 |
| 477 | Ga0373925_0000028 | 3300037068 | Bacteria | 149654 |
| 478 | Ga0373925_0001494 | 3300037068 | Bacteria | 20080 |
| 479 | Ga0373925_0001915 | 3300037068 | Bacteria | 17236 |
| 480 | Ga0373925_0007560 | 3300037068 | Bacteria | 7917 |
| 481 | Ga0373925_0109962 | 3300037068 | Bacteria | 2128 |
| 482 | Ga0395900_0143787 | 3300037418 | Bacteria | 2441 |
| 483 | Ga0395898_0179084 | 3300037466 | Bacteria | 2026 |
| 484 | Ga0395905_0059024 | 3300037471 | Bacteria | 3587 |
| 485 | Ga0451853_0174584 | 3300041512 | Bacteria | 2421 |
| 486 | Ga0451853_2073262 | 3300041512 | Bacteria | 3827 |
| 487 | Ga0439448_0007867 | 3300042005 | Bacteria | 3101 |
| 488 | Ga0439448_0008553 | 3300042005 | Bacteria | 3000 |
| 489 | Ga0439463_002716 | 3300042016 | Bacteria | 4473 |
| 490 | Ga0450902_007704 | 3300042137 | Bacteria | 1671 |
| 491 | Ga0439458_0008012 | 3300042157 | Bacteria | 2350 |
| 492 | Ga0439458_0008711 | 3300042157 | Bacteria | 2263 |
| 493 | Ga0439460_0018107 | 3300042461 | Bacteria | 1893 |
| 494 | Ga0466963_0001267 | 3300044694 | Bacteria | 13391 |
| 495 | Ga0466970_0012932 | 3300044765 | Bacteria | 4275 |
| 496 | Ga0466959_0070396 | 3300045049 | Bacteria | 2534 |
| 497 | Ga0466967_0004137 | 3300045976 | Bacteria | 9701 |
| 498 | Ga0466967_0007021 | 3300045976 | Bacteria | 8065 |
| 499 | Ga0466967_0101822 | 3300045976 | Bacteria | 2626 |
| 500 | Ga0495592_0000092 | 3300046454 | Bacteria | 79147 |
| 501 | Ga0495592_0011277 | 3300046454 | Bacteria | 6759 |
| 502 | Ga0495592_0033973 | 3300046454 | Bacteria | 3846 |
| 503 | Ga0495592_0097787 | 3300046454 | Bacteria | 2096 |
| 504 | Ga0495629_0001088 | 3300046459 | Bacteria | 21535 |
| 505 | Ga0495629_0001429 | 3300046459 | Bacteria | 18830 |
| 506 | Ga0495629_0014399 | 3300046459 | Bacteria | 5689 |
| 507 | Ga0495641_0001952 | 3300046461 | Bacteria | 16770 |
| 508 | Ga0495641_0022859 | 3300046461 | Bacteria | 3119 |
| 509 | Ga0495651_0000066 | 3300046462 | Bacteria | 77538 |
| 510 | Ga0495651_0001498 | 3300046462 | Bacteria | 18071 |
| 511 | Ga0495651_0003513 | 3300046462 | Bacteria | 12018 |
| 512 | Ga0495651_0010231 | 3300046462 | Bacteria | 7200 |
| 513 | Ga0495651_0011712 | 3300046462 | Bacteria | 6738 |
| 514 | Ga0495651_0018918 | 3300046462 | Bacteria | 5337 |
| 515 | Ga0495651_0019855 | 3300046462 | Bacteria | 5211 |
| 516 | Ga0495651_0058460 | 3300046462 | Bacteria | 2958 |
| 517 | Ga0495653_0002166 | 3300046463 | Bacteria | 15515 |
| 518 | Ga0495653_0003794 | 3300046463 | Bacteria | 12221 |
| 519 | Ga0495653_0004422 | 3300046463 | Bacteria | 11360 |
| 520 | Ga0495653_0008124 | 3300046463 | Bacteria | 8594 |
| 521 | Ga0495653_0012547 | 3300046463 | Bacteria | 6920 |
| 522 | Ga0495653_0036173 | 3300046463 | Bacteria | 3891 |
| 523 | Ga0495653_0099119 | 3300046463 | Bacteria | 2115 |
| 524 | Ga0495580_0015030 | 3300046472 | Bacteria | 5858 |
| 525 | Ga0495582_0000078 | 3300046473 | Bacteria | 49080 |
| 526 | Ga0495582_0000338 | 3300046473 | Bacteria | 25659 |
| 527 | Ga0495582_0001399 | 3300046473 | Bacteria | 13590 |
| 528 | Ga0495582_0002910 | 3300046473 | Bacteria | 9572 |
| 529 | Ga0495639_0003784 | 3300046475 | Bacteria | 6499 |
| 530 | Ga0495639_0030093 | 3300046475 | Bacteria | 2412 |
| 531 | Ga0495662_0008850 | 3300046476 | Bacteria | 4944 |
| 532 | Ga0495662_0012129 | 3300046476 | Bacteria | 4210 |
| 533 | Ga0495594_0017675 | 3300046499 | Bacteria | 3770 |
| 534 | Ga0495594_0032192 | 3300046499 | Bacteria | 2845 |
| 535 | Ga0495608_0000070 | 3300046511 | Bacteria | 77533 |
| 536 | Ga0495608_0007499 | 3300046511 | Bacteria | 7702 |
| 537 | Ga0495608_0043756 | 3300046511 | Bacteria | 2991 |
| 538 | Ga0495608_0044263 | 3300046511 | Bacteria | 2971 |
| 539 | Ga0495608_0065762 | 3300046511 | Bacteria | 2374 |
| 540 | Ga0495618_0034995 | 3300046514 | Bacteria | 3151 |
| 541 | Ga0495618_0073762 | 3300046514 | Bacteria | 2173 |
| 542 | Ga0495618_0091766 | 3300046514 | Bacteria | 1942 |
| 543 | Ga0495628_0000624 | 3300046516 | Bacteria | 32362 |
| 544 | Ga0495628_0003918 | 3300046516 | Bacteria | 13261 |
| 545 | Ga0495628_0013221 | 3300046516 | Bacteria | 6941 |
| 546 | Ga0495628_0021322 | 3300046516 | Bacteria | 5332 |
| 547 | Ga0495628_0027893 | 3300046516 | Bacteria | 4590 |
| 548 | Ga0495628_0052056 | 3300046516 | Bacteria | 3235 |
| 549 | Ga0495628_0094001 | 3300046516 | Bacteria | 2318 |
| 550 | Ga0495628_0112248 | 3300046516 | Bacteria | 2095 |
| 551 | Ga0495630_0018348 | 3300046517 | Bacteria | 5139 |
| 552 | Ga0495630_0027780 | 3300046517 | Bacteria | 4201 |
| 553 | Ga0495652_0000679 | 3300046529 | Bacteria | 39396 |
| 554 | Ga0495652_0000769 | 3300046529 | Bacteria | 36908 |
| 555 | Ga0495652_0009984 | 3300046529 | Bacteria | 8603 |
| 556 | Ga0495652_0013266 | 3300046529 | Bacteria | 7418 |
| 557 | Ga0495652_0016891 | 3300046529 | Bacteria | 6522 |
| 558 | Ga0495652_0051756 | 3300046529 | Bacteria | 3505 |
| 559 | Ga0495652_0090925 | 3300046529 | Bacteria | 2496 |
| 560 | Ga0495665_0001371 | 3300046531 | Bacteria | 13031 |
| 561 | Ga0495665_0006507 | 3300046531 | Bacteria | 6308 |
| 562 | Ga0495665_0011482 | 3300046531 | Bacteria | 4795 |
| 563 | Ga0495665_0021638 | 3300046531 | Bacteria | 3457 |
| 564 | Ga0495640_0013066 | 3300046533 | Bacteria | 6324 |
| 565 | Ga0495640_0023414 | 3300046533 | Bacteria | 4499 |
| 566 | Ga0495640_0034424 | 3300046533 | Bacteria | 3591 |
| 567 | Ga0495640_0047829 | 3300046533 | Bacteria | 2958 |
| 568 | Ga0495587_0000077 | 3300046536 | Bacteria | 77532 |
| 569 | Ga0495587_0004198 | 3300046536 | Bacteria | 9537 |
| 570 | Ga0495587_0014003 | 3300046536 | Bacteria | 5036 |
| 571 | Ga0495587_0056171 | 3300046536 | Bacteria | 2316 |
| 572 | Ga0495587_0068029 | 3300046536 | Bacteria | 2075 |
| 573 | Ga0495621_0000572 | 3300046539 | Bacteria | 9176 |
| 574 | Ga0495645_0064304 | 3300046543 | Bacteria | 2655 |
| 575 | Ga0495645_0078985 | 3300046543 | Bacteria | 2364 |
| 576 | Ga0495645_0084253 | 3300046543 | Bacteria | 2276 |
| 577 | Ga0495667_0000071 | 3300046559 | Bacteria | 77538 |
| 578 | Ga0495667_0002937 | 3300046559 | Bacteria | 11443 |
| 579 | Ga0495667_0005115 | 3300046559 | Bacteria | 8860 |
| 580 | Ga0495667_0006824 | 3300046559 | Bacteria | 7750 |
| 581 | Ga0495667_0013560 | 3300046559 | Bacteria | 5513 |
| 582 | Ga0495667_0030210 | 3300046559 | Bacteria | 3643 |
| 583 | Ga0495667_0036047 | 3300046559 | Bacteria | 3304 |
| 584 | Ga0495667_0048750 | 3300046559 | Bacteria | 2796 |
| 585 | Ga0495634_0011952 | 3300046642 | Bacteria | 6298 |
| 586 | Ga0495634_0019468 | 3300046642 | Bacteria | 4823 |
| 587 | Ga0495634_0031304 | 3300046642 | Bacteria | 3665 |
| 588 | Ga0495634_0031861 | 3300046642 | Bacteria | 3629 |
| 589 | Ga0495634_0074759 | 3300046642 | Bacteria | 2226 |
| 590 | Ga0495635_0009283 | 3300046663 | Bacteria | 6871 |
| 591 | Ga0495635_0012304 | 3300046663 | Bacteria | 5995 |
| 592 | Ga0495635_0017230 | 3300046663 | Bacteria | 5046 |
| 593 | Ga0495635_0018757 | 3300046663 | Bacteria | 4827 |
| 594 | Ga0495635_0023243 | 3300046663 | Bacteria | 4321 |
| 595 | Ga0495588_0004695 | 3300046674 | Bacteria | 6035 |
| 596 | Ga0495588_0022616 | 3300046674 | Bacteria | 3108 |
| 597 | Ga0495657_0000095 | 3300046675 | Bacteria | 77538 |
| 598 | Ga0495657_0003888 | 3300046675 | Bacteria | 12027 |
| 599 | Ga0495657_0005793 | 3300046675 | Bacteria | 9734 |
| 600 | Ga0495657_0008653 | 3300046675 | Bacteria | 7765 |
| 601 | Ga0495599_0000155 | 3300046678 | Bacteria | 45015 |
| 602 | Ga0495599_0007643 | 3300046678 | Bacteria | 6565 |
| 603 | Ga0495599_0086353 | 3300046678 | Bacteria | 1959 |
| 604 | Ga0495599_0104857 | 3300046678 | Bacteria | 1761 |
| 605 | Ga0495623_0001673 | 3300046679 | Bacteria | 14902 |
| 606 | Ga0495623_0015929 | 3300046679 | Bacteria | 4860 |
| 607 | Ga0495623_0019635 | 3300046679 | Bacteria | 4368 |
| 608 | Ga0495646_0009024 | 3300046680 | Bacteria | 6324 |
| 609 | Ga0495646_0032465 | 3300046680 | Bacteria | 3249 |
| 610 | Ga0495647_0014609 | 3300046681 | Bacteria | 2738 |
| 611 | Ga0495647_0015267 | 3300046681 | Bacteria | 2688 |
| 612 | Ga0495658_0000236 | 3300046683 | Bacteria | 31770 |
| 613 | Ga0495658_0000726 | 3300046683 | Bacteria | 17778 |
| 614 | Ga0495658_0008286 | 3300046683 | Bacteria | 5149 |
| 615 | Ga0495613_0000207 | 3300046689 | Bacteria | 58099 |
| 616 | Ga0495613_0004518 | 3300046689 | Bacteria | 10433 |
| 617 | Ga0495613_0018030 | 3300046689 | Bacteria | 5261 |
| 618 | Ga0495613_0091729 | 3300046689 | Bacteria | 2200 |
| 619 | Ga0495624_0002604 | 3300046690 | Bacteria | 13611 |
| 620 | Ga0495624_0020231 | 3300046690 | Bacteria | 4433 |
| 621 | Ga0495624_0025322 | 3300046690 | Bacteria | 3896 |
| 622 | Ga0495600_0001750 | 3300046809 | Bacteria | 12137 |
| 623 | Ga0495600_0013426 | 3300046809 | Bacteria | 5147 |
| 624 | Ga0495600_0017470 | 3300046809 | Bacteria | 4564 |
| 625 | Ga0495600_0023354 | 3300046809 | Bacteria | 3978 |
| 626 | Ga0495600_0025724 | 3300046809 | Bacteria | 3793 |
| 627 | Ga0495600_0037480 | 3300046809 | Bacteria | 3152 |
| 628 | Ga0495600_0044659 | 3300046809 | Bacteria | 2890 |
| 629 | Ga0495581_0001112 | 3300047315 | Bacteria | 14690 |
| 630 | Ga0495581_0001409 | 3300047315 | Bacteria | 13320 |
| 631 | Ga0495581_0011427 | 3300047315 | Bacteria | 5139 |
| 632 | Ga0495581_0037896 | 3300047315 | Bacteria | 2790 |
| 633 | Ga0495604_0000087 | 3300047317 | Bacteria | 79147 |
| 634 | Ga0495604_0001649 | 3300047317 | Bacteria | 18351 |
| 635 | Ga0495604_0046959 | 3300047317 | Bacteria | 3365 |
| 636 | Ga0495604_0052269 | 3300047317 | Bacteria | 3165 |
| 637 | Ga0495674_0010613 | 3300047319 | Bacteria | 8716 |
| 638 | Ga0495674_0040756 | 3300047319 | Bacteria | 4151 |
| 639 | Ga0495674_0060103 | 3300047319 | Bacteria | 3317 |
| 640 | Ga0495674_0074405 | 3300047319 | Bacteria | 2925 |
| 641 | Ga0495674_0077342 | 3300047319 | Bacteria | 2861 |
| 642 | Ga0495676_0011573 | 3300047321 | Bacteria | 7959 |
| 643 | Ga0495676_0020754 | 3300047321 | Bacteria | 5756 |
| 644 | Ga0495676_0083124 | 3300047321 | Bacteria | 2421 |
| 645 | Ga0495680_0002287 | 3300047322 | Bacteria | 19719 |
| 646 | Ga0495680_0003033 | 3300047322 | Bacteria | 16753 |
| 647 | Ga0495680_0006516 | 3300047322 | Bacteria | 10836 |
| 648 | Ga0495680_0006570 | 3300047322 | Bacteria | 10790 |
| 649 | Ga0495680_0006733 | 3300047322 | Bacteria | 10627 |
| 650 | Ga0495680_0012893 | 3300047322 | Bacteria | 7324 |
| 651 | Ga0495680_0020012 | 3300047322 | Bacteria | 5640 |
| 652 | Ga0495680_0027766 | 3300047322 | Bacteria | 4645 |
| 653 | Ga0495680_0039139 | 3300047322 | Bacteria | 3784 |
| 654 | Ga0495680_0055223 | 3300047322 | Bacteria | 3081 |
| 655 | Ga0495680_0086991 | 3300047322 | Bacteria | 2351 |
| 656 | Ga0495680_0126468 | 3300047322 | Bacteria | 1882 |
| 657 | Ga0495675_0000157 | 3300047444 | Bacteria | 48143 |
| 658 | Ga0495675_0001850 | 3300047444 | Bacteria | 12615 |
| 659 | Ga0495675_0003497 | 3300047444 | Bacteria | 9465 |
| 660 | Ga0495675_0009503 | 3300047444 | Bacteria | 6056 |
| 661 | Ga0495675_0033710 | 3300047444 | Bacteria | 3268 |
| 662 | Ga0495684_0003809 | 3300047471 | Bacteria | 11754 |
| 663 | Ga0495684_0018295 | 3300047471 | Bacteria | 5400 |
| 664 | Ga0495684_0050461 | 3300047471 | Bacteria | 3177 |
| 665 | Ga0495684_0056981 | 3300047471 | Bacteria | 2978 |
| 666 | Ga0495684_0058330 | 3300047471 | Bacteria | 2941 |
| 667 | Ga0495684_0059009 | 3300047471 | Bacteria | 2922 |
| 668 | Ga0495593_0011846 | 3300047673 | Bacteria | 5000 |
| 669 | Ga0495593_0057053 | 3300047673 | Bacteria | 2051 |
| 670 | Ga0495602_0000461 | 3300048088 | Bacteria | 37751 |
| 671 | Ga0495602_0017632 | 3300048088 | Bacteria | 7154 |
| 672 | Ga0496101_0002239 | 3300048904 | Bacteria | 11828 |
| 673 | Ga0496101_0002703 | 3300048904 | Bacteria | 10880 |
| 674 | Ga0496102_0006157 | 3300048905 | Bacteria | 10227 |
| 675 | Ga0496102_0006613 | 3300048905 | Bacteria | 9906 |
| 676 | Ga0496102_0013799 | 3300048905 | Bacteria | 7009 |
| 677 | Ga0496102_0020367 | 3300048905 | Bacteria | 5862 |
| 678 | Ga0496102_0079312 | 3300048905 | Bacteria | 3024 |
| 679 | Ga0496102_0082024 | 3300048905 | Bacteria | 2974 |
| 680 | Ga0496102_0107632 | 3300048905 | Bacteria | 2596 |
| 681 | Ga0496103_0002293 | 3300048906 | Bacteria | 12088 |
| 682 | Ga0496103_0053099 | 3300048906 | Bacteria | 2511 |
| 683 | Ga0496103_0088633 | 3300048906 | Bacteria | 1951 |
| 684 | Ga0496104_0012420 | 3300048907 | Bacteria | 7657 |
| 685 | Ga0496104_0017300 | 3300048907 | Bacteria | 6562 |
| 686 | Ga0496104_0019218 | 3300048907 | Bacteria | 6247 |
| 687 | Ga0496104_0071383 | 3300048907 | Bacteria | 3301 |
| 688 | Ga0496104_0071625 | 3300048907 | Bacteria | 3295 |
| 689 | Ga0496104_0110864 | 3300048907 | Bacteria | 2631 |
| 690 | Ga0496104_0205506 | 3300048907 | Unclassified | 1881 |
| 691 | Ga0496105_0000756 | 3300048908 | Bacteria | 21951 |
| 692 | Ga0496105_0002305 | 3300048908 | Bacteria | 13849 |
| 693 | Ga0496105_0016330 | 3300048908 | Bacteria | 5925 |
| 694 | Ga0496105_0060205 | 3300048908 | Bacteria | 3133 |
| 695 | Ga0496105_0072332 | 3300048908 | Bacteria | 2850 |
| 696 | Ga0496105_0085683 | 3300048908 | Bacteria | 2603 |
| 697 | Ga0496105_0103220 | 3300048908 | Bacteria | 2354 |
| 698 | Ga0496106_0003648 | 3300048909 | Bacteria | 11477 |
| 699 | Ga0496106_0019313 | 3300048909 | Bacteria | 5053 |
| 700 | Ga0496107_0005385 | 3300048910 | Bacteria | 8755 |
| 701 | Ga0496107_0009138 | 3300048910 | Bacteria | 6870 |
| 702 | Ga0496107_0051083 | 3300048910 | Bacteria | 2981 |
| 703 | Ga0496108_0000337 | 3300048911 | Bacteria | 39725 |
| 704 | Ga0496108_0012789 | 3300048911 | Bacteria | 6834 |
| 705 | Ga0496108_0015456 | 3300048911 | Bacteria | 6226 |
| 706 | Ga0496108_0030880 | 3300048911 | Bacteria | 4440 |
| 707 | Ga0496108_0034247 | 3300048911 | Bacteria | 4219 |
| 708 | Ga0496108_0038524 | 3300048911 | Bacteria | 3982 |
| 709 | Ga0496108_0050752 | 3300048911 | Bacteria | 3474 |
| 710 | Ga0496108_0065856 | 3300048911 | Bacteria | 3054 |
| 711 | Ga0496108_0082633 | 3300048911 | Bacteria | 2724 |
| 712 | Ga0496108_0082690 | 3300048911 | Bacteria | 2723 |
| 713 | Ga0496108_0088572 | 3300048911 | Bacteria | 2630 |
| 714 | Ga0496108_0089272 | 3300048911 | Bacteria | 2619 |
| 715 | Ga0496109_0004142 | 3300048912 | Bacteria | 12111 |
| 716 | Ga0496109_0005796 | 3300048912 | Bacteria | 10341 |
| 717 | Ga0496109_0027124 | 3300048912 | Bacteria | 5112 |
| 718 | Ga0496109_0035131 | 3300048912 | Bacteria | 4519 |
| 719 | Ga0496109_0054063 | 3300048912 | Bacteria | 3664 |
| 720 | Ga0496109_0058506 | 3300048912 | Bacteria | 3520 |
| 721 | Ga0496109_0081171 | 3300048912 | Bacteria | 2988 |
| 722 | Ga0496109_0095421 | 3300048912 | Bacteria | 2754 |
| 723 | Ga0496109_0102338 | 3300048912 | Bacteria | 2658 |
| 724 | Ga0496109_0108886 | 3300048912 | Bacteria | 2575 |
| 725 | Ga0496110_0000249 | 3300048913 | Bacteria | 34963 |
| 726 | Ga0496110_0021412 | 3300048913 | Bacteria | 5474 |
| 727 | Ga0496110_0036269 | 3300048913 | Bacteria | 4281 |
| 728 | Ga0496110_0038608 | 3300048913 | Bacteria | 4156 |
| 729 | Ga0496110_0048234 | 3300048913 | Bacteria | 3733 |
| 730 | Ga0496110_0070893 | 3300048913 | Bacteria | 3089 |
| 731 | Ga0496110_0075476 | 3300048913 | Bacteria | 2995 |
| 732 | Ga0496110_0099095 | 3300048913 | Bacteria | 2613 |
| 733 | Ga0496110_0107222 | 3300048913 | Bacteria | 2507 |
| 734 | Ga0496111_0003049 | 3300048914 | Bacteria | 10281 |
| 735 | Ga0496111_0022383 | 3300048914 | Bacteria | 4424 |
| 736 | Ga0496111_0071066 | 3300048914 | Bacteria | 2533 |
| 737 | Ga0496111_0094521 | 3300048914 | Bacteria | 2192 |
| 738 | Ga0496112_0000620 | 3300048915 | Bacteria | 24573 |
| 739 | Ga0496112_0002834 | 3300048915 | Bacteria | 14076 |
| 740 | Ga0496112_0008758 | 3300048915 | Bacteria | 9077 |
| 741 | Ga0496112_0010866 | 3300048915 | Bacteria | 8285 |
| 742 | Ga0496112_0016419 | 3300048915 | Bacteria | 6935 |
| 743 | Ga0496112_0115326 | 3300048915 | Bacteria | 2657 |
| 744 | Ga0496113_0050528 | 3300048916 | Bacteria | 3100 |
| 745 | Ga0496113_0080845 | 3300048916 | Bacteria | 2490 |
| 746 | Ga0496114_0020614 | 3300048917 | Bacteria | 5351 |
| 747 | Ga0496114_0024825 | 3300048917 | Bacteria | 4893 |
| 748 | Ga0496114_0030283 | 3300048917 | Bacteria | 4453 |
| 749 | Ga0496114_0056320 | 3300048917 | Bacteria | 3281 |
| 750 | Ga0496114_0100339 | 3300048917 | Bacteria | 2470 |
| 751 | Ga0496114_0204919 | 3300048917 | Bacteria | 1729 |
| 752 | Ga0496115_0004134 | 3300048918 | Bacteria | 10475 |
| 753 | Ga0496115_0008063 | 3300048918 | Bacteria | 7778 |
| 754 | Ga0496115_0029753 | 3300048918 | Bacteria | 4292 |
| 755 | Ga0496115_0072365 | 3300048918 | Bacteria | 2797 |
| 756 | Ga0496121_0002166 | 3300048924 | Bacteria | 30741 |
| 757 | Ga0496126_0019805 | 3300048929 | Bacteria | 6618 |
| 758 | Ga0496126_0174840 | 3300048929 | Bacteria | 1827 |
| 759 | Ga0501031_0006295 | 3300049568 | Bacteria | 7737 |
| 760 | Ga0501031_0027487 | 3300049568 | Bacteria | 3709 |
| 761 | Ga0501031_0032255 | 3300049568 | Bacteria | 3415 |
| 762 | Ga0501032_0002022 | 3300049569 | Bacteria | 15992 |
| 763 | Ga0501033_0011445 | 3300049570 | Bacteria | 6789 |
| 764 | Ga0501033_0013928 | 3300049570 | Bacteria | 6120 |
| 765 | Ga0501034_0004204 | 3300049571 | Bacteria | 16074 |
| 766 | Ga0501034_0062091 | 3300049571 | Bacteria | 3752 |
| 767 | Ga0501036_0000582 | 3300049572 | Bacteria | 26379 |
| 768 | Ga0501036_0106033 | 3300049572 | Bacteria | 2377 |
| 769 | Ga0501037_0021309 | 3300049573 | Bacteria | 4788 |
| 770 | Ga0501037_0072555 | 3300049573 | Bacteria | 2503 |
| 771 | Ga0501038_0000732 | 3300049574 | Bacteria | 29297 |
| 772 | Ga0501038_0038074 | 3300049574 | Bacteria | 4212 |
| 773 | Ga0501039_0000391 | 3300049575 | Bacteria | 31522 |
| 774 | Ga0501039_0049987 | 3300049575 | Bacteria | 3233 |
| 775 | Ga0501040_0000516 | 3300049576 | Bacteria | 23123 |
| 776 | Ga0501040_0005371 | 3300049576 | Bacteria | 8286 |
| 777 | Ga0501040_0009161 | 3300049576 | Bacteria | 6446 |
| 778 | Ga0501040_0021756 | 3300049576 | Bacteria | 4287 |
| 779 | Ga0501041_0004140 | 3300049577 | Bacteria | 8392 |
| 780 | Ga0501041_0039901 | 3300049577 | Bacteria | 2848 |
| 781 | Ga0501041_0056794 | 3300049577 | Bacteria | 2392 |
| 782 | Ga0501042_0002049 | 3300049578 | Bacteria | 12219 |
| 783 | Ga0501042_0003403 | 3300049578 | Bacteria | 9986 |
| 784 | Ga0501043_0001992 | 3300049579 | Bacteria | 17433 |
| 785 | Ga0501046_0001108 | 3300049580 | Bacteria | 26300 |
| 786 | Ga0501046_0024415 | 3300049580 | Bacteria | 4959 |
| 787 | Ga0501048_0000495 | 3300049582 | Bacteria | 27512 |
| 788 | Ga0501048_0045452 | 3300049582 | Bacteria | 3136 |
| 789 | Ga0501048_0045918 | 3300049582 | Bacteria | 3118 |
| 790 | Ga0501067_0026266 | 3300049583 | Bacteria | 3226 |
| 791 | Ga0501068_0001135 | 3300049584 | Bacteria | 14099 |
| 792 | Ga0501069_0048019 | 3300049585 | Bacteria | 2370 |
| 793 | Ga0501069_0048322 | 3300049585 | Bacteria | 2362 |
| 794 | Ga0501070_0002476 | 3300049586 | Bacteria | 16188 |
| 795 | Ga0501071_0000731 | 3300049587 | Bacteria | 17342 |
| 796 | Ga0501071_0024018 | 3300049587 | Bacteria | 4261 |
| 797 | Ga0501072_0001629 | 3300049588 | Bacteria | 16799 |
| 798 | Ga0501072_0011031 | 3300049588 | Bacteria | 6896 |
| 799 | Ga0501072_0030265 | 3300049588 | Bacteria | 4233 |
| 800 | Ga0501072_0055103 | 3300049588 | Bacteria | 3134 |
| 801 | Ga0501072_0067248 | 3300049588 | Bacteria | 2827 |
| 802 | Ga0501073_0043786 | 3300049589 | Bacteria | 3156 |
| 803 | Ga0501073_0058246 | 3300049589 | Bacteria | 2700 |
| 804 | Ga0501074_0000958 | 3300049590 | Bacteria | 18660 |
| 805 | Ga0501074_0014082 | 3300049590 | Bacteria | 5814 |
| 806 | Ga0501074_0042949 | 3300049590 | Bacteria | 3271 |
| 807 | Ga0501075_0000672 | 3300049591 | Bacteria | 21090 |
| 808 | Ga0501076_0018257 | 3300049592 | Bacteria | 5344 |
| 809 | Ga0501076_0038716 | 3300049592 | Bacteria | 3743 |
| 810 | Ga0501077_0002810 | 3300049593 | Bacteria | 10443 |
| 811 | Ga0501077_0051458 | 3300049593 | Bacteria | 2617 |
| 812 | Ga0501079_0000214 | 3300049741 | Bacteria | 34037 |
| 813 | Ga0501079_0021008 | 3300049741 | Bacteria | 4990 |
| 814 | Ga0501079_0043254 | 3300049741 | Bacteria | 3476 |
| 815 | Ga0501080_0005478 | 3300049742 | Bacteria | 11329 |
| 816 | Ga0501080_0124125 | 3300049742 | Bacteria | 2391 |
| 817 | Ga0501081_0000596 | 3300049743 | Bacteria | 20599 |
| 818 | Ga0501081_0010424 | 3300049743 | Bacteria | 6060 |
| 819 | Ga0501035_0015257 | 3300049822 | Bacteria | 7090 |
| 820 | Ga0501044_0007168 | 3300049823 | Bacteria | 12263 |
| 821 | Ga0501045_0000417 | 3300049824 | Bacteria | 25889 |
| 822 | Ga0501045_0007946 | 3300049824 | Bacteria | 7387 |
| 823 | nmdc:mga05p37_156892_c1 | 3300050507 | Bacteria | 2781 |
| 824 | nmdc:mga05p37_205530_c1 | 3300050507 | Bacteria | 2382 |
| 825 | nmdc:mga05p37_388566_c1 | 3300050507 | Bacteria | 1633 |
| 826 | nmdc:mga05p37_7880_c1 | 3300050507 | Bacteria | 12571 |
| 827 | nmdc:mga05p37_89312_c1 | 3300050507 | Bacteria | 3797 |
| 828 | nmdc:mga0qj67_228307_c1 | 3300050509 | Bacteria | 1511 |
| 829 | nmdc:mga08y16_183109_c1 | 3300050511 | Bacteria | 2174 |
| 830 | nmdc:mga08y16_33820_c1 | 3300050511 | Bacteria | 5369 |
| 831 | nmdc:mga08y16_33936_c1 | 3300050511 | Bacteria | 5361 |
| 832 | nmdc:mga08y16_56814_c1 | 3300050511 | Bacteria | 4090 |
| 833 | nmdc:mga0n895_10525_c1 | 3300050512 | Bacteria | 8180 |
| 834 | nmdc:mga0n895_198239_c1 | 3300050512 | Bacteria | 2039 |
| 835 | nmdc:mga0n895_2126_c1 | 3300050512 | Bacteria | 15301 |
| 836 | nmdc:mga0n895_43378_c1 | 3300050512 | Bacteria | 4383 |
| 837 | nmdc:mga0n895_47645_c1 | 3300050512 | Bacteria | 4191 |
| 838 | nmdc:mga0n895_825_c1 | 3300050512 | Bacteria | 22195 |
| 839 | nmdc:mga0rr50_41015_c1 | 3300050513 | Bacteria | 3369 |
| 840 | nmdc:mga0rr50_7773_c1 | 3300050513 | Bacteria | 6644 |
| 841 | nmdc:mga0rr50_95517_c1 | 3300050513 | Bacteria | 2324 |
| 842 | nmdc:mga08x19_7539_c1 | 3300050514 | Bacteria | 6466 |
| 843 | nmdc:mga08x19_9178_c1 | 3300050514 | Bacteria | 5903 |
| 844 | nmdc:mga0a205_13608_c1 | 3300050515 | Bacteria | 7579 |
| 845 | nmdc:mga0a205_192441_c1 | 3300050515 | Bacteria | 1931 |
| 846 | nmdc:mga0a205_24936_c1 | 3300050515 | Bacteria | 5692 |
| 847 | nmdc:mga0a205_37118_c1 | 3300050515 | Bacteria | 4685 |
| 848 | nmdc:mga0a205_44872_c1 | 3300050515 | Bacteria | 4263 |
| 849 | nmdc:mga0a205_6248_c1 | 3300050515 | Bacteria | 10753 |
| 850 | Ga0495601_0002354 | 3300053077 | Bacteria | 10702 |
| 851 | Ga0495601_0044793 | 3300053077 | Bacteria | 2781 |
| 852 | Ga0495612_0017888 | 3300053078 | Bacteria | 2837 |
| 853 | Ga0495612_0024350 | 3300053078 | Bacteria | 2429 |
| 854 | Ga0495595_0002737 | 3300053084 | Bacteria | 6916 |
| 855 | Ga0495619_0021469 | 3300053085 | Bacteria | 4122 |
| 856 | Ga0495619_0026491 | 3300053085 | Bacteria | 3730 |
| 857 | Ga0495619_0027064 | 3300053085 | Bacteria | 3693 |
| 858 | Ga0495619_0035391 | 3300053085 | Bacteria | 3247 |
| 859 | Ga0500616_0001517 | 3300053153 | Bacteria | 21901 |
| 860 | Ga0500616_0004633 | 3300053153 | Bacteria | 9704 |
| 861 | Ga0501082_0004602 | 3300060353 | Bacteria | 12045 |
| 862 | Ga0501082_0009312 | 3300060353 | Bacteria | 8465 |
| 863 | Ga0501082_0079914 | 3300060353 | Bacteria | 2822 |
| 864 | Ga0530510_0020513 | 3300061734 | Bacteria | 4698 |
| 865 | Ga0530510_0030155 | 3300061734 | Bacteria | 3895 |
| 866 | 2644438961 | 2643221678 | Bacteria | 9540101 |
| 867 | 2559432459 | 2558860280 | Bacteria | 11429938 |
| 868 | 2753271297 | 2751185782 | Bacteria | 11227053 |
| 869 | 2786674696 | 2786546132 | Bacteria | 10419719 |
| 870 | 2808847489 | 2808606359 | Bacteria | 9866990 |
| 871 | 2819691367 | 2818991462 | Bacteria | 4320267 |
| 872 | 2819729263 | 2818991469 | Bacteria | 4644110 |
| 873 | 2862387072 | 2862382967 | Bacteria | 10317375 |
| 874 | 2862510038 | 2862507626 | Bacteria | 9425308 |
| 875 | 2863409549 | 2863404153 | Bacteria | 9672205 |
| 876 | 2877677624 | 2877676314 | Bacteria | 9512378 |
| 877 | 2919475622 | 2919468124 | Bacteria | 9133025 |
| 878 | 2954680706 | 2954673503 | Bacteria | 9685905 |
| 879 | 2954683447 | 2954682443 | Bacteria | 9862841 |
| 880 | 3002999400 | 3002998708 | Bacteria | 11715108 |
| 881 | 8008565007 | 8008558824 | Bacteria | 10610750 |
| 882 | 8054474548 | 8054472261 | Bacteria | 7464355 |
| 883 | JGI24738J21930_10002594 | |||
| 884 | JGI24738J21930_10007244 | |||
| 885 | JGI24744J21845_10000361 | |||
| 886 | JGI25406J46586_10001317 | |||
| 887 | Ga0070658_10149849 | |||
| 888 | Ga0070683_100004234 | |||
| 889 | Ga0070683_100012321 | |||
| 890 | Ga0070683_100039924 | |||
| 891 | Ga0070683_100040738 | |||
| 892 | Ga0070683_100060608 | |||
| 893 | Ga0070683_100129725 | |||
| 894 | Ga0070683_100177975 | |||
| 895 | Ga0070670_100011377 | |||
| 896 | Ga0068869_100000672 | |||
| 897 | Ga0068869_100035330 | |||
| 898 | Ga0070680_100000135 | |||
| 899 | Ga0070680_100005054 | |||
| 900 | Ga0070680_100030659 | |||
| 901 | Ga0070680_100061964 | |||
| 902 | Ga0070680_100080356 | |||
| 903 | Ga0070682_100001129 | |||
| 904 | Ga0070682_100006989 | |||
| 905 | Ga0070682_100021497 | |||
| 906 | Ga0068868_100007548 | |||
| 907 | Ga0068868_100034361 | |||
| 908 | Ga0068868_100105593 | |||
| 909 | Ga0068868_100117303 | |||
| 910 | Ga0070660_100009909 | |||
| 911 | Ga0070689_100004510 | |||
| 912 | Ga0070689_100102416 | |||
| 913 | Ga0070687_100021220 | |||
| 914 | Ga0070661_100101541 | |||
| 915 | Ga0070692_10001374 | |||
| 916 | Ga0070692_10005242 | |||
| 917 | Ga0070671_100005326 | |||
| 918 | Ga0070671_100012639 | |||
| 919 | Ga0070674_100005664 | |||
| 920 | Ga0070673_100024595 | |||
| 921 | Ga0070659_100013914 | |||
| 922 | Ga0070659_100049618 | |||
| 923 | Ga0070659_100049664 | |||
| 924 | Ga0070709_10005337 | |||
| 925 | Ga0070709_10022372 | |||
| 926 | Ga0070714_100000974 | |||
| 927 | Ga0070714_100002168 | |||
| 928 | Ga0070714_100002616 | |||
| 929 | Ga0070714_100007815 | |||
| 930 | Ga0070714_100013040 | |||
| 931 | Ga0070714_100017478 | |||
| 932 | Ga0070714_100046678 | |||
| 933 | Ga0070714_100068894 | |||
| 934 | Ga0070714_100101202 | |||
| 935 | Ga0070713_100003754 | |||
| 936 | Ga0070713_100023202 | |||
| 937 | Ga0070713_100029057 | |||
| 938 | Ga0070713_100041203 | |||
| 939 | Ga0070713_100061707 | |||
| 940 | Ga0070713_100085957 | |||
| 941 | Ga0070710_10007083 | |||
| 942 | Ga0070710_10020055 | |||
| 943 | Ga0070710_10032808 | |||
| 944 | Ga0070701_10005335 | |||
| 945 | Ga0070701_10013604 | |||
| 946 | Ga0070701_10023749 | |||
| 947 | Ga0070711_100007610 | |||
| 948 | Ga0070711_100020370 | |||
| 949 | Ga0070711_100042360 | |||
| 950 | Ga0070711_100071560 | |||
| 951 | Ga0070700_100004148 | |||
| 952 | Ga0070700_100007174 | |||
| 953 | Ga0070700_100012601 | |||
| 954 | Ga0070700_100021607 | |||
| 955 | Ga0070694_100006385 | |||
| 956 | Ga0070663_100029447 | |||
| 957 | Ga0070663_100029835 | |||
| 958 | Ga0070678_100003700 | |||
| 959 | Ga0070662_100017767 | |||
| 960 | Ga0070681_10000020 | |||
| 961 | Ga0070681_10026083 | |||
| 962 | Ga0070681_10032436 | |||
| 963 | Ga0070681_10036883 | |||
| 964 | Ga0070681_10055574 | |||
| 965 | Ga0068867_100019015 | |||
| 966 | Ga0068867_100021874 | |||
| 967 | Ga0068867_100044464 | |||
| 968 | Ga0070685_10002662 | |||
| 969 | Ga0070706_100004208 | |||
| 970 | Ga0070706_100012140 | |||
| 971 | Ga0070707_100012396 | |||
| 972 | Ga0070707_100080485 | |||
| 973 | Ga0070698_100104833 | |||
| 974 | Ga0070699_100002823 | |||
| 975 | Ga0070679_100000044 | |||
| 976 | Ga0070679_100033742 | |||
| 977 | Ga0070679_100037668 | |||
| 978 | Ga0070679_100085799 | |||
| 979 | Ga0070679_100102225 | |||
| 980 | Ga0070679_100167816 | |||
| 981 | Ga0070684_100000622 | |||
| 982 | Ga0070684_100020042 | |||
| 983 | Ga0070684_100022148 | |||
| 984 | Ga0070684_100037755 | |||
| 985 | Ga0070684_100049238 | |||
| 986 | Ga0070684_100055477 | |||
| 987 | Ga0070697_100005200 | |||
| 988 | Ga0070672_100039743 | |||
| 989 | Ga0070672_100072106 | |||
| 990 | Ga0070672_100120348 | |||
| 991 | Ga0070686_100122995 | |||
| 992 | Ga0070693_100010163 | |||
| 993 | Ga0070693_100060028 | |||
| 994 | Ga0070665_100012542 | |||
| 995 | Ga0070665_100042412 | |||
| 996 | Ga0070665_100062706 | |||
| 997 | Ga0070665_100126293 | |||
| 998 | Ga0068855_100002117 | |||
| 999 | Ga0068855_100005045 | |||
| 1000 | Ga0068855_100181217 | |||
| 1001 | Ga0070664_100034953 | |||
| 1002 | Ga0070664_100054431 | |||
| 1003 | Ga0068857_100005707 | |||
| 1004 | Ga0068857_100022308 | |||
| 1005 | Ga0068857_100140635 | |||
| 1006 | Ga0068854_100002147 | |||
| 1007 | Ga0068856_100006035 | |||
| 1008 | Ga0068856_100013804 | |||
| 1009 | Ga0068856_100076180 | |||
| 1010 | Ga0068856_100136322 | |||
| 1011 | Ga0070702_100005662 | |||
| 1012 | Ga0070702_100009743 | |||
| 1013 | Ga0070702_100059838 | |||
| 1014 | Ga0070702_100092737 | |||
| 1015 | Ga0068852_100005875 | |||
| 1016 | Ga0068852_100009233 | |||
| 1017 | Ga0068852_100037992 | |||
| 1018 | Ga0068852_100084755 | |||
| 1019 | Ga0068852_100110271 | |||
| 1020 | Ga0068859_100046929 | |||
| 1021 | Ga0068859_100082194 | |||
| 1022 | Ga0068864_100003975 | |||
| 1023 | Ga0068866_10025248 | |||
| 1024 | Ga0068861_100002408 | |||
| 1025 | Ga0068851_10012207 | |||
| 1026 | Ga0068851_10020541 | |||
| 1027 | Ga0068870_10003481 | |||
| 1028 | Ga0068863_100006471 | |||
| 1029 | Ga0068863_100081257 | |||
| 1030 | Ga0068858_100068777 | |||
| 1031 | Ga0068860_100045967 | |||
| 1032 | Ga0081455_10000123 | |||
| 1033 | Ga0081455_10001506 | |||
| 1034 | Ga0081539_10000919 | |||
| 1035 | Ga0070717_10011176 | |||
| 1036 | Ga0070717_10013777 | |||
| 1037 | Ga0070717_10025313 | |||
| 1038 | Ga0070717_10041275 | |||
| 1039 | Ga0070717_10047747 | |||
| 1040 | Ga0070717_10084741 | |||
| 1041 | Ga0075365_10013836 | |||
| 1042 | Ga0075368_10006845 | |||
| 1043 | Ga0075363_100025841 | |||
| 1044 | Ga0070715_10001284 | |||
| 1045 | Ga0070716_100004409 | |||
| 1046 | Ga0070716_100012672 | |||
| 1047 | Ga0070716_100046609 | |||
| 1048 | Ga0070716_100074208 | |||
| 1049 | Ga0070712_100012909 | |||
| 1050 | Ga0070712_100017813 | |||
| 1051 | Ga0070712_100031738 | |||
| 1052 | Ga0070712_100042643 | |||
| 1053 | Ga0070712_100046323 | |||
| 1054 | Ga0070712_100055682 | |||
| 1055 | Ga0097621_100007462 | |||
| 1056 | Ga0097621_100117148 | |||
| 1057 | Ga0068871_100009216 | |||
| 1058 | Ga0068871_100075614 | |||
| 1059 | Ga0075428_100134410 | |||
| 1060 | Ga0075428_100167834 | |||
| 1061 | Ga0075431_100025422 | |||
| 1062 | Ga0075431_100085037 | |||
| 1063 | Ga0075431_100097074 | |||
| 1064 | Ga0075433_10011613 | |||
| 1065 | Ga0075433_10024336 | |||
| 1066 | Ga0075433_10025055 | |||
| 1067 | Ga0075433_10038978 | |||
| 1068 | Ga0075433_10105672 | |||
| 1069 | Ga0075434_100012332 | |||
| 1070 | Ga0075434_100026109 | |||
| 1071 | Ga0075434_100084553 | |||
| 1072 | Ga0075434_100119422 | |||
| 1073 | Ga0075434_100180303 | |||
| 1074 | Ga0075429_100047159 | |||
| 1075 | Ga0075429_100082607 | |||
| 1076 | Ga0068865_100003709 | |||
| 1077 | Ga0068865_100031231 | |||
| 1078 | Ga0068865_100066120 | |||
| 1079 | Ga0075436_100010143 | |||
| 1080 | Ga0075436_100017185 | |||
| 1081 | Ga0075436_100049588 | |||
| 1082 | Ga0097620_100046929 | |||
| 1083 | Ga0097620_100082193 | |||
| 1084 | Ga0075435_100000523 | |||
| 1085 | Ga0075435_100005298 | |||
| 1086 | Ga0075435_100058051 | |||
| 1087 | Ga0105251_10016259 | |||
| 1088 | Ga0105240_10015709 | |||
| 1089 | Ga0105240_10072227 | |||
| 1090 | Ga0105240_10094129 | |||
| 1091 | Ga0105240_10114985 | |||
| 1092 | Ga0111539_10019426 | |||
| 1093 | Ga0111539_10148357 | |||
| 1094 | Ga0111539_10178312 | |||
| 1095 | Ga0111539_10234046 | |||
| 1096 | Ga0105245_10005589 | |||
| 1097 | Ga0105245_10011825 | |||
| 1098 | Ga0105245_10036074 | |||
| 1099 | Ga0105245_10125346 | |||
| 1100 | Ga0105247_10009645 | |||
| 1101 | Ga0105247_10039178 | |||
| 1102 | Ga0114129_10015764 | |||
| 1103 | Ga0114129_10040454 | |||
| 1104 | Ga0114129_10046739 | |||
| 1105 | Ga0114129_10055068 | |||
| 1106 | Ga0114129_10314640 | |||
| 1107 | Ga0105243_10002387 | |||
| 1108 | Ga0105243_10009903 | |||
| 1109 | Ga0105243_10094380 | |||
| 1110 | Ga0105241_10001988 | |||
| 1111 | Ga0105241_10005381 | |||
| 1112 | Ga0105241_10019360 | |||
| 1113 | Ga0105242_10027713 | |||
| 1114 | Ga0105248_10067072 | |||
| 1115 | Ga0105248_10068314 | |||
| 1116 | Ga0105237_10008550 | |||
| 1117 | Ga0105237_10021863 | |||
| 1118 | Ga0105238_10004485 | |||
| 1119 | Ga0105238_10013378 | |||
| 1120 | Ga0105238_10015810 | |||
| 1121 | Ga0105238_10030996 | |||
| 1122 | Ga0105238_10044458 | |||
| 1123 | Ga0105249_10008050 | |||
| 1124 | Ga0105249_10010209 | |||
| 1125 | Ga0105249_10036681 | |||
| 1126 | Ga0105249_10046632 | |||
| 1127 | Ga0105249_10055325 | |||
| 1128 | Ga0105239_10028892 | |||
| 1129 | Ga0105239_10032423 | |||
| 1130 | Ga0105239_10041232 | |||
| 1131 | Ga0105239_10054291 | |||
| 1132 | Ga0105239_10081713 | |||
| 1133 | Ga0105246_10002583 | |||
| 1134 | Ga0105246_10010935 | |||
| 1135 | Ga0105246_10017620 | |||
| 1136 | Ga0105246_10038000 | |||
| 1137 | Ga0105246_10050252 | |||
| 1138 | Ga0105246_10050500 | |||
| 1139 | Ga0157373_10047373 | |||
| 1140 | Ga0157369_10001889 | |||
| 1141 | Ga0157369_10011108 | |||
| 1142 | Ga0157369_10018141 | |||
| 1143 | Ga0157369_10157007 | |||
| 1144 | Ga0157369_10250643 | |||
| 1145 | Ga0157374_10008821 | |||
| 1146 | Ga0157374_10040301 | |||
| 1147 | Ga0157374_10094403 | |||
| 1148 | Ga0163162_10033665 | |||
| 1149 | Ga0163162_10068450 | |||
| 1150 | Ga0157372_10017094 | |||
| 1151 | Ga0157372_10077393 | |||
| 1152 | Ga0157372_10112101 | |||
| 1153 | Ga0157372_10129147 | |||
| 1154 | Ga0157372_10209447 | |||
| 1155 | Ga0157375_10030166 | |||
| 1156 | Ga0157375_10042902 | |||
| 1157 | Ga0157375_10134302 | |||
| 1158 | Ga0163163_10009952 | |||
| 1159 | Ga0163163_10061935 | |||
| 1160 | Ga0163163_10115834 | |||
| 1161 | Ga0157380_10009185 | |||
| 1162 | Ga0157380_10038542 | |||
| 1163 | Ga0182008_10025926 | |||
| 1164 | Ga0157377_10009848 | |||
| 1165 | Ga0157377_10010375 | |||
| 1166 | Ga0157377_10014394 | |||
| 1167 | Ga0157376_10017650 | |||
| 1168 | Ga0157376_10022075 | |||
| 1169 | Ga0206353_11878011 | |||
| 1170 | Ga0224712_10025006 | |||
| 1171 | Ga0224572_1002365 | |||
| 1172 | Ga0207656_10012516 | |||
| 1173 | Ga0207656_10021898 | |||
| 1174 | Ga0207692_10006172 | |||
| 1175 | Ga0207692_10042480 | |||
| 1176 | Ga0207642_10012998 | |||
| 1177 | Ga0207710_10006639 | |||
| 1178 | Ga0207688_10000213 | |||
| 1179 | Ga0207688_10002494 | |||
| 1180 | Ga0207688_10044282 | |||
| 1181 | Ga0207647_10005252 | |||
| 1182 | Ga0207699_10000619 | |||
| 1183 | Ga0207699_10001901 | |||
| 1184 | Ga0207699_10004489 | |||
| 1185 | Ga0207699_10004492 | |||
| 1186 | Ga0207645_10044425 | |||
| 1187 | Ga0207643_10000218 | |||
| 1188 | Ga0207643_10007267 | |||
| 1189 | Ga0207643_10007735 | |||
| 1190 | Ga0207705_10037063 | |||
| 1191 | Ga0207684_10001508 | |||
| 1192 | Ga0207684_10005740 | |||
| 1193 | Ga0207654_10003770 | |||
| 1194 | Ga0207707_10000090 | |||
| 1195 | Ga0207707_10007781 | |||
| 1196 | Ga0207707_10035007 | |||
| 1197 | Ga0207695_10002866 | |||
| 1198 | Ga0207671_10003461 | |||
| 1199 | Ga0207671_10035151 | |||
| 1200 | Ga0207693_10010102 | |||
| 1201 | Ga0207693_10027829 | |||
| 1202 | Ga0207693_10081784 | |||
| 1203 | Ga0207663_10035938 | |||
| 1204 | Ga0207663_10122751 | |||
| 1205 | Ga0207660_10000219 | |||
| 1206 | Ga0207660_10043409 | |||
| 1207 | Ga0207660_10059241 | |||
| 1208 | Ga0207662_10016436 | |||
| 1209 | Ga0207657_10008572 | |||
| 1210 | Ga0207657_10010945 | |||
| 1211 | Ga0207657_10013651 | |||
| 1212 | Ga0207657_10102038 | |||
| 1213 | Ga0207649_10007987 | |||
| 1214 | Ga0207652_10000485 | |||
| 1215 | Ga0207652_10016208 | |||
| 1216 | Ga0207646_10012024 | |||
| 1217 | Ga0207694_10000843 | |||
| 1218 | Ga0207694_10114250 | |||
| 1219 | Ga0207650_10009927 | |||
| 1220 | Ga0207687_10000842 | |||
| 1221 | Ga0207687_10031812 | |||
| 1222 | Ga0207700_10004656 | |||
| 1223 | Ga0207700_10008259 | |||
| 1224 | Ga0207700_10011992 | |||
| 1225 | Ga0207700_10024576 | |||
| 1226 | Ga0207700_10025233 | |||
| 1227 | Ga0207700_10035520 | |||
| 1228 | Ga0207700_10048897 | |||
| 1229 | Ga0207700_10058256 | |||
| 1230 | Ga0207700_10066774 | |||
| 1231 | Ga0207700_10072356 | |||
| 1232 | Ga0207664_10003669 | |||
| 1233 | Ga0207664_10003919 | |||
| 1234 | Ga0207664_10004524 | |||
| 1235 | Ga0207664_10010352 | |||
| 1236 | Ga0207664_10017382 | |||
| 1237 | Ga0207664_10025480 | |||
| 1238 | Ga0207664_10026630 | |||
| 1239 | Ga0207664_10039346 | |||
| 1240 | Ga0207644_10008003 | |||
| 1241 | Ga0207644_10012375 | |||
| 1242 | Ga0207690_10004202 | |||
| 1243 | Ga0207690_10090184 | |||
| 1244 | Ga0207706_10076573 | |||
| 1245 | Ga0207706_10106804 | |||
| 1246 | Ga0207709_10008686 | |||
| 1247 | Ga0207709_10029106 | |||
| 1248 | Ga0207670_10097738 | |||
| 1249 | Ga0207669_10105408 | |||
| 1250 | Ga0207704_10056512 | |||
| 1251 | Ga0207665_10000412 | |||
| 1252 | Ga0207665_10004021 | |||
| 1253 | Ga0207665_10008637 | |||
| 1254 | Ga0207665_10023651 | |||
| 1255 | Ga0207691_10013198 | |||
| 1256 | Ga0207691_10022500 | |||
| 1257 | Ga0207691_10107485 | |||
| 1258 | Ga0207689_10002593 | |||
| 1259 | Ga0207689_10029825 | |||
| 1260 | Ga0207661_10002657 | |||
| 1261 | Ga0207661_10006624 | |||
| 1262 | Ga0207661_10044306 | |||
| 1263 | Ga0207661_10065827 | |||
| 1264 | Ga0207661_10088523 | |||
| 1265 | Ga0207661_10133799 | |||
| 1266 | Ga0207679_10010995 | |||
| 1267 | Ga0207679_10060091 | |||
| 1268 | Ga0207679_10106384 | |||
| 1269 | Ga0207667_10004602 | |||
| 1270 | Ga0207667_10015537 | |||
| 1271 | Ga0207651_10118895 | |||
| 1272 | Ga0207651_10121339 | |||
| 1273 | Ga0207668_10017830 | |||
| 1274 | Ga0207640_10004012 | |||
| 1275 | Ga0207677_10004443 | |||
| 1276 | Ga0207677_10029647 | |||
| 1277 | Ga0207677_10062601 | |||
| 1278 | Ga0207677_10081446 | |||
| 1279 | Ga0207703_10123776 | |||
| 1280 | Ga0207639_10057038 | |||
| 1281 | Ga0207639_10057387 | |||
| 1282 | Ga0207678_10011871 | |||
| 1283 | Ga0207678_10078529 | |||
| 1284 | Ga0207678_10096187 | |||
| 1285 | Ga0207708_10000985 | |||
| 1286 | Ga0207708_10002530 | |||
| 1287 | Ga0207708_10006019 | |||
| 1288 | Ga0207708_10032889 | |||
| 1289 | Ga0207708_10033380 | |||
| 1290 | Ga0207708_10045044 | |||
| 1291 | Ga0207708_10071096 | |||
| 1292 | Ga0207702_10002437 | |||
| 1293 | Ga0207702_10009971 | |||
| 1294 | Ga0207702_10114614 | |||
| 1295 | Ga0207648_10001308 | |||
| 1296 | Ga0207648_10004509 | |||
| 1297 | Ga0207648_10017309 | |||
| 1298 | Ga0207648_10029778 | |||
| 1299 | Ga0207676_10003391 | |||
| 1300 | Ga0207676_10016826 | |||
| 1301 | Ga0207676_10033378 | |||
| 1302 | Ga0207674_10000093 | |||
| 1303 | Ga0207674_10014208 | |||
| 1304 | Ga0207674_10017738 | |||
| 1305 | Ga0207674_10084964 | |||
| 1306 | Ga0207674_10107503 | |||
| 1307 | Ga0207675_100003463 | |||
| 1308 | Ga0207683_10000454 | |||
| 1309 | Ga0207683_10009054 | |||
| 1310 | Ga0207683_10106699 | |||
| 1311 | Ga0207683_10154855 | |||
| 1312 | Ga0207698_10004756 | |||
| 1313 | Ga0207698_10046821 | |||
| 1314 | Ga0207428_10115835 | |||
| 1315 | Ga0207428_10133363 | |||
| 1316 | Ga0268266_10054809 | |||
| 1317 | Ga0268266_10094610 | |||
| 1318 | Ga0268265_10108993 | |||
| 1319 | Ga0268265_10122970 | |||
| 1320 | Ga0268264_10039541 | |||
| 1321 | Ga0307513_10019341 | |||
| 1322 | Ga0307406_10076400 | |||
| 1323 | Ga0307409_100027270 | |||
| 1324 | Ga0307416_100005109 | |||
| 1325 | Ga0307416_100090392 | |||
| 1326 | Ga0307416_100114158 | |||
| 1327 | Ga0307411_10016550 | |||
| 1328 | Ga0307415_100037871 | |||
| 1329 | Ga0373926_0001583 | |||
| 1330 | Ga0373934_0001615 | |||
| 1331 | Ga0373944_0001827 | |||
| 1332 | Ga0373936_0003892 | |||
| 1333 | Ga0373945_0000591 | |||
| 1334 | Ga0373953_0009920 | |||
| 1335 | Ga0373954_0042125 | |||
| 1336 | Ga0373956_0001004 | |||
| 1337 | Ga0373957_0008506 | |||
| 1338 | Ga0373957_0019408 | |||
| 1339 | Ga0373943_0001628 | |||
| 1340 | Ga0373955_0000005 | |||
| 1341 | Ga0373924_0008586 | |||
| 1342 | Ga0373927_0016122 | |||
| 1343 | Ga0373927_0019496 | |||
| 1344 | Ga0373933_0000043 | |||
| 1345 | Ga0373933_0022557 | |||
| 1346 | Ga0373933_0039045 | |||
| 1347 | Ga0373933_0049229 | |||
| 1348 | Ga0373933_0081560 | |||
| 1349 | Ga0373947_0004411 | |||
| 1350 | Ga0373947_0019417 | |||
| 1351 | Ga0373937_0000245 | |||
| 1352 | Ga0373937_0003783 | |||
| 1353 | Ga0373937_0040151 | |||
| 1354 | Ga0373937_0063250 | |||
| 1355 | Ga0373937_0063513 | |||
| 1356 | Ga0373937_0084052 | |||
| 1357 | Ga0373937_0096125 | |||
| 1358 | Ga0373937_0179693 | |||
| 1359 | Ga0373925_0000028 | |||
| 1360 | Ga0373925_0001494 | |||
| 1361 | Ga0373925_0001915 | |||
| 1362 | Ga0373925_0007560 | |||
| 1363 | Ga0373925_0109962 | |||
| 1364 | Ga0395900_0143787 | |||
| 1365 | Ga0395898_0179084 | |||
| 1366 | Ga0395905_0059024 | |||
| 1367 | Ga0451853_0174584 | |||
| 1368 | Ga0451853_2073262 | |||
| 1369 | Ga0439448_0007867 | |||
| 1370 | Ga0439448_0008553 | |||
| 1371 | Ga0439463_002716 | |||
| 1372 | Ga0450902_007704 | |||
| 1373 | Ga0439458_0008012 | |||
| 1374 | Ga0439458_0008711 | |||
| 1375 | Ga0439460_0018107 | |||
| 1376 | Ga0466963_0001267 | |||
| 1377 | Ga0466970_0012932 | |||
| 1378 | Ga0466959_0070396 | |||
| 1379 | Ga0466967_0004137 | |||
| 1380 | Ga0466967_0007021 | |||
| 1381 | Ga0466967_0101822 | |||
| 1382 | Ga0495592_0000092 | |||
| 1383 | Ga0495592_0011277 | |||
| 1384 | Ga0495592_0033973 | |||
| 1385 | Ga0495592_0097787 | |||
| 1386 | Ga0495629_0001088 | |||
| 1387 | Ga0495629_0001429 | |||
| 1388 | Ga0495629_0014399 | |||
| 1389 | Ga0495641_0001952 | |||
| 1390 | Ga0495641_0022859 | |||
| 1391 | Ga0495651_0000066 | |||
| 1392 | Ga0495651_0001498 | |||
| 1393 | Ga0495651_0003513 | |||
| 1394 | Ga0495651_0010231 | |||
| 1395 | Ga0495651_0011712 | |||
| 1396 | Ga0495651_0018918 | |||
| 1397 | Ga0495651_0019855 | |||
| 1398 | Ga0495651_0058460 | |||
| 1399 | Ga0495653_0002166 | |||
| 1400 | Ga0495653_0003794 | |||
| 1401 | Ga0495653_0004422 | |||
| 1402 | Ga0495653_0008124 | |||
| 1403 | Ga0495653_0012547 | |||
| 1404 | Ga0495653_0036173 | |||
| 1405 | Ga0495653_0099119 | |||
| 1406 | Ga0495580_0015030 | |||
| 1407 | Ga0495582_0000078 | |||
| 1408 | Ga0495582_0000338 | |||
| 1409 | Ga0495582_0001399 | |||
| 1410 | Ga0495582_0002910 | |||
| 1411 | Ga0495639_0003784 | |||
| 1412 | Ga0495639_0030093 | |||
| 1413 | Ga0495662_0008850 | |||
| 1414 | Ga0495662_0012129 | |||
| 1415 | Ga0495594_0017675 | |||
| 1416 | Ga0495594_0032192 | |||
| 1417 | Ga0495608_0000070 | |||
| 1418 | Ga0495608_0007499 | |||
| 1419 | Ga0495608_0043756 | |||
| 1420 | Ga0495608_0044263 | |||
| 1421 | Ga0495608_0065762 | |||
| 1422 | Ga0495618_0034995 | |||
| 1423 | Ga0495618_0073762 | |||
| 1424 | Ga0495618_0091766 | |||
| 1425 | Ga0495628_0000624 | |||
| 1426 | Ga0495628_0003918 | |||
| 1427 | Ga0495628_0013221 | |||
| 1428 | Ga0495628_0021322 | |||
| 1429 | Ga0495628_0027893 | |||
| 1430 | Ga0495628_0052056 | |||
| 1431 | Ga0495628_0094001 | |||
| 1432 | Ga0495628_0112248 | |||
| 1433 | Ga0495630_0018348 | |||
| 1434 | Ga0495630_0027780 | |||
| 1435 | Ga0495652_0000679 | |||
| 1436 | Ga0495652_0000769 | |||
| 1437 | Ga0495652_0009984 | |||
| 1438 | Ga0495652_0013266 | |||
| 1439 | Ga0495652_0016891 | |||
| 1440 | Ga0495652_0051756 | |||
| 1441 | Ga0495652_0090925 | |||
| 1442 | Ga0495665_0001371 | |||
| 1443 | Ga0495665_0006507 | |||
| 1444 | Ga0495665_0011482 | |||
| 1445 | Ga0495665_0021638 | |||
| 1446 | Ga0495640_0013066 | |||
| 1447 | Ga0495640_0023414 | |||
| 1448 | Ga0495640_0034424 | |||
| 1449 | Ga0495640_0047829 | |||
| 1450 | Ga0495587_0000077 | |||
| 1451 | Ga0495587_0004198 | |||
| 1452 | Ga0495587_0014003 | |||
| 1453 | Ga0495587_0056171 | |||
| 1454 | Ga0495587_0068029 | |||
| 1455 | Ga0495621_0000572 | |||
| 1456 | Ga0495645_0064304 | |||
| 1457 | Ga0495645_0078985 | |||
| 1458 | Ga0495645_0084253 | |||
| 1459 | Ga0495667_0000071 | |||
| 1460 | Ga0495667_0002937 | |||
| 1461 | Ga0495667_0005115 | |||
| 1462 | Ga0495667_0006824 | |||
| 1463 | Ga0495667_0013560 | |||
| 1464 | Ga0495667_0030210 | |||
| 1465 | Ga0495667_0036047 | |||
| 1466 | Ga0495667_0048750 | |||
| 1467 | Ga0495634_0011952 | |||
| 1468 | Ga0495634_0019468 | |||
| 1469 | Ga0495634_0031304 | |||
| 1470 | Ga0495634_0031861 | |||
| 1471 | Ga0495634_0074759 | |||
| 1472 | Ga0495635_0009283 | |||
| 1473 | Ga0495635_0012304 | |||
| 1474 | Ga0495635_0017230 | |||
| 1475 | Ga0495635_0018757 | |||
| 1476 | Ga0495635_0023243 | |||
| 1477 | Ga0495588_0004695 | |||
| 1478 | Ga0495588_0022616 | |||
| 1479 | Ga0495657_0000095 | |||
| 1480 | Ga0495657_0003888 | |||
| 1481 | Ga0495657_0005793 | |||
| 1482 | Ga0495657_0008653 | |||
| 1483 | Ga0495599_0000155 | |||
| 1484 | Ga0495599_0007643 | |||
| 1485 | Ga0495599_0086353 | |||
| 1486 | Ga0495599_0104857 | |||
| 1487 | Ga0495623_0001673 | |||
| 1488 | Ga0495623_0015929 | |||
| 1489 | Ga0495623_0019635 | |||
| 1490 | Ga0495646_0009024 | |||
| 1491 | Ga0495646_0032465 | |||
| 1492 | Ga0495647_0014609 | |||
| 1493 | Ga0495647_0015267 | |||
| 1494 | Ga0495658_0000236 | |||
| 1495 | Ga0495658_0000726 | |||
| 1496 | Ga0495658_0008286 | |||
| 1497 | Ga0495613_0000207 | |||
| 1498 | Ga0495613_0004518 | |||
| 1499 | Ga0495613_0018030 | |||
| 1500 | Ga0495613_0091729 | |||
| 1501 | Ga0495624_0002604 | |||
| 1502 | Ga0495624_0020231 | |||
| 1503 | Ga0495624_0025322 | |||
| 1504 | Ga0495600_0001750 | |||
| 1505 | Ga0495600_0013426 | |||
| 1506 | Ga0495600_0017470 | |||
| 1507 | Ga0495600_0023354 | |||
| 1508 | Ga0495600_0025724 | |||
| 1509 | Ga0495600_0037480 | |||
| 1510 | Ga0495600_0044659 | |||
| 1511 | Ga0495581_0001112 | |||
| 1512 | Ga0495581_0001409 | |||
| 1513 | Ga0495581_0011427 | |||
| 1514 | Ga0495581_0037896 | |||
| 1515 | Ga0495604_0000087 | |||
| 1516 | Ga0495604_0001649 | |||
| 1517 | Ga0495604_0046959 | |||
| 1518 | Ga0495604_0052269 | |||
| 1519 | Ga0495674_0010613 | |||
| 1520 | Ga0495674_0040756 | |||
| 1521 | Ga0495674_0060103 | |||
| 1522 | Ga0495674_0074405 | |||
| 1523 | Ga0495674_0077342 | |||
| 1524 | Ga0495676_0011573 | |||
| 1525 | Ga0495676_0020754 | |||
| 1526 | Ga0495676_0083124 | |||
| 1527 | Ga0495680_0002287 | |||
| 1528 | Ga0495680_0003033 | |||
| 1529 | Ga0495680_0006516 | |||
| 1530 | Ga0495680_0006570 | |||
| 1531 | Ga0495680_0006733 | |||
| 1532 | Ga0495680_0012893 | |||
| 1533 | Ga0495680_0020012 | |||
| 1534 | Ga0495680_0027766 | |||
| 1535 | Ga0495680_0039139 | |||
| 1536 | Ga0495680_0055223 | |||
| 1537 | Ga0495680_0086991 | |||
| 1538 | Ga0495680_0126468 | |||
| 1539 | Ga0495675_0000157 | |||
| 1540 | Ga0495675_0001850 | |||
| 1541 | Ga0495675_0003497 | |||
| 1542 | Ga0495675_0009503 | |||
| 1543 | Ga0495675_0033710 | |||
| 1544 | Ga0495684_0003809 | |||
| 1545 | Ga0495684_0018295 | |||
| 1546 | Ga0495684_0050461 | |||
| 1547 | Ga0495684_0056981 | |||
| 1548 | Ga0495684_0058330 | |||
| 1549 | Ga0495684_0059009 | |||
| 1550 | Ga0495593_0011846 | |||
| 1551 | Ga0495593_0057053 | |||
| 1552 | Ga0495602_0000461 | |||
| 1553 | Ga0495602_0017632 | |||
| 1554 | Ga0496101_0002239 | |||
| 1555 | Ga0496101_0002703 | |||
| 1556 | Ga0496102_0006157 | |||
| 1557 | Ga0496102_0006613 | |||
| 1558 | Ga0496102_0013799 | |||
| 1559 | Ga0496102_0020367 | |||
| 1560 | Ga0496102_0079312 | |||
| 1561 | Ga0496102_0082024 | |||
| 1562 | Ga0496102_0107632 | |||
| 1563 | Ga0496103_0002293 | |||
| 1564 | Ga0496103_0053099 | |||
| 1565 | Ga0496103_0088633 | |||
| 1566 | Ga0496104_0012420 | |||
| 1567 | Ga0496104_0017300 | |||
| 1568 | Ga0496104_0019218 | |||
| 1569 | Ga0496104_0071383 | |||
| 1570 | Ga0496104_0071625 | |||
| 1571 | Ga0496104_0110864 | |||
| 1572 | Ga0496104_0205506 | |||
| 1573 | Ga0496105_0000756 | |||
| 1574 | Ga0496105_0002305 | |||
| 1575 | Ga0496105_0016330 | |||
| 1576 | Ga0496105_0060205 | |||
| 1577 | Ga0496105_0072332 | |||
| 1578 | Ga0496105_0085683 | |||
| 1579 | Ga0496105_0103220 | |||
| 1580 | Ga0496106_0003648 | |||
| 1581 | Ga0496106_0019313 | |||
| 1582 | Ga0496107_0005385 | |||
| 1583 | Ga0496107_0009138 | |||
| 1584 | Ga0496107_0051083 | |||
| 1585 | Ga0496108_0000337 | |||
| 1586 | Ga0496108_0012789 | |||
| 1587 | Ga0496108_0015456 | |||
| 1588 | Ga0496108_0030880 | |||
| 1589 | Ga0496108_0034247 | |||
| 1590 | Ga0496108_0038524 | |||
| 1591 | Ga0496108_0050752 | |||
| 1592 | Ga0496108_0065856 | |||
| 1593 | Ga0496108_0082633 | |||
| 1594 | Ga0496108_0082690 | |||
| 1595 | Ga0496108_0088572 | |||
| 1596 | Ga0496108_0089272 | |||
| 1597 | Ga0496109_0004142 | |||
| 1598 | Ga0496109_0005796 | |||
| 1599 | Ga0496109_0027124 | |||
| 1600 | Ga0496109_0035131 | |||
| 1601 | Ga0496109_0054063 | |||
| 1602 | Ga0496109_0058506 | |||
| 1603 | Ga0496109_0081171 | |||
| 1604 | Ga0496109_0095421 | |||
| 1605 | Ga0496109_0102338 | |||
| 1606 | Ga0496109_0108886 | |||
| 1607 | Ga0496110_0000249 | |||
| 1608 | Ga0496110_0021412 | |||
| 1609 | Ga0496110_0036269 | |||
| 1610 | Ga0496110_0038608 | |||
| 1611 | Ga0496110_0048234 | |||
| 1612 | Ga0496110_0070893 | |||
| 1613 | Ga0496110_0075476 | |||
| 1614 | Ga0496110_0099095 | |||
| 1615 | Ga0496110_0107222 | |||
| 1616 | Ga0496111_0003049 | |||
| 1617 | Ga0496111_0022383 | |||
| 1618 | Ga0496111_0071066 | |||
| 1619 | Ga0496111_0094521 | |||
| 1620 | Ga0496112_0000620 | |||
| 1621 | Ga0496112_0002834 | |||
| 1622 | Ga0496112_0008758 | |||
| 1623 | Ga0496112_0010866 | |||
| 1624 | Ga0496112_0016419 | |||
| 1625 | Ga0496112_0115326 | |||
| 1626 | Ga0496113_0050528 | |||
| 1627 | Ga0496113_0080845 | |||
| 1628 | Ga0496114_0020614 | |||
| 1629 | Ga0496114_0024825 | |||
| 1630 | Ga0496114_0030283 | |||
| 1631 | Ga0496114_0056320 | |||
| 1632 | Ga0496114_0100339 | |||
| 1633 | Ga0496114_0204919 | |||
| 1634 | Ga0496115_0004134 | |||
| 1635 | Ga0496115_0008063 | |||
| 1636 | Ga0496115_0029753 | |||
| 1637 | Ga0496115_0072365 | |||
| 1638 | Ga0496121_0002166 | |||
| 1639 | Ga0496126_0019805 | |||
| 1640 | Ga0496126_0174840 | |||
| 1641 | Ga0501031_0006295 | |||
| 1642 | Ga0501031_0027487 | |||
| 1643 | Ga0501031_0032255 | |||
| 1644 | Ga0501032_0002022 | |||
| 1645 | Ga0501033_0011445 | |||
| 1646 | Ga0501033_0013928 | |||
| 1647 | Ga0501034_0004204 | |||
| 1648 | Ga0501034_0062091 | |||
| 1649 | Ga0501036_0000582 | |||
| 1650 | Ga0501036_0106033 | |||
| 1651 | Ga0501037_0021309 | |||
| 1652 | Ga0501037_0072555 | |||
| 1653 | Ga0501038_0000732 | |||
| 1654 | Ga0501038_0038074 | |||
| 1655 | Ga0501039_0000391 | |||
| 1656 | Ga0501039_0049987 | |||
| 1657 | Ga0501040_0000516 | |||
| 1658 | Ga0501040_0005371 | |||
| 1659 | Ga0501040_0009161 | |||
| 1660 | Ga0501040_0021756 | |||
| 1661 | Ga0501041_0004140 | |||
| 1662 | Ga0501041_0039901 | |||
| 1663 | Ga0501041_0056794 | |||
| 1664 | Ga0501042_0002049 | |||
| 1665 | Ga0501042_0003403 | |||
| 1666 | Ga0501043_0001992 | |||
| 1667 | Ga0501046_0001108 | |||
| 1668 | Ga0501046_0024415 | |||
| 1669 | Ga0501048_0000495 | |||
| 1670 | Ga0501048_0045452 | |||
| 1671 | Ga0501048_0045918 | |||
| 1672 | Ga0501067_0026266 | |||
| 1673 | Ga0501068_0001135 | |||
| 1674 | Ga0501069_0048019 | |||
| 1675 | Ga0501069_0048322 | |||
| 1676 | Ga0501070_0002476 | |||
| 1677 | Ga0501071_0000731 | |||
| 1678 | Ga0501071_0024018 | |||
| 1679 | Ga0501072_0001629 | |||
| 1680 | Ga0501072_0011031 | |||
| 1681 | Ga0501072_0030265 | |||
| 1682 | Ga0501072_0055103 | |||
| 1683 | Ga0501072_0067248 | |||
| 1684 | Ga0501073_0043786 | |||
| 1685 | Ga0501073_0058246 | |||
| 1686 | Ga0501074_0000958 | |||
| 1687 | Ga0501074_0014082 | |||
| 1688 | Ga0501074_0042949 | |||
| 1689 | Ga0501075_0000672 | |||
| 1690 | Ga0501076_0018257 | |||
| 1691 | Ga0501076_0038716 | |||
| 1692 | Ga0501077_0002810 | |||
| 1693 | Ga0501077_0051458 | |||
| 1694 | Ga0501079_0000214 | |||
| 1695 | Ga0501079_0021008 | |||
| 1696 | Ga0501079_0043254 | |||
| 1697 | Ga0501080_0005478 | |||
| 1698 | Ga0501080_0124125 | |||
| 1699 | Ga0501081_0000596 | |||
| 1700 | Ga0501081_0010424 | |||
| 1701 | Ga0501035_0015257 | |||
| 1702 | Ga0501044_0007168 | |||
| 1703 | Ga0501045_0000417 | |||
| 1704 | Ga0501045_0007946 | |||
| 1705 | nmdc:mga05p37_156892_c1 | |||
| 1706 | nmdc:mga05p37_205530_c1 | |||
| 1707 | nmdc:mga05p37_388566_c1 | |||
| 1708 | nmdc:mga05p37_7880_c1 | |||
| 1709 | nmdc:mga05p37_89312_c1 | |||
| 1710 | nmdc:mga0qj67_228307_c1 | |||
| 1711 | nmdc:mga08y16_183109_c1 | |||
| 1712 | nmdc:mga08y16_33820_c1 | |||
| 1713 | nmdc:mga08y16_33936_c1 | |||
| 1714 | nmdc:mga08y16_56814_c1 | |||
| 1715 | nmdc:mga0n895_10525_c1 | |||
| 1716 | nmdc:mga0n895_198239_c1 | |||
| 1717 | nmdc:mga0n895_2126_c1 | |||
| 1718 | nmdc:mga0n895_43378_c1 | |||
| 1719 | nmdc:mga0n895_47645_c1 | |||
| 1720 | nmdc:mga0n895_825_c1 | |||
| 1721 | nmdc:mga0rr50_41015_c1 | |||
| 1722 | nmdc:mga0rr50_7773_c1 | |||
| 1723 | nmdc:mga0rr50_95517_c1 | |||
| 1724 | nmdc:mga08x19_7539_c1 | |||
| 1725 | nmdc:mga08x19_9178_c1 | |||
| 1726 | nmdc:mga0a205_13608_c1 | |||
| 1727 | nmdc:mga0a205_192441_c1 | |||
| 1728 | nmdc:mga0a205_24936_c1 | |||
| 1729 | nmdc:mga0a205_37118_c1 | |||
| 1730 | nmdc:mga0a205_44872_c1 | |||
| 1731 | nmdc:mga0a205_6248_c1 | |||
| 1732 | Ga0495601_0002354 | |||
| 1733 | Ga0495601_0044793 | |||
| 1734 | Ga0495612_0017888 | |||
| 1735 | Ga0495612_0024350 | |||
| 1736 | Ga0495595_0002737 | |||
| 1737 | Ga0495619_0021469 | |||
| 1738 | Ga0495619_0026491 | |||
| 1739 | Ga0495619_0027064 | |||
| 1740 | Ga0495619_0035391 | |||
| 1741 | Ga0500616_0001517 | |||
| 1742 | Ga0500616_0004633 | |||
| 1743 | Ga0501082_0004602 | |||
| 1744 | Ga0501082_0009312 | |||
| 1745 | Ga0501082_0079914 | |||
| 1746 | Ga0530510_0020513 | |||
| 1747 | Ga0530510_0030155 | |||
| 1748 | 2644438961 | |||
| 1749 | 2559432459 | |||
| 1750 | 2753271297 | |||
| 1751 | 2786674696 | |||
| 1752 | 2808847489 | |||
| 1753 | 2819691367 | |||
| 1754 | 2819729263 | |||
| 1755 | 2862387072 | |||
| 1756 | 2862510038 | |||
| 1757 | 2863409549 | |||
| 1758 | 2877677624 | |||
| 1759 | 2919475622 | |||
| 1760 | 2954680706 | |||
| 1761 | 2954683447 | |||
| 1762 | 3002999400 | |||
| 1763 | 8008565007 | |||
| 1764 | 8054474548 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ezb-assembly2.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9099 | 395 | 525 |
| 7v73-assembly1.cif.gz_A | thermostabilized human prestin in complex with chloride | 0.8865 | 2 | 531 |
| 7lhv-assembly1.cif.gz_B | structure of arabidopsis thaliana sulfate transporter atsultr4;1 | 0.8862 | 2 | 526 |
| 8opq-assembly1.cif.gz_A | structure of human solute carrier 26 family member a6 (slc26a6) anion transporter in an inward-facing state | 0.8832 | 2 | 530 |
| 7s9d-assembly1.cif.gz_B | cryo-em structure of dolphin prestin: intermediate state | 0.8814 | 7 | 531 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGF7_437_560_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9451 | 409 | 528 | 3.30.750.24 |
| af_Q942E2_508_653_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9224 | 394 | 526 | 3.30.750.24 |
| af_Q94LW6_488_626_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9189 | 394 | 528 | 3.30.750.24 |
| af_I1KA21_504_648_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9182 | 394 | 528 | 3.30.750.24 |
| af_Q10QI4_508_648_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9154 | 393 | 529 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U1BMN8-F1-model_v4 | deleted | 0.9522 | 1 | 532 |
|
| AF-A0A521THE0-F1-model_v4 | Sulfate permease | 0.9491 | 1 | 529 |
GO:0008509
GO:0016020 GO:0098661 |
| AF-A0A2V5KGL9-F1-model_v4 | Sodium-independent anion transporter | 0.9446 | 2 | 358 |
GO:0016020
GO:0055085 |
| AF-A0A495K0Q3-F1-model_v4 | High affinity sulfate transporter 1 | 0.9399 | 1 | 531 |
GO:0008509
GO:0016020 GO:0098661 |
| AF-A0A656TQD3-F1-model_v4 | deleted | 0.9373 | 2 | 345 |
|