F484221
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 872 | 236 | 1744 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300031344|Ga0265316_10318326|Ga0265316_103183262 |
| Length | 166 |
| Sequence | MPSRHKSRQRALQILFLWDARRQPEAAEAYPLAAAIDAYYDTLFPEEAPERDPFTAALVSGTVERLPEMDELIAKHAEHWRMERMPNVDRNILRLAAYEMAHGGTPAAVAIDEALELARKFSNEESVQFVNGVLDAIHRGLAAPGGGTPREGLSDPGASAEADAAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 162 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 170 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 182 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 185 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 186 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 187 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.69 |
| Rhizosphere | 98.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265316_10318326 | 3300031344 | Bacteria | 1130 |
| 2 | Ga0070658_10015689 | 3300005327 | Bacteria | 6059 |
| 3 | Ga0070658_10355692 | 3300005327 | Bacteria | 1254 |
| 4 | Ga0070676_10908687 | 3300005328 | Bacteria | 656 |
| 5 | Ga0070683_100001320 | 3300005329 | Bacteria | 18868 |
| 6 | Ga0070683_100050718 | 3300005329 | Bacteria | 3843 |
| 7 | Ga0070683_100080053 | 3300005329 | Bacteria | 3058 |
| 8 | Ga0070683_100080252 | 3300005329 | Bacteria | 3054 |
| 9 | Ga0070683_100170856 | 3300005329 | Bacteria | 2063 |
| 10 | Ga0070683_100186158 | 3300005329 | Bacteria | 1971 |
| 11 | Ga0070683_100334677 | 3300005329 | Bacteria | 1441 |
| 12 | Ga0070683_100583276 | 3300005329 | Unclassified | 1069 |
| 13 | Ga0070683_100939060 | 3300005329 | Unclassified | 830 |
| 14 | Ga0070690_100029704 | 3300005330 | Bacteria | 3392 |
| 15 | Ga0070670_101130193 | 3300005331 | Bacteria | 715 |
| 16 | Ga0070677_10502500 | 3300005333 | Bacteria | 657 |
| 17 | Ga0068869_100006386 | 3300005334 | Bacteria | 7474 |
| 18 | Ga0068869_100285526 | 3300005334 | Bacteria | 1328 |
| 19 | Ga0068869_100361691 | 3300005334 | Unclassified | 1185 |
| 20 | Ga0068869_102121466 | 3300005334 | Unclassified | 505 |
| 21 | Ga0070666_10066266 | 3300005335 | Bacteria | 2450 |
| 22 | Ga0070666_10071960 | 3300005335 | Bacteria | 2354 |
| 23 | Ga0070666_10239150 | 3300005335 | Bacteria | 1284 |
| 24 | Ga0070666_10678038 | 3300005335 | Bacteria | 755 |
| 25 | Ga0070666_11179637 | 3300005335 | Unclassified | 570 |
| 26 | Ga0070680_100104591 | 3300005336 | Bacteria | 2353 |
| 27 | Ga0070680_100432699 | 3300005336 | Bacteria | 1123 |
| 28 | Ga0068868_100001744 | 3300005338 | Bacteria | 14909 |
| 29 | Ga0068868_100053470 | 3300005338 | Bacteria | 3181 |
| 30 | Ga0068868_100132719 | 3300005338 | Bacteria | 2039 |
| 31 | Ga0068868_100281096 | 3300005338 | Bacteria | 1409 |
| 32 | Ga0068868_100436916 | 3300005338 | Bacteria | 1136 |
| 33 | Ga0068868_101936356 | 3300005338 | Unclassified | 559 |
| 34 | Ga0070660_100102518 | 3300005339 | Bacteria | 2268 |
| 35 | Ga0070660_100172120 | 3300005339 | Bacteria | 1749 |
| 36 | Ga0070660_101291229 | 3300005339 | Unclassified | 619 |
| 37 | Ga0070661_100112172 | 3300005344 | Bacteria | 2037 |
| 38 | Ga0070692_10264130 | 3300005345 | Bacteria | 1036 |
| 39 | Ga0070669_101003533 | 3300005353 | Bacteria | 716 |
| 40 | Ga0070675_100355876 | 3300005354 | Bacteria | 1299 |
| 41 | Ga0070671_100007174 | 3300005355 | Bacteria | 8910 |
| 42 | Ga0070671_100829009 | 3300005355 | Bacteria | 806 |
| 43 | Ga0070671_100957374 | 3300005355 | Unclassified | 749 |
| 44 | Ga0070674_100331670 | 3300005356 | Bacteria | 1223 |
| 45 | Ga0070674_100374899 | 3300005356 | Unclassified | 1156 |
| 46 | Ga0070674_100423931 | 3300005356 | Bacteria | 1092 |
| 47 | Ga0070674_102091490 | 3300005356 | Unclassified | 516 |
| 48 | Ga0070673_100012445 | 3300005364 | Bacteria | 5842 |
| 49 | Ga0070673_100643639 | 3300005364 | Bacteria | 970 |
| 50 | Ga0070659_100020791 | 3300005366 | Bacteria | 4991 |
| 51 | Ga0070659_100393609 | 3300005366 | Bacteria | 1169 |
| 52 | Ga0070667_100056048 | 3300005367 | Bacteria | 3329 |
| 53 | Ga0070667_100840407 | 3300005367 | Bacteria | 853 |
| 54 | Ga0070709_10264129 | 3300005434 | Unclassified | 1245 |
| 55 | Ga0070709_10272504 | 3300005434 | Bacteria | 1227 |
| 56 | Ga0070709_10568777 | 3300005434 | Bacteria | 869 |
| 57 | Ga0070709_11434257 | 3300005434 | Unclassified | 559 |
| 58 | Ga0070709_11458823 | 3300005434 | Bacteria | 555 |
| 59 | Ga0070714_100012429 | 3300005435 | Bacteria | 6798 |
| 60 | Ga0070714_100463491 | 3300005435 | Bacteria | 1205 |
| 61 | Ga0070714_100674412 | 3300005435 | Bacteria | 996 |
| 62 | Ga0070714_101222568 | 3300005435 | Bacteria | 733 |
| 63 | Ga0070713_100025779 | 3300005436 | Bacteria | 4603 |
| 64 | Ga0070713_100200151 | 3300005436 | Bacteria | 1803 |
| 65 | Ga0070713_100220185 | 3300005436 | Bacteria | 1721 |
| 66 | Ga0070713_100279253 | 3300005436 | Bacteria | 1532 |
| 67 | Ga0070713_100323441 | 3300005436 | Bacteria | 1425 |
| 68 | Ga0070713_100697699 | 3300005436 | Bacteria | 969 |
| 69 | Ga0070713_100762342 | 3300005436 | Unclassified | 926 |
| 70 | Ga0070713_102163661 | 3300005436 | Unclassified | 539 |
| 71 | Ga0070710_11053418 | 3300005437 | Unclassified | 595 |
| 72 | Ga0070710_11165808 | 3300005437 | Bacteria | 568 |
| 73 | Ga0070710_11171025 | 3300005437 | Unclassified | 567 |
| 74 | Ga0070711_100287619 | 3300005439 | Bacteria | 1303 |
| 75 | Ga0070711_100472720 | 3300005439 | Bacteria | 1029 |
| 76 | Ga0070711_100884634 | 3300005439 | Bacteria | 761 |
| 77 | Ga0070711_101170802 | 3300005439 | Unclassified | 664 |
| 78 | Ga0070705_101110132 | 3300005440 | Bacteria | 647 |
| 79 | Ga0070708_100901636 | 3300005445 | Bacteria | 830 |
| 80 | Ga0070678_100851390 | 3300005456 | Bacteria | 831 |
| 81 | Ga0070678_100954362 | 3300005456 | Unclassified | 786 |
| 82 | Ga0070662_100043876 | 3300005457 | Unclassified | 3201 |
| 83 | Ga0070681_10005962 | 3300005458 | Bacteria | 11798 |
| 84 | Ga0070681_10022598 | 3300005458 | Bacteria | 6316 |
| 85 | Ga0070681_10081652 | 3300005458 | Bacteria | 3189 |
| 86 | Ga0070681_10582423 | 3300005458 | Bacteria | 1033 |
| 87 | Ga0070681_10934700 | 3300005458 | Unclassified | 786 |
| 88 | Ga0070681_11264776 | 3300005458 | Bacteria | 660 |
| 89 | Ga0068867_100115638 | 3300005459 | Bacteria | 2066 |
| 90 | Ga0068867_100171948 | 3300005459 | Bacteria | 1717 |
| 91 | Ga0068867_100911976 | 3300005459 | Bacteria | 791 |
| 92 | Ga0068867_101885925 | 3300005459 | Bacteria | 563 |
| 93 | Ga0070685_10247082 | 3300005466 | Bacteria | 1180 |
| 94 | Ga0070706_102040920 | 3300005467 | Bacteria | 519 |
| 95 | Ga0070698_100868665 | 3300005471 | Bacteria | 847 |
| 96 | Ga0070699_100118807 | 3300005518 | Bacteria | 2324 |
| 97 | Ga0070679_100027969 | 3300005530 | Bacteria | 5556 |
| 98 | Ga0070679_100113318 | 3300005530 | Unclassified | 2697 |
| 99 | Ga0070679_100650400 | 3300005530 | Bacteria | 997 |
| 100 | Ga0070679_100922093 | 3300005530 | Bacteria | 817 |
| 101 | Ga0070684_100023948 | 3300005535 | Bacteria | 5115 |
| 102 | Ga0070684_100067426 | 3300005535 | Bacteria | 3143 |
| 103 | Ga0070684_100146401 | 3300005535 | Bacteria | 2138 |
| 104 | Ga0070684_100503423 | 3300005535 | Unclassified | 1122 |
| 105 | Ga0070684_100838306 | 3300005535 | Bacteria | 860 |
| 106 | Ga0070684_101276142 | 3300005535 | Bacteria | 691 |
| 107 | Ga0070697_100303270 | 3300005536 | Bacteria | 1373 |
| 108 | Ga0070697_101216812 | 3300005536 | Unclassified | 671 |
| 109 | Ga0068853_100082083 | 3300005539 | Bacteria | 2823 |
| 110 | Ga0068853_100185918 | 3300005539 | Bacteria | 1886 |
| 111 | Ga0068853_100495514 | 3300005539 | Bacteria | 1153 |
| 112 | Ga0068853_100789554 | 3300005539 | Bacteria | 909 |
| 113 | Ga0070686_100373484 | 3300005544 | Bacteria | 1077 |
| 114 | Ga0070693_100102548 | 3300005547 | Bacteria | 1745 |
| 115 | Ga0070693_100733955 | 3300005547 | Bacteria | 726 |
| 116 | Ga0070665_100008566 | 3300005548 | Bacteria | 10349 |
| 117 | Ga0070665_100573409 | 3300005548 | Bacteria | 1141 |
| 118 | Ga0070665_101687377 | 3300005548 | Bacteria | 641 |
| 119 | Ga0070704_101002270 | 3300005549 | Unclassified | 755 |
| 120 | Ga0068855_100005945 | 3300005563 | Bacteria | 14877 |
| 121 | Ga0068855_100010509 | 3300005563 | Bacteria | 11167 |
| 122 | Ga0068855_100100226 | 3300005563 | Bacteria | 3335 |
| 123 | Ga0068855_100113686 | 3300005563 | Bacteria | 3105 |
| 124 | Ga0068855_100134125 | 3300005563 | Unclassified | 2826 |
| 125 | Ga0068855_100137356 | 3300005563 | Unclassified | 2788 |
| 126 | Ga0068855_100259923 | 3300005563 | Bacteria | 1934 |
| 127 | Ga0068855_100602952 | 3300005563 | Unclassified | 1184 |
| 128 | Ga0068855_100682187 | 3300005563 | Bacteria | 1101 |
| 129 | Ga0070664_100250560 | 3300005564 | Bacteria | 1592 |
| 130 | Ga0070664_100313761 | 3300005564 | Bacteria | 1419 |
| 131 | Ga0070664_100780039 | 3300005564 | Bacteria | 893 |
| 132 | Ga0070664_101682295 | 3300005564 | Unclassified | 601 |
| 133 | Ga0070664_101701966 | 3300005564 | Bacteria | 598 |
| 134 | Ga0068857_100002818 | 3300005577 | Bacteria | 14302 |
| 135 | Ga0068857_100533172 | 3300005577 | Bacteria | 1104 |
| 136 | Ga0068857_100695890 | 3300005577 | Bacteria | 965 |
| 137 | Ga0068854_100135051 | 3300005578 | Unclassified | 1888 |
| 138 | Ga0068854_100563776 | 3300005578 | Unclassified | 968 |
| 139 | Ga0068856_100025021 | 3300005614 | Bacteria | 5818 |
| 140 | Ga0068856_100066090 | 3300005614 | Bacteria | 3573 |
| 141 | Ga0068856_100194620 | 3300005614 | Bacteria | 2041 |
| 142 | Ga0068856_100253203 | 3300005614 | Bacteria | 1776 |
| 143 | Ga0068856_100260362 | 3300005614 | Bacteria | 1750 |
| 144 | Ga0068856_100475033 | 3300005614 | Bacteria | 1271 |
| 145 | Ga0068856_100480456 | 3300005614 | Bacteria | 1263 |
| 146 | Ga0068856_100931953 | 3300005614 | Unclassified | 887 |
| 147 | Ga0070702_100833148 | 3300005615 | Unclassified | 716 |
| 148 | Ga0068852_100008043 | 3300005616 | Bacteria | 7735 |
| 149 | Ga0068852_100174804 | 3300005616 | Bacteria | 2015 |
| 150 | Ga0068859_100020418 | 3300005617 | Bacteria | 6649 |
| 151 | Ga0068859_100178016 | 3300005617 | Bacteria | 2209 |
| 152 | Ga0068859_100370092 | 3300005617 | Bacteria | 1528 |
| 153 | Ga0068859_100426099 | 3300005617 | Bacteria | 1423 |
| 154 | Ga0068859_101207000 | 3300005617 | Bacteria | 833 |
| 155 | Ga0068864_100047345 | 3300005618 | Bacteria | 3692 |
| 156 | Ga0068864_100355570 | 3300005618 | Unclassified | 1383 |
| 157 | Ga0068864_100381523 | 3300005618 | Bacteria | 1336 |
| 158 | Ga0068864_100464192 | 3300005618 | Bacteria | 1213 |
| 159 | Ga0068864_100616238 | 3300005618 | Bacteria | 1054 |
| 160 | Ga0068864_101886380 | 3300005618 | Bacteria | 603 |
| 161 | Ga0068866_10143807 | 3300005718 | Bacteria | 1373 |
| 162 | Ga0068866_10453919 | 3300005718 | Bacteria | 839 |
| 163 | Ga0068866_10697109 | 3300005718 | Bacteria | 696 |
| 164 | Ga0068866_11387748 | 3300005718 | Bacteria | 513 |
| 165 | Ga0068863_100031885 | 3300005841 | Bacteria | 5027 |
| 166 | Ga0068863_100140513 | 3300005841 | Bacteria | 2308 |
| 167 | Ga0068863_100762428 | 3300005841 | Bacteria | 964 |
| 168 | Ga0068858_100073443 | 3300005842 | Bacteria | 3174 |
| 169 | Ga0068858_100141925 | 3300005842 | Unclassified | 2255 |
| 170 | Ga0068858_100161660 | 3300005842 | Bacteria | 2109 |
| 171 | Ga0068858_100194691 | 3300005842 | Bacteria | 1916 |
| 172 | Ga0068858_100218591 | 3300005842 | Bacteria | 1804 |
| 173 | Ga0068858_100424993 | 3300005842 | Bacteria | 1278 |
| 174 | Ga0068858_102130629 | 3300005842 | Unclassified | 554 |
| 175 | Ga0068860_100036657 | 3300005843 | Bacteria | 4697 |
| 176 | Ga0068860_100258421 | 3300005843 | Bacteria | 1697 |
| 177 | Ga0068860_100428836 | 3300005843 | Bacteria | 1312 |
| 178 | Ga0068860_100861299 | 3300005843 | Bacteria | 921 |
| 179 | Ga0068860_101527928 | 3300005843 | Unclassified | 689 |
| 180 | Ga0068860_102153782 | 3300005843 | Bacteria | 579 |
| 181 | Ga0070717_10022785 | 3300006028 | Bacteria | 4954 |
| 182 | Ga0070717_10724752 | 3300006028 | Bacteria | 904 |
| 183 | Ga0070715_10338888 | 3300006163 | Bacteria | 817 |
| 184 | Ga0070715_10419491 | 3300006163 | Bacteria | 748 |
| 185 | Ga0070712_100423408 | 3300006175 | Bacteria | 1104 |
| 186 | Ga0070712_100493249 | 3300006175 | Unclassified | 1026 |
| 187 | Ga0097621_100007230 | 3300006237 | Bacteria | 7925 |
| 188 | Ga0097621_100029491 | 3300006237 | Bacteria | 4333 |
| 189 | Ga0097621_100035287 | 3300006237 | Bacteria | 3995 |
| 190 | Ga0097621_100036622 | 3300006237 | Bacteria | 3926 |
| 191 | Ga0097621_100036646 | 3300006237 | Bacteria | 3924 |
| 192 | Ga0097621_100124371 | 3300006237 | Bacteria | 2190 |
| 193 | Ga0097621_100256693 | 3300006237 | Bacteria | 1532 |
| 194 | Ga0097621_100451670 | 3300006237 | Bacteria | 1158 |
| 195 | Ga0097621_100762528 | 3300006237 | Unclassified | 894 |
| 196 | Ga0097621_100872834 | 3300006237 | Bacteria | 837 |
| 197 | Ga0068871_100041681 | 3300006358 | Bacteria | 3682 |
| 198 | Ga0068871_100059348 | 3300006358 | Unclassified | 3117 |
| 199 | Ga0068871_100063272 | 3300006358 | Bacteria | 3026 |
| 200 | Ga0068871_100069414 | 3300006358 | Bacteria | 2894 |
| 201 | Ga0068871_100111964 | 3300006358 | Bacteria | 2296 |
| 202 | Ga0068871_100266292 | 3300006358 | Bacteria | 1496 |
| 203 | Ga0068871_100278824 | 3300006358 | Unclassified | 1462 |
| 204 | Ga0068871_100328810 | 3300006358 | Bacteria | 1348 |
| 205 | Ga0068871_100400741 | 3300006358 | Bacteria | 1222 |
| 206 | Ga0068871_100718066 | 3300006358 | Bacteria | 917 |
| 207 | Ga0068871_100778094 | 3300006358 | Bacteria | 881 |
| 208 | Ga0068871_100854086 | 3300006358 | Bacteria | 841 |
| 209 | Ga0075428_101059817 | 3300006844 | Unclassified | 857 |
| 210 | Ga0075431_100022765 | 3300006847 | Bacteria | 6404 |
| 211 | Ga0075434_100931815 | 3300006871 | Bacteria | 883 |
| 212 | Ga0075434_101967340 | 3300006871 | Unclassified | 590 |
| 213 | Ga0068865_100021719 | 3300006881 | Unclassified | 4178 |
| 214 | Ga0068865_100426901 | 3300006881 | Bacteria | 1091 |
| 215 | Ga0068865_100488717 | 3300006881 | Bacteria | 1024 |
| 216 | Ga0075436_101028988 | 3300006914 | Unclassified | 619 |
| 217 | Ga0097620_100020418 | 3300006931 | Bacteria | 6649 |
| 218 | Ga0097620_100178009 | 3300006931 | Bacteria | 2209 |
| 219 | Ga0097620_100370077 | 3300006931 | Bacteria | 1528 |
| 220 | Ga0097620_100426109 | 3300006931 | Bacteria | 1423 |
| 221 | Ga0097620_101206734 | 3300006931 | Bacteria | 833 |
| 222 | Ga0099794_10461738 | 3300007265 | Bacteria | 666 |
| 223 | Ga0105240_10001445 | 3300009093 | Bacteria | 40579 |
| 224 | Ga0105240_10013455 | 3300009093 | Bacteria | 11237 |
| 225 | Ga0105240_10014978 | 3300009093 | Bacteria | 10565 |
| 226 | Ga0105240_10050088 | 3300009093 | Bacteria | 5268 |
| 227 | Ga0105240_10051197 | 3300009093 | Bacteria | 5199 |
| 228 | Ga0105240_10061008 | 3300009093 | Bacteria | 4700 |
| 229 | Ga0105240_10160138 | 3300009093 | Bacteria | 2674 |
| 230 | Ga0105240_10168597 | 3300009093 | Bacteria | 2595 |
| 231 | Ga0105240_10277150 | 3300009093 | Bacteria | 1928 |
| 232 | Ga0105240_10284196 | 3300009093 | Bacteria | 1899 |
| 233 | Ga0105240_10316251 | 3300009093 | Unclassified | 1781 |
| 234 | Ga0105240_11117380 | 3300009093 | Bacteria | 838 |
| 235 | Ga0105240_11483725 | 3300009093 | Bacteria | 711 |
| 236 | Ga0111539_10570661 | 3300009094 | Bacteria | 1318 |
| 237 | Ga0105245_10001935 | 3300009098 | Bacteria | 18814 |
| 238 | Ga0105245_10006150 | 3300009098 | Bacteria | 10564 |
| 239 | Ga0105245_10046178 | 3300009098 | Bacteria | 3892 |
| 240 | Ga0105245_10084207 | 3300009098 | Bacteria | 2912 |
| 241 | Ga0105245_10087198 | 3300009098 | Bacteria | 2865 |
| 242 | Ga0105245_10121343 | 3300009098 | Bacteria | 2442 |
| 243 | Ga0105245_10178990 | 3300009098 | Bacteria | 2024 |
| 244 | Ga0105245_10229961 | 3300009098 | Unclassified | 1793 |
| 245 | Ga0105245_10273191 | 3300009098 | Bacteria | 1649 |
| 246 | Ga0105245_10277754 | 3300009098 | Bacteria | 1636 |
| 247 | Ga0105245_10327107 | 3300009098 | Bacteria | 1512 |
| 248 | Ga0105245_10546923 | 3300009098 | Bacteria | 1179 |
| 249 | Ga0105245_10567099 | 3300009098 | Bacteria | 1159 |
| 250 | Ga0105245_12710646 | 3300009098 | Unclassified | 549 |
| 251 | Ga0105247_10018459 | 3300009101 | Bacteria | 4183 |
| 252 | Ga0105247_10230713 | 3300009101 | Bacteria | 1257 |
| 253 | Ga0114129_10148036 | 3300009147 | Bacteria | 3215 |
| 254 | Ga0105243_10184172 | 3300009148 | Bacteria | 1818 |
| 255 | Ga0105243_10358414 | 3300009148 | Bacteria | 1341 |
| 256 | Ga0105243_11085734 | 3300009148 | Bacteria | 808 |
| 257 | Ga0105243_11630761 | 3300009148 | Bacteria | 672 |
| 258 | Ga0105241_10002797 | 3300009174 | Bacteria | 13060 |
| 259 | Ga0105241_10006036 | 3300009174 | Bacteria | 8937 |
| 260 | Ga0105241_10035266 | 3300009174 | Unclassified | 3762 |
| 261 | Ga0105241_10052247 | 3300009174 | Bacteria | 3119 |
| 262 | Ga0105241_10076277 | 3300009174 | Bacteria | 2614 |
| 263 | Ga0105241_10133384 | 3300009174 | Unclassified | 2013 |
| 264 | Ga0105241_10281487 | 3300009174 | Bacteria | 1420 |
| 265 | Ga0105241_10522697 | 3300009174 | Bacteria | 1061 |
| 266 | Ga0105241_10529675 | 3300009174 | Unclassified | 1055 |
| 267 | Ga0105241_11317101 | 3300009174 | Bacteria | 688 |
| 268 | Ga0105241_11626683 | 3300009174 | Bacteria | 625 |
| 269 | Ga0105241_11931604 | 3300009174 | Bacteria | 579 |
| 270 | Ga0105241_12383015 | 3300009174 | Bacteria | 528 |
| 271 | Ga0105242_10022206 | 3300009176 | Bacteria | 4987 |
| 272 | Ga0105242_10071782 | 3300009176 | Bacteria | 2874 |
| 273 | Ga0105242_10092386 | 3300009176 | Unclassified | 2549 |
| 274 | Ga0105242_10104238 | 3300009176 | Bacteria | 2407 |
| 275 | Ga0105242_10162167 | 3300009176 | Bacteria | 1958 |
| 276 | Ga0105242_10204027 | 3300009176 | Bacteria | 1758 |
| 277 | Ga0105242_10216133 | 3300009176 | Bacteria | 1711 |
| 278 | Ga0105242_10382985 | 3300009176 | Bacteria | 1308 |
| 279 | Ga0105242_11508197 | 3300009176 | Bacteria | 703 |
| 280 | Ga0105242_11536258 | 3300009176 | Bacteria | 697 |
| 281 | Ga0105242_12423912 | 3300009176 | Bacteria | 572 |
| 282 | Ga0105242_12647641 | 3300009176 | Unclassified | 551 |
| 283 | Ga0105242_12847815 | 3300009176 | Unclassified | 534 |
| 284 | Ga0105242_12958796 | 3300009176 | Unclassified | 525 |
| 285 | Ga0105248_10018112 | 3300009177 | Bacteria | 7776 |
| 286 | Ga0105248_10052214 | 3300009177 | Bacteria | 4587 |
| 287 | Ga0105248_10068791 | 3300009177 | Unclassified | 3975 |
| 288 | Ga0105248_10080276 | 3300009177 | Bacteria | 3666 |
| 289 | Ga0105248_10275286 | 3300009177 | Bacteria | 1895 |
| 290 | Ga0105248_10315442 | 3300009177 | Bacteria | 1761 |
| 291 | Ga0105248_10369150 | 3300009177 | Bacteria | 1616 |
| 292 | Ga0105248_10543542 | 3300009177 | Bacteria | 1310 |
| 293 | Ga0105248_10684976 | 3300009177 | Bacteria | 1156 |
| 294 | Ga0105248_10700855 | 3300009177 | Bacteria | 1142 |
| 295 | Ga0105248_10701089 | 3300009177 | Bacteria | 1142 |
| 296 | Ga0105248_10855586 | 3300009177 | Bacteria | 1026 |
| 297 | Ga0105248_11107949 | 3300009177 | Bacteria | 895 |
| 298 | Ga0105248_11461382 | 3300009177 | Bacteria | 774 |
| 299 | Ga0105237_10008991 | 3300009545 | Bacteria | 10747 |
| 300 | Ga0105237_10036849 | 3300009545 | Bacteria | 4947 |
| 301 | Ga0105237_10081124 | 3300009545 | Bacteria | 3234 |
| 302 | Ga0105237_10084194 | 3300009545 | Bacteria | 3171 |
| 303 | Ga0105237_10185440 | 3300009545 | Bacteria | 2081 |
| 304 | Ga0105237_10194821 | 3300009545 | Unclassified | 2026 |
| 305 | Ga0105237_10390575 | 3300009545 | Bacteria | 1396 |
| 306 | Ga0105237_10398653 | 3300009545 | Bacteria | 1381 |
| 307 | Ga0105237_10416059 | 3300009545 | Bacteria | 1349 |
| 308 | Ga0105237_10798416 | 3300009545 | Bacteria | 951 |
| 309 | Ga0105238_10000599 | 3300009551 | Bacteria | 37847 |
| 310 | Ga0105238_10003339 | 3300009551 | Bacteria | 16014 |
| 311 | Ga0105238_10010862 | 3300009551 | Bacteria | 9152 |
| 312 | Ga0105238_10017202 | 3300009551 | Bacteria | 7345 |
| 313 | Ga0105238_10025296 | 3300009551 | Bacteria | 6050 |
| 314 | Ga0105238_10045342 | 3300009551 | Unclassified | 4441 |
| 315 | Ga0105238_10123966 | 3300009551 | Bacteria | 2563 |
| 316 | Ga0105238_10176056 | 3300009551 | Bacteria | 2116 |
| 317 | Ga0105238_10193604 | 3300009551 | Bacteria | 2009 |
| 318 | Ga0105238_10444872 | 3300009551 | Bacteria | 1292 |
| 319 | Ga0105238_10492215 | 3300009551 | Unclassified | 1226 |
| 320 | Ga0105238_11217027 | 3300009551 | Bacteria | 778 |
| 321 | Ga0105249_10126209 | 3300009553 | Bacteria | 2437 |
| 322 | Ga0105249_10411436 | 3300009553 | Bacteria | 1385 |
| 323 | Ga0105249_11565999 | 3300009553 | Bacteria | 731 |
| 324 | Ga0105249_12024599 | 3300009553 | Bacteria | 648 |
| 325 | Ga0105249_12851589 | 3300009553 | Bacteria | 555 |
| 326 | Ga0105239_10000963 | 3300010375 | Bacteria | 40408 |
| 327 | Ga0105239_10002731 | 3300010375 | Bacteria | 22158 |
| 328 | Ga0105239_10003562 | 3300010375 | Bacteria | 19042 |
| 329 | Ga0105239_10005855 | 3300010375 | Bacteria | 14331 |
| 330 | Ga0105239_10014036 | 3300010375 | Bacteria | 8892 |
| 331 | Ga0105239_10032014 | 3300010375 | Bacteria | 5779 |
| 332 | Ga0105239_10157271 | 3300010375 | Unclassified | 2539 |
| 333 | Ga0105239_10233093 | 3300010375 | Bacteria | 2066 |
| 334 | Ga0105239_10315634 | 3300010375 | Bacteria | 1762 |
| 335 | Ga0105239_10544048 | 3300010375 | Bacteria | 1322 |
| 336 | Ga0105239_12177551 | 3300010375 | Bacteria | 645 |
| 337 | Ga0105246_10051444 | 3300011119 | Bacteria | 2829 |
| 338 | Ga0105246_10052668 | 3300011119 | Bacteria | 2798 |
| 339 | Ga0105246_10074202 | 3300011119 | Bacteria | 2404 |
| 340 | Ga0105246_10307800 | 3300011119 | Bacteria | 1282 |
| 341 | Ga0105246_10427261 | 3300011119 | Bacteria | 1107 |
| 342 | Ga0105246_10791298 | 3300011119 | Bacteria | 840 |
| 343 | Ga0105246_11394829 | 3300011119 | Bacteria | 653 |
| 344 | Ga0157373_10239584 | 3300013100 | Bacteria | 1282 |
| 345 | Ga0157373_11155402 | 3300013100 | Bacteria | 582 |
| 346 | Ga0157371_10359554 | 3300013102 | Bacteria | 1061 |
| 347 | Ga0157370_10006562 | 3300013104 | Bacteria | 12816 |
| 348 | Ga0157370_10012942 | 3300013104 | Bacteria | 8624 |
| 349 | Ga0157370_10035171 | 3300013104 | Bacteria | 4872 |
| 350 | Ga0157370_10141654 | 3300013104 | Bacteria | 2240 |
| 351 | Ga0157370_10196040 | 3300013104 | Bacteria | 1874 |
| 352 | Ga0157369_10000449 | 3300013105 | Bacteria | 54630 |
| 353 | Ga0157369_10006340 | 3300013105 | Bacteria | 13729 |
| 354 | Ga0157369_10007671 | 3300013105 | Bacteria | 12417 |
| 355 | Ga0157369_10021520 | 3300013105 | Bacteria | 7213 |
| 356 | Ga0157369_10346714 | 3300013105 | Bacteria | 1543 |
| 357 | Ga0157369_10546326 | 3300013105 | Archaea | 1198 |
| 358 | Ga0157374_10047482 | 3300013296 | Unclassified | 3981 |
| 359 | Ga0157374_10108795 | 3300013296 | Bacteria | 2664 |
| 360 | Ga0157374_10119809 | 3300013296 | Bacteria | 2538 |
| 361 | Ga0157374_10160638 | 3300013296 | Bacteria | 2188 |
| 362 | Ga0157374_10431942 | 3300013296 | Unclassified | 1317 |
| 363 | Ga0157374_11020632 | 3300013296 | Unclassified | 847 |
| 364 | Ga0157374_11975835 | 3300013296 | Bacteria | 609 |
| 365 | Ga0157378_10087923 | 3300013297 | Bacteria | 2819 |
| 366 | Ga0157378_10113687 | 3300013297 | Bacteria | 2486 |
| 367 | Ga0157378_10140783 | 3300013297 | Bacteria | 2240 |
| 368 | Ga0157378_10686175 | 3300013297 | Bacteria | 1042 |
| 369 | Ga0157378_10972907 | 3300013297 | Bacteria | 882 |
| 370 | Ga0157378_11395065 | 3300013297 | Bacteria | 743 |
| 371 | Ga0157378_11742899 | 3300013297 | Bacteria | 670 |
| 372 | Ga0163162_10003010 | 3300013306 | Bacteria | 16108 |
| 373 | Ga0163162_10136983 | 3300013306 | Bacteria | 2559 |
| 374 | Ga0163162_10418741 | 3300013306 | Bacteria | 1472 |
| 375 | Ga0163162_10650201 | 3300013306 | Bacteria | 1178 |
| 376 | Ga0163162_10752080 | 3300013306 | Bacteria | 1094 |
| 377 | Ga0163162_10831141 | 3300013306 | Unclassified | 1040 |
| 378 | Ga0163162_11811040 | 3300013306 | Bacteria | 698 |
| 379 | Ga0163162_11829522 | 3300013306 | Unclassified | 694 |
| 380 | Ga0163162_11909113 | 3300013306 | Unclassified | 680 |
| 381 | Ga0157372_10036561 | 3300013307 | Bacteria | 5412 |
| 382 | Ga0157372_10049671 | 3300013307 | Unclassified | 4665 |
| 383 | Ga0157372_10051720 | 3300013307 | Bacteria | 4573 |
| 384 | Ga0157372_10054407 | 3300013307 | Bacteria | 4464 |
| 385 | Ga0157372_10426072 | 3300013307 | Unclassified | 1546 |
| 386 | Ga0157372_10636266 | 3300013307 | Bacteria | 1242 |
| 387 | Ga0157372_10758853 | 3300013307 | Unclassified | 1128 |
| 388 | Ga0157375_10002947 | 3300013308 | Bacteria | 14769 |
| 389 | Ga0157375_10038859 | 3300013308 | Bacteria | 4573 |
| 390 | Ga0157375_10074787 | 3300013308 | Bacteria | 3410 |
| 391 | Ga0157375_10149301 | 3300013308 | Bacteria | 2471 |
| 392 | Ga0157375_10674014 | 3300013308 | Bacteria | 1189 |
| 393 | Ga0157375_10950784 | 3300013308 | Bacteria | 1001 |
| 394 | Ga0157375_11213890 | 3300013308 | Bacteria | 885 |
| 395 | Ga0157375_11531132 | 3300013308 | Bacteria | 787 |
| 396 | Ga0157375_11582330 | 3300013308 | Unclassified | 775 |
| 397 | Ga0157375_11802770 | 3300013308 | Unclassified | 725 |
| 398 | Ga0163163_10008110 | 3300014325 | Bacteria | 9306 |
| 399 | Ga0163163_10041562 | 3300014325 | Bacteria | 4497 |
| 400 | Ga0163163_10077713 | 3300014325 | Bacteria | 3314 |
| 401 | Ga0163163_10151063 | 3300014325 | Bacteria | 2366 |
| 402 | Ga0163163_10228107 | 3300014325 | Bacteria | 1911 |
| 403 | Ga0163163_10251044 | 3300014325 | Bacteria | 1819 |
| 404 | Ga0163163_10385418 | 3300014325 | Unclassified | 1459 |
| 405 | Ga0163163_10801860 | 3300014325 | Bacteria | 1005 |
| 406 | Ga0163163_11101884 | 3300014325 | Bacteria | 857 |
| 407 | Ga0157380_10198119 | 3300014326 | Bacteria | 1779 |
| 408 | Ga0157380_11746540 | 3300014326 | Bacteria | 680 |
| 409 | Ga0157379_10041952 | 3300014968 | Bacteria | 4083 |
| 410 | Ga0157379_10121375 | 3300014968 | Bacteria | 2351 |
| 411 | Ga0157379_10229016 | 3300014968 | Bacteria | 1684 |
| 412 | Ga0157379_10350977 | 3300014968 | Bacteria | 1350 |
| 413 | Ga0157379_10357927 | 3300014968 | Bacteria | 1337 |
| 414 | Ga0157379_10384995 | 3300014968 | Bacteria | 1287 |
| 415 | Ga0157379_11491411 | 3300014968 | Unclassified | 658 |
| 416 | Ga0157376_10153947 | 3300014969 | Bacteria | 2076 |
| 417 | Ga0157376_10167198 | 3300014969 | Bacteria | 1999 |
| 418 | Ga0157376_10200505 | 3300014969 | Bacteria | 1836 |
| 419 | Ga0157376_10351217 | 3300014969 | Bacteria | 1411 |
| 420 | Ga0157376_10426426 | 3300014969 | Bacteria | 1288 |
| 421 | Ga0157376_10507554 | 3300014969 | Bacteria | 1186 |
| 422 | Ga0157376_10559199 | 3300014969 | Bacteria | 1133 |
| 423 | Ga0157376_10967514 | 3300014969 | Bacteria | 872 |
| 424 | Ga0157376_11124465 | 3300014969 | Unclassified | 812 |
| 425 | Ga0157376_11210917 | 3300014969 | Unclassified | 783 |
| 426 | Ga0157376_11292195 | 3300014969 | Bacteria | 759 |
| 427 | Ga0163161_10666915 | 3300017792 | Bacteria | 863 |
| 428 | Ga0163161_11598543 | 3300017792 | Bacteria | 575 |
| 429 | Ga0213875_10019213 | 3300021388 | Bacteria | 3288 |
| 430 | Ga0207692_10134819 | 3300025898 | Bacteria | 1398 |
| 431 | Ga0207642_10080071 | 3300025899 | Bacteria | 1583 |
| 432 | Ga0207642_10093423 | 3300025899 | Bacteria | 1492 |
| 433 | Ga0207642_10261660 | 3300025899 | Bacteria | 987 |
| 434 | Ga0207642_10415692 | 3300025899 | Bacteria | 808 |
| 435 | Ga0207710_10226736 | 3300025900 | Bacteria | 929 |
| 436 | Ga0207680_10013109 | 3300025903 | Bacteria | 4246 |
| 437 | Ga0207680_10133057 | 3300025903 | Bacteria | 1641 |
| 438 | Ga0207680_10682820 | 3300025903 | Bacteria | 736 |
| 439 | Ga0207680_10881402 | 3300025903 | Unclassified | 641 |
| 440 | Ga0207699_10111091 | 3300025906 | Bacteria | 1757 |
| 441 | Ga0207699_10372619 | 3300025906 | Bacteria | 1012 |
| 442 | Ga0207645_10083743 | 3300025907 | Bacteria | 2046 |
| 443 | Ga0207705_10037989 | 3300025909 | Bacteria | 3446 |
| 444 | Ga0207654_10008097 | 3300025911 | Bacteria | 5300 |
| 445 | Ga0207654_10019251 | 3300025911 | Unclassified | 3600 |
| 446 | Ga0207654_10021079 | 3300025911 | Bacteria | 3462 |
| 447 | Ga0207654_10030947 | 3300025911 | Bacteria | 2943 |
| 448 | Ga0207654_10041382 | 3300025911 | Bacteria | 2601 |
| 449 | Ga0207654_10211585 | 3300025911 | Bacteria | 1282 |
| 450 | Ga0207654_10534043 | 3300025911 | Bacteria | 831 |
| 451 | Ga0207707_10003018 | 3300025912 | Bacteria | 14966 |
| 452 | Ga0207707_10078056 | 3300025912 | Bacteria | 2891 |
| 453 | Ga0207707_10089651 | 3300025912 | Bacteria | 2688 |
| 454 | Ga0207707_10165548 | 3300025912 | Bacteria | 1932 |
| 455 | Ga0207707_10383262 | 3300025912 | Bacteria | 1208 |
| 456 | Ga0207707_10769701 | 3300025912 | Unclassified | 804 |
| 457 | Ga0207695_10001453 | 3300025913 | Bacteria | 39659 |
| 458 | Ga0207695_10003944 | 3300025913 | Bacteria | 20511 |
| 459 | Ga0207695_10007981 | 3300025913 | Bacteria | 13346 |
| 460 | Ga0207695_10008516 | 3300025913 | Bacteria | 12824 |
| 461 | Ga0207695_10021195 | 3300025913 | Bacteria | 7422 |
| 462 | Ga0207695_10067594 | 3300025913 | Bacteria | 3665 |
| 463 | Ga0207695_10075970 | 3300025913 | Unclassified | 3416 |
| 464 | Ga0207695_10430677 | 3300025913 | Bacteria | 1203 |
| 465 | Ga0207695_11056820 | 3300025913 | Unclassified | 692 |
| 466 | Ga0207695_11420756 | 3300025913 | Bacteria | 574 |
| 467 | Ga0207671_10023873 | 3300025914 | Bacteria | 4606 |
| 468 | Ga0207671_10047667 | 3300025914 | Bacteria | 3172 |
| 469 | Ga0207671_10055126 | 3300025914 | Unclassified | 2945 |
| 470 | Ga0207671_10067572 | 3300025914 | Bacteria | 2662 |
| 471 | Ga0207671_10292895 | 3300025914 | Bacteria | 1285 |
| 472 | Ga0207671_11014997 | 3300025914 | Unclassified | 653 |
| 473 | Ga0207671_11085881 | 3300025914 | Unclassified | 629 |
| 474 | Ga0207671_11260160 | 3300025914 | Bacteria | 577 |
| 475 | Ga0207693_10176885 | 3300025915 | Bacteria | 1679 |
| 476 | Ga0207663_10133221 | 3300025916 | Bacteria | 1720 |
| 477 | Ga0207663_10186163 | 3300025916 | Unclassified | 1487 |
| 478 | Ga0207663_10189239 | 3300025916 | Bacteria | 1476 |
| 479 | Ga0207663_10268209 | 3300025916 | Bacteria | 1263 |
| 480 | Ga0207660_10080060 | 3300025917 | Bacteria | 2398 |
| 481 | Ga0207660_10323751 | 3300025917 | Bacteria | 1231 |
| 482 | Ga0207657_10001616 | 3300025919 | Bacteria | 24238 |
| 483 | Ga0207657_10067678 | 3300025919 | Bacteria | 3036 |
| 484 | Ga0207657_10100986 | 3300025919 | Bacteria | 2395 |
| 485 | Ga0207657_10169808 | 3300025919 | Bacteria | 1768 |
| 486 | Ga0207657_11042485 | 3300025919 | Unclassified | 626 |
| 487 | Ga0207649_10082921 | 3300025920 | Bacteria | 2080 |
| 488 | Ga0207652_10001181 | 3300025921 | Bacteria | 23479 |
| 489 | Ga0207652_10038658 | 3300025921 | Bacteria | 4047 |
| 490 | Ga0207652_10384541 | 3300025921 | Unclassified | 1266 |
| 491 | Ga0207652_10748180 | 3300025921 | Bacteria | 870 |
| 492 | Ga0207694_10000448 | 3300025924 | Bacteria | 38251 |
| 493 | Ga0207694_10003244 | 3300025924 | Bacteria | 12965 |
| 494 | Ga0207694_10007766 | 3300025924 | Bacteria | 8123 |
| 495 | Ga0207694_10025523 | 3300025924 | Bacteria | 4492 |
| 496 | Ga0207694_10031802 | 3300025924 | Bacteria | 4034 |
| 497 | Ga0207694_10032283 | 3300025924 | Bacteria | 4006 |
| 498 | Ga0207694_10045660 | 3300025924 | Bacteria | 3384 |
| 499 | Ga0207694_10248954 | 3300025924 | Bacteria | 1454 |
| 500 | Ga0207694_10462252 | 3300025924 | Unclassified | 1060 |
| 501 | Ga0207694_10843245 | 3300025924 | Bacteria | 775 |
| 502 | Ga0207650_10539876 | 3300025925 | Bacteria | 977 |
| 503 | Ga0207659_10228439 | 3300025926 | Bacteria | 1500 |
| 504 | Ga0207687_10001795 | 3300025927 | Bacteria | 14771 |
| 505 | Ga0207687_10007087 | 3300025927 | Bacteria | 7389 |
| 506 | Ga0207687_10015219 | 3300025927 | Bacteria | 5040 |
| 507 | Ga0207687_10026024 | 3300025927 | Bacteria | 3917 |
| 508 | Ga0207687_10064372 | 3300025927 | Bacteria | 2600 |
| 509 | Ga0207687_10090074 | 3300025927 | Bacteria | 2235 |
| 510 | Ga0207687_10181524 | 3300025927 | Bacteria | 1631 |
| 511 | Ga0207687_10315338 | 3300025927 | Bacteria | 1264 |
| 512 | Ga0207687_10334041 | 3300025927 | Bacteria | 1230 |
| 513 | Ga0207687_10346954 | 3300025927 | Bacteria | 1208 |
| 514 | Ga0207687_10425539 | 3300025927 | Bacteria | 1096 |
| 515 | Ga0207687_10893910 | 3300025927 | Bacteria | 760 |
| 516 | Ga0207687_11756041 | 3300025927 | Unclassified | 531 |
| 517 | Ga0207700_10006564 | 3300025928 | Bacteria | 7042 |
| 518 | Ga0207700_10019238 | 3300025928 | Bacteria | 4609 |
| 519 | Ga0207700_10024933 | 3300025928 | Bacteria | 4146 |
| 520 | Ga0207700_10239930 | 3300025928 | Bacteria | 1544 |
| 521 | Ga0207700_10394727 | 3300025928 | Bacteria | 1212 |
| 522 | Ga0207700_10622215 | 3300025928 | Bacteria | 962 |
| 523 | Ga0207700_11491618 | 3300025928 | Unclassified | 600 |
| 524 | Ga0207664_10029384 | 3300025929 | Bacteria | 4186 |
| 525 | Ga0207664_10656606 | 3300025929 | Bacteria | 943 |
| 526 | Ga0207644_10057523 | 3300025931 | Bacteria | 2808 |
| 527 | Ga0207644_10585502 | 3300025931 | Bacteria | 926 |
| 528 | Ga0207644_10702593 | 3300025931 | Unclassified | 843 |
| 529 | Ga0207690_10078006 | 3300025932 | Bacteria | 2304 |
| 530 | Ga0207706_10127218 | 3300025933 | Unclassified | 2240 |
| 531 | Ga0207686_10006571 | 3300025934 | Bacteria | 6262 |
| 532 | Ga0207686_10009264 | 3300025934 | Bacteria | 5339 |
| 533 | Ga0207686_10010944 | 3300025934 | Bacteria | 4948 |
| 534 | Ga0207686_10097499 | 3300025934 | Unclassified | 1956 |
| 535 | Ga0207686_10274270 | 3300025934 | Bacteria | 1242 |
| 536 | Ga0207686_10481943 | 3300025934 | Bacteria | 959 |
| 537 | Ga0207686_10684157 | 3300025934 | Bacteria | 814 |
| 538 | Ga0207709_10231814 | 3300025935 | Bacteria | 1338 |
| 539 | Ga0207709_10235741 | 3300025935 | Bacteria | 1328 |
| 540 | Ga0207709_10301589 | 3300025935 | Bacteria | 1191 |
| 541 | Ga0207709_10516126 | 3300025935 | Bacteria | 935 |
| 542 | Ga0207709_11722565 | 3300025935 | Bacteria | 521 |
| 543 | Ga0207670_10883774 | 3300025936 | Bacteria | 748 |
| 544 | Ga0207704_10039559 | 3300025938 | Unclassified | 2747 |
| 545 | Ga0207704_10200496 | 3300025938 | Bacteria | 1460 |
| 546 | Ga0207704_10270097 | 3300025938 | Bacteria | 1287 |
| 547 | Ga0207704_10336029 | 3300025938 | Bacteria | 1171 |
| 548 | Ga0207704_10439077 | 3300025938 | Bacteria | 1039 |
| 549 | Ga0207665_10294263 | 3300025939 | Bacteria | 1212 |
| 550 | Ga0207711_10002029 | 3300025941 | Bacteria | 18313 |
| 551 | Ga0207711_10003043 | 3300025941 | Bacteria | 14659 |
| 552 | Ga0207711_10099643 | 3300025941 | Bacteria | 2569 |
| 553 | Ga0207711_10159152 | 3300025941 | Bacteria | 2043 |
| 554 | Ga0207711_10174704 | 3300025941 | Bacteria | 1951 |
| 555 | Ga0207711_10190267 | 3300025941 | Bacteria | 1870 |
| 556 | Ga0207711_10204314 | 3300025941 | Bacteria | 1803 |
| 557 | Ga0207711_10219084 | 3300025941 | Bacteria | 1740 |
| 558 | Ga0207711_10258181 | 3300025941 | Unclassified | 1601 |
| 559 | Ga0207711_10400987 | 3300025941 | Unclassified | 1274 |
| 560 | Ga0207711_11105788 | 3300025941 | Bacteria | 733 |
| 561 | Ga0207689_10153540 | 3300025942 | Bacteria | 1898 |
| 562 | Ga0207689_10381544 | 3300025942 | Unclassified | 1173 |
| 563 | Ga0207689_10595434 | 3300025942 | Bacteria | 930 |
| 564 | Ga0207689_10929528 | 3300025942 | Bacteria | 734 |
| 565 | Ga0207661_10070300 | 3300025944 | Bacteria | 2857 |
| 566 | Ga0207661_10136679 | 3300025944 | Bacteria | 2106 |
| 567 | Ga0207661_10182944 | 3300025944 | Bacteria | 1832 |
| 568 | Ga0207661_10272446 | 3300025944 | Bacteria | 1511 |
| 569 | Ga0207661_10274799 | 3300025944 | Bacteria | 1504 |
| 570 | Ga0207661_10576996 | 3300025944 | Unclassified | 1031 |
| 571 | Ga0207661_11109287 | 3300025944 | Unclassified | 728 |
| 572 | Ga0207679_10050164 | 3300025945 | Bacteria | 3048 |
| 573 | Ga0207679_10146157 | 3300025945 | Bacteria | 1918 |
| 574 | Ga0207679_10184360 | 3300025945 | Bacteria | 1729 |
| 575 | Ga0207679_10465691 | 3300025945 | Bacteria | 1123 |
| 576 | Ga0207667_10000290 | 3300025949 | Bacteria | 69361 |
| 577 | Ga0207667_10001654 | 3300025949 | Bacteria | 28076 |
| 578 | Ga0207667_10004072 | 3300025949 | Bacteria | 17963 |
| 579 | Ga0207667_10043852 | 3300025949 | Bacteria | 4745 |
| 580 | Ga0207667_10099935 | 3300025949 | Bacteria | 2993 |
| 581 | Ga0207667_10116956 | 3300025949 | Bacteria | 2747 |
| 582 | Ga0207667_10244219 | 3300025949 | Unclassified | 1837 |
| 583 | Ga0207667_10339766 | 3300025949 | Bacteria | 1532 |
| 584 | Ga0207667_10643959 | 3300025949 | Bacteria | 1066 |
| 585 | Ga0207667_11748592 | 3300025949 | Unclassified | 587 |
| 586 | Ga0207667_11871916 | 3300025949 | Unclassified | 563 |
| 587 | Ga0207651_10874423 | 3300025960 | Bacteria | 799 |
| 588 | Ga0207712_10105483 | 3300025961 | Bacteria | 2103 |
| 589 | Ga0207640_10274844 | 3300025981 | Bacteria | 1320 |
| 590 | Ga0207640_11687058 | 3300025981 | Bacteria | 572 |
| 591 | Ga0207677_10002199 | 3300026023 | Bacteria | 10246 |
| 592 | Ga0207677_10019458 | 3300026023 | Bacteria | 4100 |
| 593 | Ga0207677_10264019 | 3300026023 | Bacteria | 1405 |
| 594 | Ga0207677_10289217 | 3300026023 | Unclassified | 1349 |
| 595 | Ga0207677_10698716 | 3300026023 | Bacteria | 900 |
| 596 | Ga0207677_10819108 | 3300026023 | Bacteria | 834 |
| 597 | Ga0207677_11952363 | 3300026023 | Unclassified | 545 |
| 598 | Ga0207703_10037194 | 3300026035 | Bacteria | 3877 |
| 599 | Ga0207703_10115744 | 3300026035 | Bacteria | 2294 |
| 600 | Ga0207703_10185424 | 3300026035 | Bacteria | 1839 |
| 601 | Ga0207703_10312040 | 3300026035 | Bacteria | 1438 |
| 602 | Ga0207703_10316749 | 3300026035 | Bacteria | 1427 |
| 603 | Ga0207703_10970368 | 3300026035 | Unclassified | 815 |
| 604 | Ga0207703_11443691 | 3300026035 | Bacteria | 662 |
| 605 | Ga0207703_12068796 | 3300026035 | Bacteria | 546 |
| 606 | Ga0207639_10074186 | 3300026041 | Unclassified | 2670 |
| 607 | Ga0207639_10252521 | 3300026041 | Bacteria | 1538 |
| 608 | Ga0207639_10309543 | 3300026041 | Bacteria | 1399 |
| 609 | Ga0207639_10557003 | 3300026041 | Bacteria | 1053 |
| 610 | Ga0207639_10718293 | 3300026041 | Bacteria | 928 |
| 611 | Ga0207702_10004522 | 3300026078 | Bacteria | 12331 |
| 612 | Ga0207702_10012004 | 3300026078 | Bacteria | 7202 |
| 613 | Ga0207702_10175129 | 3300026078 | Bacteria | 1971 |
| 614 | Ga0207702_10244158 | 3300026078 | Bacteria | 1684 |
| 615 | Ga0207702_10263771 | 3300026078 | Bacteria | 1623 |
| 616 | Ga0207702_10334649 | 3300026078 | Bacteria | 1445 |
| 617 | Ga0207702_11099338 | 3300026078 | Unclassified | 789 |
| 618 | Ga0207702_11993422 | 3300026078 | Unclassified | 571 |
| 619 | Ga0207641_10067796 | 3300026088 | Bacteria | 3058 |
| 620 | Ga0207641_10119491 | 3300026088 | Unclassified | 2349 |
| 621 | Ga0207641_10336210 | 3300026088 | Bacteria | 1436 |
| 622 | Ga0207641_10974748 | 3300026088 | Bacteria | 844 |
| 623 | Ga0207641_11116547 | 3300026088 | Unclassified | 787 |
| 624 | Ga0207641_11475762 | 3300026088 | Bacteria | 681 |
| 625 | Ga0207648_10147912 | 3300026089 | Bacteria | 2072 |
| 626 | Ga0207648_10168295 | 3300026089 | Bacteria | 1937 |
| 627 | Ga0207648_11624835 | 3300026089 | Bacteria | 607 |
| 628 | Ga0207676_10124588 | 3300026095 | Bacteria | 2180 |
| 629 | Ga0207676_10254460 | 3300026095 | Unclassified | 1582 |
| 630 | Ga0207676_10311152 | 3300026095 | Bacteria | 1442 |
| 631 | Ga0207676_10391028 | 3300026095 | Bacteria | 1297 |
| 632 | Ga0207676_10795226 | 3300026095 | Bacteria | 922 |
| 633 | Ga0207676_11278122 | 3300026095 | Bacteria | 728 |
| 634 | Ga0207676_11923987 | 3300026095 | Bacteria | 590 |
| 635 | Ga0207674_10000985 | 3300026116 | Bacteria | 37225 |
| 636 | Ga0207674_10019772 | 3300026116 | Bacteria | 7287 |
| 637 | Ga0207674_10055454 | 3300026116 | Bacteria | 4029 |
| 638 | Ga0207674_10059067 | 3300026116 | Bacteria | 3883 |
| 639 | Ga0207674_11820290 | 3300026116 | Unclassified | 576 |
| 640 | Ga0207675_101727854 | 3300026118 | Bacteria | 645 |
| 641 | Ga0207683_10691174 | 3300026121 | Bacteria | 946 |
| 642 | Ga0207698_10269267 | 3300026142 | Bacteria | 1569 |
| 643 | Ga0207698_11091896 | 3300026142 | Bacteria | 810 |
| 644 | Ga0207698_11245371 | 3300026142 | Bacteria | 758 |
| 645 | Ga0207698_11344436 | 3300026142 | Unclassified | 729 |
| 646 | Ga0209588_1193079 | 3300027671 | Bacteria | 636 |
| 647 | Ga0268266_10003108 | 3300028379 | Bacteria | 16915 |
| 648 | Ga0268266_11377961 | 3300028379 | Bacteria | 681 |
| 649 | Ga0268264_10054641 | 3300028381 | Bacteria | 3335 |
| 650 | Ga0268264_10137809 | 3300028381 | Bacteria | 2172 |
| 651 | Ga0268264_10231885 | 3300028381 | Bacteria | 1705 |
| 652 | Ga0268264_11040024 | 3300028381 | Bacteria | 826 |
| 653 | Ga0268264_11932919 | 3300028381 | Bacteria | 599 |
| 654 | Ga0265338_10408391 | 3300028800 | Bacteria | 967 |
| 655 | Ga0265760_10071018 | 3300031090 | Bacteria | 1068 |
| 656 | Ga0265332_10024535 | 3300031238 | Bacteria | 2652 |
| 657 | Ga0265325_10106269 | 3300031241 | Unclassified | 1369 |
| 658 | Ga0265339_10148325 | 3300031249 | Bacteria | 1188 |
| 659 | Ga0265331_10040901 | 3300031250 | Unclassified | 2254 |
| 660 | Ga0265331_10068858 | 3300031250 | Unclassified | 1658 |
| 661 | Ga0265331_10379035 | 3300031250 | Bacteria | 634 |
| 662 | Ga0265316_10007594 | 3300031344 | Bacteria | 10196 |
| 663 | Ga0265316_10013946 | 3300031344 | Bacteria | 7106 |
| 664 | Ga0265316_10048971 | 3300031344 | Bacteria | 3331 |
| 665 | Ga0265316_10065984 | 3300031344 | Unclassified | 2802 |
| 666 | Ga0265316_10070056 | 3300031344 | Bacteria | 2705 |
| 667 | Ga0265316_10092048 | 3300031344 | Bacteria | 2312 |
| 668 | Ga0265316_10151436 | 3300031344 | Bacteria | 1737 |
| 669 | Ga0265316_10154524 | 3300031344 | Bacteria | 1717 |
| 670 | Ga0265316_10227713 | 3300031344 | Bacteria | 1374 |
| 671 | Ga0265313_10005690 | 3300031595 | Bacteria | 9090 |
| 672 | Ga0265313_10096410 | 3300031595 | Bacteria | 1319 |
| 673 | Ga0265313_10180192 | 3300031595 | Bacteria | 888 |
| 674 | Ga0265314_10000559 | 3300031711 | Bacteria | 47507 |
| 675 | Ga0265314_10000932 | 3300031711 | Bacteria | 34486 |
| 676 | Ga0265314_10063352 | 3300031711 | Bacteria | 2508 |
| 677 | Ga0265314_10109185 | 3300031711 | Bacteria | 1761 |
| 678 | Ga0265314_10206687 | 3300031711 | Bacteria | 1156 |
| 679 | Ga0265342_10352392 | 3300031712 | Bacteria | 766 |
| 680 | Ga0373926_0208252 | 3300035083 | Bacteria | 753 |
| 681 | Ga0373934_0001924 | 3300035086 | Bacteria | 7617 |
| 682 | Ga0373934_0034130 | 3300035086 | Bacteria | 1999 |
| 683 | Ga0373934_0048464 | 3300035086 | Bacteria | 1682 |
| 684 | Ga0373923_0015943 | 3300035111 | Bacteria | 2845 |
| 685 | Ga0373936_0139542 | 3300035113 | Bacteria | 1046 |
| 686 | Ga0373945_0359735 | 3300035116 | Unclassified | 632 |
| 687 | Ga0373953_0266112 | 3300035117 | Bacteria | 746 |
| 688 | Ga0373953_0289914 | 3300035117 | Bacteria | 714 |
| 689 | Ga0373954_0002014 | 3300035118 | Bacteria | 8440 |
| 690 | Ga0373954_0217849 | 3300035118 | Bacteria | 939 |
| 691 | Ga0373956_0038601 | 3300035119 | Bacteria | 2113 |
| 692 | Ga0373956_0473747 | 3300035119 | Bacteria | 598 |
| 693 | Ga0373957_0169538 | 3300035120 | Bacteria | 902 |
| 694 | Ga0373960_0344921 | 3300035121 | Bacteria | 563 |
| 695 | Ga0373943_0014711 | 3300035170 | Bacteria | 3548 |
| 696 | Ga0373943_0038001 | 3300035170 | Bacteria | 2313 |
| 697 | Ga0373943_0367708 | 3300035170 | Unclassified | 826 |
| 698 | Ga0373943_0527193 | 3300035170 | Unclassified | 692 |
| 699 | Ga0373946_0121181 | 3300035171 | Bacteria | 1194 |
| 700 | Ga0373955_0023707 | 3300035172 | Bacteria | 3130 |
| 701 | Ga0373955_0123148 | 3300035172 | Bacteria | 1509 |
| 702 | Ga0373955_0142744 | 3300035172 | Unclassified | 1405 |
| 703 | Ga0373924_0148084 | 3300035410 | Bacteria | 1026 |
| 704 | Ga0373935_0162041 | 3300035692 | Bacteria | 1525 |
| 705 | Ga0373935_0362754 | 3300035692 | Bacteria | 1035 |
| 706 | Ga0373935_0420553 | 3300035692 | Bacteria | 962 |
| 707 | Ga0373935_0843837 | 3300035692 | Bacteria | 677 |
| 708 | Ga0373927_0003424 | 3300035695 | Bacteria | 11375 |
| 709 | Ga0373927_0075373 | 3300035695 | Bacteria | 2185 |
| 710 | Ga0373927_0258526 | 3300035695 | Bacteria | 1145 |
| 711 | Ga0373927_0260657 | 3300035695 | Bacteria | 1140 |
| 712 | Ga0373927_0596064 | 3300035695 | Bacteria | 730 |
| 713 | Ga0373933_0079161 | 3300035724 | Bacteria | 2012 |
| 714 | Ga0373933_0448942 | 3300035724 | Bacteria | 843 |
| 715 | Ga0373933_0512078 | 3300035724 | Unclassified | 786 |
| 716 | Ga0373947_0003449 | 3300035725 | Bacteria | 9346 |
| 717 | Ga0373947_0274520 | 3300035725 | Bacteria | 1120 |
| 718 | Ga0373947_0678450 | 3300035725 | Unclassified | 703 |
| 719 | Ga0373947_0880674 | 3300035725 | Bacteria | 611 |
| 720 | Ga0373947_0965936 | 3300035725 | Unclassified | 581 |
| 721 | Ga0373947_1265034 | 3300035725 | Bacteria | 502 |
| 722 | Ga0373937_0001907 | 3300036401 | Bacteria | 17502 |
| 723 | Ga0373937_0020084 | 3300036401 | Bacteria | 5985 |
| 724 | Ga0373937_0057467 | 3300036401 | Bacteria | 3574 |
| 725 | Ga0373937_0137776 | 3300036401 | Bacteria | 2282 |
| 726 | Ga0373937_0197728 | 3300036401 | Unclassified | 1890 |
| 727 | Ga0373937_0368066 | 3300036401 | Bacteria | 1363 |
| 728 | Ga0373937_0389586 | 3300036401 | Unclassified | 1322 |
| 729 | Ga0373937_0492129 | 3300036401 | Unclassified | 1165 |
| 730 | Ga0373925_0001244 | 3300037068 | Bacteria | 22460 |
| 731 | Ga0373925_0017973 | 3300037068 | Bacteria | 5134 |
| 732 | Ga0373925_0079912 | 3300037068 | Bacteria | 2485 |
| 733 | Ga0373925_0099449 | 3300037068 | Bacteria | 2234 |
| 734 | Ga0373925_0246478 | 3300037068 | Bacteria | 1432 |
| 735 | Ga0373925_0292436 | 3300037068 | Unclassified | 1314 |
| 736 | Ga0373925_0328371 | 3300037068 | Bacteria | 1239 |
| 737 | Ga0373925_0417960 | 3300037068 | Bacteria | 1095 |
| 738 | Ga0373925_0974647 | 3300037068 | Bacteria | 698 |
| 739 | Ga0436364_0634814 | 3300037853 | Bacteria | 6872 |
| 740 | Ga0436364_0680395 | 3300037853 | Bacteria | 7356 |
| 741 | Ga0436364_1261791 | 3300037853 | Unclassified | 785 |
| 742 | Ga0436364_1424376 | 3300037853 | Bacteria | 1372 |
| 743 | Ga0242420_118898 | 3300038996 | Unclassified | 575 |
| 744 | Ga0436365_0496136 | 3300039437 | Unclassified | 709 |
| 745 | Ga0436365_1778402 | 3300039437 | Bacteria | 3215 |
| 746 | Ga0436360_1273375 | 3300039438 | Unclassified | 692 |
| 747 | Ga0451839_1534484 | 3300041496 | Unclassified | 579 |
| 748 | Ga0451853_2905678 | 3300041512 | Bacteria | 653 |
| 749 | Ga0453684_0251538 | 3300044712 | Bacteria | 2029 |
| 750 | Ga0451576_0026734 | 3300045051 | Bacteria | 6204 |
| 751 | Ga0451576_0566931 | 3300045051 | Bacteria | 1193 |
| 752 | Ga0451576_0936164 | 3300045051 | Bacteria | 909 |
| 753 | Ga0451576_2298897 | 3300045051 | Unclassified | 552 |
| 754 | Ga0495592_0012783 | 3300046454 | Bacteria | 6382 |
| 755 | Ga0495592_0029959 | 3300046454 | Bacteria | 4117 |
| 756 | Ga0495651_0029066 | 3300046462 | Bacteria | 4311 |
| 757 | Ga0495651_0239089 | 3300046462 | Bacteria | 1247 |
| 758 | Ga0495653_0282738 | 3300046463 | Bacteria | 1088 |
| 759 | Ga0495653_0397888 | 3300046463 | Unclassified | 876 |
| 760 | Ga0495653_0712770 | 3300046463 | Bacteria | 609 |
| 761 | Ga0495580_0000307 | 3300046472 | Bacteria | 39901 |
| 762 | Ga0495580_0061918 | 3300046472 | Bacteria | 2626 |
| 763 | Ga0495580_0269560 | 3300046472 | Unclassified | 1163 |
| 764 | Ga0495580_0345047 | 3300046472 | Bacteria | 1009 |
| 765 | Ga0495580_0346643 | 3300046472 | Unclassified | 1007 |
| 766 | Ga0495580_0546433 | 3300046472 | Unclassified | 770 |
| 767 | Ga0495582_0011352 | 3300046473 | Bacteria | 4909 |
| 768 | Ga0495639_0414826 | 3300046475 | Unclassified | 681 |
| 769 | Ga0495664_0013254 | 3300046477 | Bacteria | 4675 |
| 770 | Ga0495664_0508738 | 3300046477 | Bacteria | 719 |
| 771 | Ga0495664_0581877 | 3300046477 | Unclassified | 666 |
| 772 | Ga0495594_0131671 | 3300046499 | Bacteria | 1417 |
| 773 | Ga0495594_0178198 | 3300046499 | Bacteria | 1210 |
| 774 | Ga0495594_0240751 | 3300046499 | Bacteria | 1031 |
| 775 | Ga0495594_0356019 | 3300046499 | Unclassified | 834 |
| 776 | Ga0495618_0255258 | 3300046514 | Bacteria | 1099 |
| 777 | Ga0495628_0024119 | 3300046516 | Bacteria | 4982 |
| 778 | Ga0495628_0059017 | 3300046516 | Bacteria | 3014 |
| 779 | Ga0495628_0068257 | 3300046516 | Bacteria | 2775 |
| 780 | Ga0495628_0591773 | 3300046516 | Bacteria | 793 |
| 781 | Ga0495628_0720547 | 3300046516 | Bacteria | 703 |
| 782 | Ga0495630_0018918 | 3300046517 | Bacteria | 5063 |
| 783 | Ga0495630_0168767 | 3300046517 | Bacteria | 1667 |
| 784 | Ga0495666_0085266 | 3300046526 | Bacteria | 1492 |
| 785 | Ga0495652_0040924 | 3300046529 | Bacteria | 4003 |
| 786 | Ga0495652_0118195 | 3300046529 | Bacteria | 2119 |
| 787 | Ga0495652_0175855 | 3300046529 | Bacteria | 1648 |
| 788 | Ga0495652_0253109 | 3300046529 | Unclassified | 1304 |
| 789 | Ga0495652_0646580 | 3300046529 | Unclassified | 717 |
| 790 | Ga0495665_0085194 | 3300046531 | Bacteria | 1661 |
| 791 | Ga0495665_0181226 | 3300046531 | Bacteria | 1095 |
| 792 | Ga0495665_0198207 | 3300046531 | Unclassified | 1041 |
| 793 | Ga0495665_0208968 | 3300046531 | Bacteria | 1011 |
| 794 | Ga0495640_0048723 | 3300046533 | Bacteria | 2926 |
| 795 | Ga0495586_0111443 | 3300046535 | Bacteria | 1523 |
| 796 | Ga0495586_0273994 | 3300046535 | Bacteria | 965 |
| 797 | Ga0495586_0288036 | 3300046535 | Bacteria | 940 |
| 798 | Ga0495587_0001113 | 3300046536 | Bacteria | 17614 |
| 799 | Ga0495587_0045658 | 3300046536 | Bacteria | 2603 |
| 800 | Ga0495587_0076792 | 3300046536 | Bacteria | 1940 |
| 801 | Ga0495587_0178035 | 3300046536 | Bacteria | 1206 |
| 802 | Ga0495645_0002625 | 3300046543 | Bacteria | 12222 |
| 803 | Ga0495645_0343442 | 3300046543 | Unclassified | 963 |
| 804 | Ga0495645_0670234 | 3300046543 | Unclassified | 632 |
| 805 | Ga0495633_0214867 | 3300046558 | Bacteria | 881 |
| 806 | Ga0495667_0300376 | 3300046559 | Bacteria | 1017 |
| 807 | Ga0495634_0071303 | 3300046642 | Bacteria | 2288 |
| 808 | Ga0495634_0077186 | 3300046642 | Bacteria | 2185 |
| 809 | Ga0495635_0882156 | 3300046663 | Bacteria | 573 |
| 810 | Ga0495599_0004841 | 3300046678 | Bacteria | 8009 |
| 811 | Ga0495599_0007068 | 3300046678 | Bacteria | 6795 |
| 812 | Ga0495599_0058293 | 3300046678 | Bacteria | 2416 |
| 813 | Ga0495599_0312479 | 3300046678 | Bacteria | 947 |
| 814 | Ga0495623_0171961 | 3300046679 | Unclassified | 1265 |
| 815 | Ga0495623_0363307 | 3300046679 | Bacteria | 786 |
| 816 | Ga0495623_0501937 | 3300046679 | Bacteria | 640 |
| 817 | Ga0495623_0624217 | 3300046679 | Unclassified | 558 |
| 818 | Ga0495646_0257567 | 3300046680 | Unclassified | 933 |
| 819 | Ga0495658_0166869 | 3300046683 | Bacteria | 1361 |
| 820 | Ga0495658_0603580 | 3300046683 | Bacteria | 703 |
| 821 | Ga0495669_0133631 | 3300046684 | Bacteria | 1169 |
| 822 | Ga0495669_0388141 | 3300046684 | Bacteria | 676 |
| 823 | Ga0495613_0090378 | 3300046689 | Bacteria | 2218 |
| 824 | Ga0495613_0132561 | 3300046689 | Bacteria | 1784 |
| 825 | Ga0495613_0247721 | 3300046689 | Bacteria | 1244 |
| 826 | Ga0495613_0961336 | 3300046689 | Bacteria | 550 |
| 827 | Ga0495600_0053298 | 3300046809 | Bacteria | 2642 |
| 828 | Ga0495600_0305439 | 3300046809 | Unclassified | 1003 |
| 829 | Ga0495604_0153282 | 3300047317 | Bacteria | 1635 |
| 830 | Ga0495604_0156996 | 3300047317 | Bacteria | 1611 |
| 831 | Ga0495604_0923559 | 3300047317 | Bacteria | 544 |
| 832 | Ga0495636_0088624 | 3300047318 | Bacteria | 1341 |
| 833 | Ga0495674_0045746 | 3300047319 | Bacteria | 3886 |
| 834 | Ga0495674_0051721 | 3300047319 | Unclassified | 3621 |
| 835 | Ga0495674_0287979 | 3300047319 | Bacteria | 1344 |
| 836 | Ga0495674_0308153 | 3300047319 | Unclassified | 1292 |
| 837 | Ga0495674_0406935 | 3300047319 | Bacteria | 1098 |
| 838 | Ga0495674_0715622 | 3300047319 | Bacteria | 785 |
| 839 | Ga0495680_0247480 | 3300047322 | Unclassified | 1264 |
| 840 | Ga0495680_0479888 | 3300047322 | Bacteria | 847 |
| 841 | Ga0495675_0068772 | 3300047444 | Bacteria | 2237 |
| 842 | Ga0495675_0115713 | 3300047444 | Unclassified | 1672 |
| 843 | Ga0495675_0136572 | 3300047444 | Bacteria | 1522 |
| 844 | Ga0495684_0004128 | 3300047471 | Bacteria | 11344 |
| 845 | Ga0495684_0016021 | 3300047471 | Bacteria | 5772 |
| 846 | Ga0495684_0024166 | 3300047471 | Bacteria | 4676 |
| 847 | Ga0495684_0065364 | 3300047471 | Bacteria | 2765 |
| 848 | Ga0495684_0180024 | 3300047471 | Unclassified | 1567 |
| 849 | Ga0495684_0272439 | 3300047471 | Bacteria | 1224 |
| 850 | Ga0495684_0720098 | 3300047471 | Unclassified | 660 |
| 851 | Ga0495593_0133971 | 3300047673 | Bacteria | 1257 |
| 852 | Ga0495593_0138230 | 3300047673 | Bacteria | 1235 |
| 853 | Ga0495602_0001372 | 3300048088 | Bacteria | 24025 |
| 854 | Ga0495602_0118037 | 3300048088 | Bacteria | 2141 |
| 855 | Ga0495602_0180894 | 3300048088 | Bacteria | 1626 |
| 856 | Ga0495602_0184490 | 3300048088 | Bacteria | 1606 |
| 857 | Ga0496102_1062717 | 3300048905 | Unclassified | 729 |
| 858 | Ga0496104_0259643 | 3300048907 | Bacteria | 1650 |
| 859 | Ga0496105_0216939 | 3300048908 | Bacteria | 1558 |
| 860 | Ga0496115_0046537 | 3300048918 | Bacteria | 3468 |
| 861 | Ga0496115_0162753 | 3300048918 | Unclassified | 1844 |
| 862 | Ga0496115_0285517 | 3300048918 | Bacteria | 1354 |
| 863 | Ga0501073_0931105 | 3300049589 | Bacteria | 598 |
| 864 | nmdc:mga05p37_108043_c1 | 3300050507 | Bacteria | 3422 |
| 865 | nmdc:mga06r32_59860_c1 | 3300050510 | Bacteria | 3664 |
| 866 | nmdc:mga08y16_526036_c1 | 3300050511 | Bacteria | 1199 |
| 867 | nmdc:mga0n895_1485647_c1 | 3300050512 | Bacteria | 644 |
| 868 | Ga0495601_0077502 | 3300053077 | Bacteria | 2129 |
| 869 | Ga0495601_0166533 | 3300053077 | Bacteria | 1440 |
| 870 | Ga0495601_0232250 | 3300053077 | Bacteria | 1205 |
| 871 | Ga0495601_0277554 | 3300053077 | Unclassified | 1093 |
| 872 | Ga0495619_0784833 | 3300053085 | Bacteria | 645 |
| 873 | Ga0265316_10318326 | |||
| 874 | Ga0070658_10015689 | |||
| 875 | Ga0070658_10355692 | |||
| 876 | Ga0070676_10908687 | |||
| 877 | Ga0070683_100001320 | |||
| 878 | Ga0070683_100050718 | |||
| 879 | Ga0070683_100080053 | |||
| 880 | Ga0070683_100080252 | |||
| 881 | Ga0070683_100170856 | |||
| 882 | Ga0070683_100186158 | |||
| 883 | Ga0070683_100334677 | |||
| 884 | Ga0070683_100583276 | |||
| 885 | Ga0070683_100939060 | |||
| 886 | Ga0070690_100029704 | |||
| 887 | Ga0070670_101130193 | |||
| 888 | Ga0070677_10502500 | |||
| 889 | Ga0068869_100006386 | |||
| 890 | Ga0068869_100285526 | |||
| 891 | Ga0068869_100361691 | |||
| 892 | Ga0068869_102121466 | |||
| 893 | Ga0070666_10066266 | |||
| 894 | Ga0070666_10071960 | |||
| 895 | Ga0070666_10239150 | |||
| 896 | Ga0070666_10678038 | |||
| 897 | Ga0070666_11179637 | |||
| 898 | Ga0070680_100104591 | |||
| 899 | Ga0070680_100432699 | |||
| 900 | Ga0068868_100001744 | |||
| 901 | Ga0068868_100053470 | |||
| 902 | Ga0068868_100132719 | |||
| 903 | Ga0068868_100281096 | |||
| 904 | Ga0068868_100436916 | |||
| 905 | Ga0068868_101936356 | |||
| 906 | Ga0070660_100102518 | |||
| 907 | Ga0070660_100172120 | |||
| 908 | Ga0070660_101291229 | |||
| 909 | Ga0070661_100112172 | |||
| 910 | Ga0070692_10264130 | |||
| 911 | Ga0070669_101003533 | |||
| 912 | Ga0070675_100355876 | |||
| 913 | Ga0070671_100007174 | |||
| 914 | Ga0070671_100829009 | |||
| 915 | Ga0070671_100957374 | |||
| 916 | Ga0070674_100331670 | |||
| 917 | Ga0070674_100374899 | |||
| 918 | Ga0070674_100423931 | |||
| 919 | Ga0070674_102091490 | |||
| 920 | Ga0070673_100012445 | |||
| 921 | Ga0070673_100643639 | |||
| 922 | Ga0070659_100020791 | |||
| 923 | Ga0070659_100393609 | |||
| 924 | Ga0070667_100056048 | |||
| 925 | Ga0070667_100840407 | |||
| 926 | Ga0070709_10264129 | |||
| 927 | Ga0070709_10272504 | |||
| 928 | Ga0070709_10568777 | |||
| 929 | Ga0070709_11434257 | |||
| 930 | Ga0070709_11458823 | |||
| 931 | Ga0070714_100012429 | |||
| 932 | Ga0070714_100463491 | |||
| 933 | Ga0070714_100674412 | |||
| 934 | Ga0070714_101222568 | |||
| 935 | Ga0070713_100025779 | |||
| 936 | Ga0070713_100200151 | |||
| 937 | Ga0070713_100220185 | |||
| 938 | Ga0070713_100279253 | |||
| 939 | Ga0070713_100323441 | |||
| 940 | Ga0070713_100697699 | |||
| 941 | Ga0070713_100762342 | |||
| 942 | Ga0070713_102163661 | |||
| 943 | Ga0070710_11053418 | |||
| 944 | Ga0070710_11165808 | |||
| 945 | Ga0070710_11171025 | |||
| 946 | Ga0070711_100287619 | |||
| 947 | Ga0070711_100472720 | |||
| 948 | Ga0070711_100884634 | |||
| 949 | Ga0070711_101170802 | |||
| 950 | Ga0070705_101110132 | |||
| 951 | Ga0070708_100901636 | |||
| 952 | Ga0070678_100851390 | |||
| 953 | Ga0070678_100954362 | |||
| 954 | Ga0070662_100043876 | |||
| 955 | Ga0070681_10005962 | |||
| 956 | Ga0070681_10022598 | |||
| 957 | Ga0070681_10081652 | |||
| 958 | Ga0070681_10582423 | |||
| 959 | Ga0070681_10934700 | |||
| 960 | Ga0070681_11264776 | |||
| 961 | Ga0068867_100115638 | |||
| 962 | Ga0068867_100171948 | |||
| 963 | Ga0068867_100911976 | |||
| 964 | Ga0068867_101885925 | |||
| 965 | Ga0070685_10247082 | |||
| 966 | Ga0070706_102040920 | |||
| 967 | Ga0070698_100868665 | |||
| 968 | Ga0070699_100118807 | |||
| 969 | Ga0070679_100027969 | |||
| 970 | Ga0070679_100113318 | |||
| 971 | Ga0070679_100650400 | |||
| 972 | Ga0070679_100922093 | |||
| 973 | Ga0070684_100023948 | |||
| 974 | Ga0070684_100067426 | |||
| 975 | Ga0070684_100146401 | |||
| 976 | Ga0070684_100503423 | |||
| 977 | Ga0070684_100838306 | |||
| 978 | Ga0070684_101276142 | |||
| 979 | Ga0070697_100303270 | |||
| 980 | Ga0070697_101216812 | |||
| 981 | Ga0068853_100082083 | |||
| 982 | Ga0068853_100185918 | |||
| 983 | Ga0068853_100495514 | |||
| 984 | Ga0068853_100789554 | |||
| 985 | Ga0070686_100373484 | |||
| 986 | Ga0070693_100102548 | |||
| 987 | Ga0070693_100733955 | |||
| 988 | Ga0070665_100008566 | |||
| 989 | Ga0070665_100573409 | |||
| 990 | Ga0070665_101687377 | |||
| 991 | Ga0070704_101002270 | |||
| 992 | Ga0068855_100005945 | |||
| 993 | Ga0068855_100010509 | |||
| 994 | Ga0068855_100100226 | |||
| 995 | Ga0068855_100113686 | |||
| 996 | Ga0068855_100134125 | |||
| 997 | Ga0068855_100137356 | |||
| 998 | Ga0068855_100259923 | |||
| 999 | Ga0068855_100602952 | |||
| 1000 | Ga0068855_100682187 | |||
| 1001 | Ga0070664_100250560 | |||
| 1002 | Ga0070664_100313761 | |||
| 1003 | Ga0070664_100780039 | |||
| 1004 | Ga0070664_101682295 | |||
| 1005 | Ga0070664_101701966 | |||
| 1006 | Ga0068857_100002818 | |||
| 1007 | Ga0068857_100533172 | |||
| 1008 | Ga0068857_100695890 | |||
| 1009 | Ga0068854_100135051 | |||
| 1010 | Ga0068854_100563776 | |||
| 1011 | Ga0068856_100025021 | |||
| 1012 | Ga0068856_100066090 | |||
| 1013 | Ga0068856_100194620 | |||
| 1014 | Ga0068856_100253203 | |||
| 1015 | Ga0068856_100260362 | |||
| 1016 | Ga0068856_100475033 | |||
| 1017 | Ga0068856_100480456 | |||
| 1018 | Ga0068856_100931953 | |||
| 1019 | Ga0070702_100833148 | |||
| 1020 | Ga0068852_100008043 | |||
| 1021 | Ga0068852_100174804 | |||
| 1022 | Ga0068859_100020418 | |||
| 1023 | Ga0068859_100178016 | |||
| 1024 | Ga0068859_100370092 | |||
| 1025 | Ga0068859_100426099 | |||
| 1026 | Ga0068859_101207000 | |||
| 1027 | Ga0068864_100047345 | |||
| 1028 | Ga0068864_100355570 | |||
| 1029 | Ga0068864_100381523 | |||
| 1030 | Ga0068864_100464192 | |||
| 1031 | Ga0068864_100616238 | |||
| 1032 | Ga0068864_101886380 | |||
| 1033 | Ga0068866_10143807 | |||
| 1034 | Ga0068866_10453919 | |||
| 1035 | Ga0068866_10697109 | |||
| 1036 | Ga0068866_11387748 | |||
| 1037 | Ga0068863_100031885 | |||
| 1038 | Ga0068863_100140513 | |||
| 1039 | Ga0068863_100762428 | |||
| 1040 | Ga0068858_100073443 | |||
| 1041 | Ga0068858_100141925 | |||
| 1042 | Ga0068858_100161660 | |||
| 1043 | Ga0068858_100194691 | |||
| 1044 | Ga0068858_100218591 | |||
| 1045 | Ga0068858_100424993 | |||
| 1046 | Ga0068858_102130629 | |||
| 1047 | Ga0068860_100036657 | |||
| 1048 | Ga0068860_100258421 | |||
| 1049 | Ga0068860_100428836 | |||
| 1050 | Ga0068860_100861299 | |||
| 1051 | Ga0068860_101527928 | |||
| 1052 | Ga0068860_102153782 | |||
| 1053 | Ga0070717_10022785 | |||
| 1054 | Ga0070717_10724752 | |||
| 1055 | Ga0070715_10338888 | |||
| 1056 | Ga0070715_10419491 | |||
| 1057 | Ga0070712_100423408 | |||
| 1058 | Ga0070712_100493249 | |||
| 1059 | Ga0097621_100007230 | |||
| 1060 | Ga0097621_100029491 | |||
| 1061 | Ga0097621_100035287 | |||
| 1062 | Ga0097621_100036622 | |||
| 1063 | Ga0097621_100036646 | |||
| 1064 | Ga0097621_100124371 | |||
| 1065 | Ga0097621_100256693 | |||
| 1066 | Ga0097621_100451670 | |||
| 1067 | Ga0097621_100762528 | |||
| 1068 | Ga0097621_100872834 | |||
| 1069 | Ga0068871_100041681 | |||
| 1070 | Ga0068871_100059348 | |||
| 1071 | Ga0068871_100063272 | |||
| 1072 | Ga0068871_100069414 | |||
| 1073 | Ga0068871_100111964 | |||
| 1074 | Ga0068871_100266292 | |||
| 1075 | Ga0068871_100278824 | |||
| 1076 | Ga0068871_100328810 | |||
| 1077 | Ga0068871_100400741 | |||
| 1078 | Ga0068871_100718066 | |||
| 1079 | Ga0068871_100778094 | |||
| 1080 | Ga0068871_100854086 | |||
| 1081 | Ga0075428_101059817 | |||
| 1082 | Ga0075431_100022765 | |||
| 1083 | Ga0075434_100931815 | |||
| 1084 | Ga0075434_101967340 | |||
| 1085 | Ga0068865_100021719 | |||
| 1086 | Ga0068865_100426901 | |||
| 1087 | Ga0068865_100488717 | |||
| 1088 | Ga0075436_101028988 | |||
| 1089 | Ga0097620_100020418 | |||
| 1090 | Ga0097620_100178009 | |||
| 1091 | Ga0097620_100370077 | |||
| 1092 | Ga0097620_100426109 | |||
| 1093 | Ga0097620_101206734 | |||
| 1094 | Ga0099794_10461738 | |||
| 1095 | Ga0105240_10001445 | |||
| 1096 | Ga0105240_10013455 | |||
| 1097 | Ga0105240_10014978 | |||
| 1098 | Ga0105240_10050088 | |||
| 1099 | Ga0105240_10051197 | |||
| 1100 | Ga0105240_10061008 | |||
| 1101 | Ga0105240_10160138 | |||
| 1102 | Ga0105240_10168597 | |||
| 1103 | Ga0105240_10277150 | |||
| 1104 | Ga0105240_10284196 | |||
| 1105 | Ga0105240_10316251 | |||
| 1106 | Ga0105240_11117380 | |||
| 1107 | Ga0105240_11483725 | |||
| 1108 | Ga0111539_10570661 | |||
| 1109 | Ga0105245_10001935 | |||
| 1110 | Ga0105245_10006150 | |||
| 1111 | Ga0105245_10046178 | |||
| 1112 | Ga0105245_10084207 | |||
| 1113 | Ga0105245_10087198 | |||
| 1114 | Ga0105245_10121343 | |||
| 1115 | Ga0105245_10178990 | |||
| 1116 | Ga0105245_10229961 | |||
| 1117 | Ga0105245_10273191 | |||
| 1118 | Ga0105245_10277754 | |||
| 1119 | Ga0105245_10327107 | |||
| 1120 | Ga0105245_10546923 | |||
| 1121 | Ga0105245_10567099 | |||
| 1122 | Ga0105245_12710646 | |||
| 1123 | Ga0105247_10018459 | |||
| 1124 | Ga0105247_10230713 | |||
| 1125 | Ga0114129_10148036 | |||
| 1126 | Ga0105243_10184172 | |||
| 1127 | Ga0105243_10358414 | |||
| 1128 | Ga0105243_11085734 | |||
| 1129 | Ga0105243_11630761 | |||
| 1130 | Ga0105241_10002797 | |||
| 1131 | Ga0105241_10006036 | |||
| 1132 | Ga0105241_10035266 | |||
| 1133 | Ga0105241_10052247 | |||
| 1134 | Ga0105241_10076277 | |||
| 1135 | Ga0105241_10133384 | |||
| 1136 | Ga0105241_10281487 | |||
| 1137 | Ga0105241_10522697 | |||
| 1138 | Ga0105241_10529675 | |||
| 1139 | Ga0105241_11317101 | |||
| 1140 | Ga0105241_11626683 | |||
| 1141 | Ga0105241_11931604 | |||
| 1142 | Ga0105241_12383015 | |||
| 1143 | Ga0105242_10022206 | |||
| 1144 | Ga0105242_10071782 | |||
| 1145 | Ga0105242_10092386 | |||
| 1146 | Ga0105242_10104238 | |||
| 1147 | Ga0105242_10162167 | |||
| 1148 | Ga0105242_10204027 | |||
| 1149 | Ga0105242_10216133 | |||
| 1150 | Ga0105242_10382985 | |||
| 1151 | Ga0105242_11508197 | |||
| 1152 | Ga0105242_11536258 | |||
| 1153 | Ga0105242_12423912 | |||
| 1154 | Ga0105242_12647641 | |||
| 1155 | Ga0105242_12847815 | |||
| 1156 | Ga0105242_12958796 | |||
| 1157 | Ga0105248_10018112 | |||
| 1158 | Ga0105248_10052214 | |||
| 1159 | Ga0105248_10068791 | |||
| 1160 | Ga0105248_10080276 | |||
| 1161 | Ga0105248_10275286 | |||
| 1162 | Ga0105248_10315442 | |||
| 1163 | Ga0105248_10369150 | |||
| 1164 | Ga0105248_10543542 | |||
| 1165 | Ga0105248_10684976 | |||
| 1166 | Ga0105248_10700855 | |||
| 1167 | Ga0105248_10701089 | |||
| 1168 | Ga0105248_10855586 | |||
| 1169 | Ga0105248_11107949 | |||
| 1170 | Ga0105248_11461382 | |||
| 1171 | Ga0105237_10008991 | |||
| 1172 | Ga0105237_10036849 | |||
| 1173 | Ga0105237_10081124 | |||
| 1174 | Ga0105237_10084194 | |||
| 1175 | Ga0105237_10185440 | |||
| 1176 | Ga0105237_10194821 | |||
| 1177 | Ga0105237_10390575 | |||
| 1178 | Ga0105237_10398653 | |||
| 1179 | Ga0105237_10416059 | |||
| 1180 | Ga0105237_10798416 | |||
| 1181 | Ga0105238_10000599 | |||
| 1182 | Ga0105238_10003339 | |||
| 1183 | Ga0105238_10010862 | |||
| 1184 | Ga0105238_10017202 | |||
| 1185 | Ga0105238_10025296 | |||
| 1186 | Ga0105238_10045342 | |||
| 1187 | Ga0105238_10123966 | |||
| 1188 | Ga0105238_10176056 | |||
| 1189 | Ga0105238_10193604 | |||
| 1190 | Ga0105238_10444872 | |||
| 1191 | Ga0105238_10492215 | |||
| 1192 | Ga0105238_11217027 | |||
| 1193 | Ga0105249_10126209 | |||
| 1194 | Ga0105249_10411436 | |||
| 1195 | Ga0105249_11565999 | |||
| 1196 | Ga0105249_12024599 | |||
| 1197 | Ga0105249_12851589 | |||
| 1198 | Ga0105239_10000963 | |||
| 1199 | Ga0105239_10002731 | |||
| 1200 | Ga0105239_10003562 | |||
| 1201 | Ga0105239_10005855 | |||
| 1202 | Ga0105239_10014036 | |||
| 1203 | Ga0105239_10032014 | |||
| 1204 | Ga0105239_10157271 | |||
| 1205 | Ga0105239_10233093 | |||
| 1206 | Ga0105239_10315634 | |||
| 1207 | Ga0105239_10544048 | |||
| 1208 | Ga0105239_12177551 | |||
| 1209 | Ga0105246_10051444 | |||
| 1210 | Ga0105246_10052668 | |||
| 1211 | Ga0105246_10074202 | |||
| 1212 | Ga0105246_10307800 | |||
| 1213 | Ga0105246_10427261 | |||
| 1214 | Ga0105246_10791298 | |||
| 1215 | Ga0105246_11394829 | |||
| 1216 | Ga0157373_10239584 | |||
| 1217 | Ga0157373_11155402 | |||
| 1218 | Ga0157371_10359554 | |||
| 1219 | Ga0157370_10006562 | |||
| 1220 | Ga0157370_10012942 | |||
| 1221 | Ga0157370_10035171 | |||
| 1222 | Ga0157370_10141654 | |||
| 1223 | Ga0157370_10196040 | |||
| 1224 | Ga0157369_10000449 | |||
| 1225 | Ga0157369_10006340 | |||
| 1226 | Ga0157369_10007671 | |||
| 1227 | Ga0157369_10021520 | |||
| 1228 | Ga0157369_10346714 | |||
| 1229 | Ga0157369_10546326 | |||
| 1230 | Ga0157374_10047482 | |||
| 1231 | Ga0157374_10108795 | |||
| 1232 | Ga0157374_10119809 | |||
| 1233 | Ga0157374_10160638 | |||
| 1234 | Ga0157374_10431942 | |||
| 1235 | Ga0157374_11020632 | |||
| 1236 | Ga0157374_11975835 | |||
| 1237 | Ga0157378_10087923 | |||
| 1238 | Ga0157378_10113687 | |||
| 1239 | Ga0157378_10140783 | |||
| 1240 | Ga0157378_10686175 | |||
| 1241 | Ga0157378_10972907 | |||
| 1242 | Ga0157378_11395065 | |||
| 1243 | Ga0157378_11742899 | |||
| 1244 | Ga0163162_10003010 | |||
| 1245 | Ga0163162_10136983 | |||
| 1246 | Ga0163162_10418741 | |||
| 1247 | Ga0163162_10650201 | |||
| 1248 | Ga0163162_10752080 | |||
| 1249 | Ga0163162_10831141 | |||
| 1250 | Ga0163162_11811040 | |||
| 1251 | Ga0163162_11829522 | |||
| 1252 | Ga0163162_11909113 | |||
| 1253 | Ga0157372_10036561 | |||
| 1254 | Ga0157372_10049671 | |||
| 1255 | Ga0157372_10051720 | |||
| 1256 | Ga0157372_10054407 | |||
| 1257 | Ga0157372_10426072 | |||
| 1258 | Ga0157372_10636266 | |||
| 1259 | Ga0157372_10758853 | |||
| 1260 | Ga0157375_10002947 | |||
| 1261 | Ga0157375_10038859 | |||
| 1262 | Ga0157375_10074787 | |||
| 1263 | Ga0157375_10149301 | |||
| 1264 | Ga0157375_10674014 | |||
| 1265 | Ga0157375_10950784 | |||
| 1266 | Ga0157375_11213890 | |||
| 1267 | Ga0157375_11531132 | |||
| 1268 | Ga0157375_11582330 | |||
| 1269 | Ga0157375_11802770 | |||
| 1270 | Ga0163163_10008110 | |||
| 1271 | Ga0163163_10041562 | |||
| 1272 | Ga0163163_10077713 | |||
| 1273 | Ga0163163_10151063 | |||
| 1274 | Ga0163163_10228107 | |||
| 1275 | Ga0163163_10251044 | |||
| 1276 | Ga0163163_10385418 | |||
| 1277 | Ga0163163_10801860 | |||
| 1278 | Ga0163163_11101884 | |||
| 1279 | Ga0157380_10198119 | |||
| 1280 | Ga0157380_11746540 | |||
| 1281 | Ga0157379_10041952 | |||
| 1282 | Ga0157379_10121375 | |||
| 1283 | Ga0157379_10229016 | |||
| 1284 | Ga0157379_10350977 | |||
| 1285 | Ga0157379_10357927 | |||
| 1286 | Ga0157379_10384995 | |||
| 1287 | Ga0157379_11491411 | |||
| 1288 | Ga0157376_10153947 | |||
| 1289 | Ga0157376_10167198 | |||
| 1290 | Ga0157376_10200505 | |||
| 1291 | Ga0157376_10351217 | |||
| 1292 | Ga0157376_10426426 | |||
| 1293 | Ga0157376_10507554 | |||
| 1294 | Ga0157376_10559199 | |||
| 1295 | Ga0157376_10967514 | |||
| 1296 | Ga0157376_11124465 | |||
| 1297 | Ga0157376_11210917 | |||
| 1298 | Ga0157376_11292195 | |||
| 1299 | Ga0163161_10666915 | |||
| 1300 | Ga0163161_11598543 | |||
| 1301 | Ga0213875_10019213 | |||
| 1302 | Ga0207692_10134819 | |||
| 1303 | Ga0207642_10080071 | |||
| 1304 | Ga0207642_10093423 | |||
| 1305 | Ga0207642_10261660 | |||
| 1306 | Ga0207642_10415692 | |||
| 1307 | Ga0207710_10226736 | |||
| 1308 | Ga0207680_10013109 | |||
| 1309 | Ga0207680_10133057 | |||
| 1310 | Ga0207680_10682820 | |||
| 1311 | Ga0207680_10881402 | |||
| 1312 | Ga0207699_10111091 | |||
| 1313 | Ga0207699_10372619 | |||
| 1314 | Ga0207645_10083743 | |||
| 1315 | Ga0207705_10037989 | |||
| 1316 | Ga0207654_10008097 | |||
| 1317 | Ga0207654_10019251 | |||
| 1318 | Ga0207654_10021079 | |||
| 1319 | Ga0207654_10030947 | |||
| 1320 | Ga0207654_10041382 | |||
| 1321 | Ga0207654_10211585 | |||
| 1322 | Ga0207654_10534043 | |||
| 1323 | Ga0207707_10003018 | |||
| 1324 | Ga0207707_10078056 | |||
| 1325 | Ga0207707_10089651 | |||
| 1326 | Ga0207707_10165548 | |||
| 1327 | Ga0207707_10383262 | |||
| 1328 | Ga0207707_10769701 | |||
| 1329 | Ga0207695_10001453 | |||
| 1330 | Ga0207695_10003944 | |||
| 1331 | Ga0207695_10007981 | |||
| 1332 | Ga0207695_10008516 | |||
| 1333 | Ga0207695_10021195 | |||
| 1334 | Ga0207695_10067594 | |||
| 1335 | Ga0207695_10075970 | |||
| 1336 | Ga0207695_10430677 | |||
| 1337 | Ga0207695_11056820 | |||
| 1338 | Ga0207695_11420756 | |||
| 1339 | Ga0207671_10023873 | |||
| 1340 | Ga0207671_10047667 | |||
| 1341 | Ga0207671_10055126 | |||
| 1342 | Ga0207671_10067572 | |||
| 1343 | Ga0207671_10292895 | |||
| 1344 | Ga0207671_11014997 | |||
| 1345 | Ga0207671_11085881 | |||
| 1346 | Ga0207671_11260160 | |||
| 1347 | Ga0207693_10176885 | |||
| 1348 | Ga0207663_10133221 | |||
| 1349 | Ga0207663_10186163 | |||
| 1350 | Ga0207663_10189239 | |||
| 1351 | Ga0207663_10268209 | |||
| 1352 | Ga0207660_10080060 | |||
| 1353 | Ga0207660_10323751 | |||
| 1354 | Ga0207657_10001616 | |||
| 1355 | Ga0207657_10067678 | |||
| 1356 | Ga0207657_10100986 | |||
| 1357 | Ga0207657_10169808 | |||
| 1358 | Ga0207657_11042485 | |||
| 1359 | Ga0207649_10082921 | |||
| 1360 | Ga0207652_10001181 | |||
| 1361 | Ga0207652_10038658 | |||
| 1362 | Ga0207652_10384541 | |||
| 1363 | Ga0207652_10748180 | |||
| 1364 | Ga0207694_10000448 | |||
| 1365 | Ga0207694_10003244 | |||
| 1366 | Ga0207694_10007766 | |||
| 1367 | Ga0207694_10025523 | |||
| 1368 | Ga0207694_10031802 | |||
| 1369 | Ga0207694_10032283 | |||
| 1370 | Ga0207694_10045660 | |||
| 1371 | Ga0207694_10248954 | |||
| 1372 | Ga0207694_10462252 | |||
| 1373 | Ga0207694_10843245 | |||
| 1374 | Ga0207650_10539876 | |||
| 1375 | Ga0207659_10228439 | |||
| 1376 | Ga0207687_10001795 | |||
| 1377 | Ga0207687_10007087 | |||
| 1378 | Ga0207687_10015219 | |||
| 1379 | Ga0207687_10026024 | |||
| 1380 | Ga0207687_10064372 | |||
| 1381 | Ga0207687_10090074 | |||
| 1382 | Ga0207687_10181524 | |||
| 1383 | Ga0207687_10315338 | |||
| 1384 | Ga0207687_10334041 | |||
| 1385 | Ga0207687_10346954 | |||
| 1386 | Ga0207687_10425539 | |||
| 1387 | Ga0207687_10893910 | |||
| 1388 | Ga0207687_11756041 | |||
| 1389 | Ga0207700_10006564 | |||
| 1390 | Ga0207700_10019238 | |||
| 1391 | Ga0207700_10024933 | |||
| 1392 | Ga0207700_10239930 | |||
| 1393 | Ga0207700_10394727 | |||
| 1394 | Ga0207700_10622215 | |||
| 1395 | Ga0207700_11491618 | |||
| 1396 | Ga0207664_10029384 | |||
| 1397 | Ga0207664_10656606 | |||
| 1398 | Ga0207644_10057523 | |||
| 1399 | Ga0207644_10585502 | |||
| 1400 | Ga0207644_10702593 | |||
| 1401 | Ga0207690_10078006 | |||
| 1402 | Ga0207706_10127218 | |||
| 1403 | Ga0207686_10006571 | |||
| 1404 | Ga0207686_10009264 | |||
| 1405 | Ga0207686_10010944 | |||
| 1406 | Ga0207686_10097499 | |||
| 1407 | Ga0207686_10274270 | |||
| 1408 | Ga0207686_10481943 | |||
| 1409 | Ga0207686_10684157 | |||
| 1410 | Ga0207709_10231814 | |||
| 1411 | Ga0207709_10235741 | |||
| 1412 | Ga0207709_10301589 | |||
| 1413 | Ga0207709_10516126 | |||
| 1414 | Ga0207709_11722565 | |||
| 1415 | Ga0207670_10883774 | |||
| 1416 | Ga0207704_10039559 | |||
| 1417 | Ga0207704_10200496 | |||
| 1418 | Ga0207704_10270097 | |||
| 1419 | Ga0207704_10336029 | |||
| 1420 | Ga0207704_10439077 | |||
| 1421 | Ga0207665_10294263 | |||
| 1422 | Ga0207711_10002029 | |||
| 1423 | Ga0207711_10003043 | |||
| 1424 | Ga0207711_10099643 | |||
| 1425 | Ga0207711_10159152 | |||
| 1426 | Ga0207711_10174704 | |||
| 1427 | Ga0207711_10190267 | |||
| 1428 | Ga0207711_10204314 | |||
| 1429 | Ga0207711_10219084 | |||
| 1430 | Ga0207711_10258181 | |||
| 1431 | Ga0207711_10400987 | |||
| 1432 | Ga0207711_11105788 | |||
| 1433 | Ga0207689_10153540 | |||
| 1434 | Ga0207689_10381544 | |||
| 1435 | Ga0207689_10595434 | |||
| 1436 | Ga0207689_10929528 | |||
| 1437 | Ga0207661_10070300 | |||
| 1438 | Ga0207661_10136679 | |||
| 1439 | Ga0207661_10182944 | |||
| 1440 | Ga0207661_10272446 | |||
| 1441 | Ga0207661_10274799 | |||
| 1442 | Ga0207661_10576996 | |||
| 1443 | Ga0207661_11109287 | |||
| 1444 | Ga0207679_10050164 | |||
| 1445 | Ga0207679_10146157 | |||
| 1446 | Ga0207679_10184360 | |||
| 1447 | Ga0207679_10465691 | |||
| 1448 | Ga0207667_10000290 | |||
| 1449 | Ga0207667_10001654 | |||
| 1450 | Ga0207667_10004072 | |||
| 1451 | Ga0207667_10043852 | |||
| 1452 | Ga0207667_10099935 | |||
| 1453 | Ga0207667_10116956 | |||
| 1454 | Ga0207667_10244219 | |||
| 1455 | Ga0207667_10339766 | |||
| 1456 | Ga0207667_10643959 | |||
| 1457 | Ga0207667_11748592 | |||
| 1458 | Ga0207667_11871916 | |||
| 1459 | Ga0207651_10874423 | |||
| 1460 | Ga0207712_10105483 | |||
| 1461 | Ga0207640_10274844 | |||
| 1462 | Ga0207640_11687058 | |||
| 1463 | Ga0207677_10002199 | |||
| 1464 | Ga0207677_10019458 | |||
| 1465 | Ga0207677_10264019 | |||
| 1466 | Ga0207677_10289217 | |||
| 1467 | Ga0207677_10698716 | |||
| 1468 | Ga0207677_10819108 | |||
| 1469 | Ga0207677_11952363 | |||
| 1470 | Ga0207703_10037194 | |||
| 1471 | Ga0207703_10115744 | |||
| 1472 | Ga0207703_10185424 | |||
| 1473 | Ga0207703_10312040 | |||
| 1474 | Ga0207703_10316749 | |||
| 1475 | Ga0207703_10970368 | |||
| 1476 | Ga0207703_11443691 | |||
| 1477 | Ga0207703_12068796 | |||
| 1478 | Ga0207639_10074186 | |||
| 1479 | Ga0207639_10252521 | |||
| 1480 | Ga0207639_10309543 | |||
| 1481 | Ga0207639_10557003 | |||
| 1482 | Ga0207639_10718293 | |||
| 1483 | Ga0207702_10004522 | |||
| 1484 | Ga0207702_10012004 | |||
| 1485 | Ga0207702_10175129 | |||
| 1486 | Ga0207702_10244158 | |||
| 1487 | Ga0207702_10263771 | |||
| 1488 | Ga0207702_10334649 | |||
| 1489 | Ga0207702_11099338 | |||
| 1490 | Ga0207702_11993422 | |||
| 1491 | Ga0207641_10067796 | |||
| 1492 | Ga0207641_10119491 | |||
| 1493 | Ga0207641_10336210 | |||
| 1494 | Ga0207641_10974748 | |||
| 1495 | Ga0207641_11116547 | |||
| 1496 | Ga0207641_11475762 | |||
| 1497 | Ga0207648_10147912 | |||
| 1498 | Ga0207648_10168295 | |||
| 1499 | Ga0207648_11624835 | |||
| 1500 | Ga0207676_10124588 | |||
| 1501 | Ga0207676_10254460 | |||
| 1502 | Ga0207676_10311152 | |||
| 1503 | Ga0207676_10391028 | |||
| 1504 | Ga0207676_10795226 | |||
| 1505 | Ga0207676_11278122 | |||
| 1506 | Ga0207676_11923987 | |||
| 1507 | Ga0207674_10000985 | |||
| 1508 | Ga0207674_10019772 | |||
| 1509 | Ga0207674_10055454 | |||
| 1510 | Ga0207674_10059067 | |||
| 1511 | Ga0207674_11820290 | |||
| 1512 | Ga0207675_101727854 | |||
| 1513 | Ga0207683_10691174 | |||
| 1514 | Ga0207698_10269267 | |||
| 1515 | Ga0207698_11091896 | |||
| 1516 | Ga0207698_11245371 | |||
| 1517 | Ga0207698_11344436 | |||
| 1518 | Ga0209588_1193079 | |||
| 1519 | Ga0268266_10003108 | |||
| 1520 | Ga0268266_11377961 | |||
| 1521 | Ga0268264_10054641 | |||
| 1522 | Ga0268264_10137809 | |||
| 1523 | Ga0268264_10231885 | |||
| 1524 | Ga0268264_11040024 | |||
| 1525 | Ga0268264_11932919 | |||
| 1526 | Ga0265338_10408391 | |||
| 1527 | Ga0265760_10071018 | |||
| 1528 | Ga0265332_10024535 | |||
| 1529 | Ga0265325_10106269 | |||
| 1530 | Ga0265339_10148325 | |||
| 1531 | Ga0265331_10040901 | |||
| 1532 | Ga0265331_10068858 | |||
| 1533 | Ga0265331_10379035 | |||
| 1534 | Ga0265316_10007594 | |||
| 1535 | Ga0265316_10013946 | |||
| 1536 | Ga0265316_10048971 | |||
| 1537 | Ga0265316_10065984 | |||
| 1538 | Ga0265316_10070056 | |||
| 1539 | Ga0265316_10092048 | |||
| 1540 | Ga0265316_10151436 | |||
| 1541 | Ga0265316_10154524 | |||
| 1542 | Ga0265316_10227713 | |||
| 1543 | Ga0265313_10005690 | |||
| 1544 | Ga0265313_10096410 | |||
| 1545 | Ga0265313_10180192 | |||
| 1546 | Ga0265314_10000559 | |||
| 1547 | Ga0265314_10000932 | |||
| 1548 | Ga0265314_10063352 | |||
| 1549 | Ga0265314_10109185 | |||
| 1550 | Ga0265314_10206687 | |||
| 1551 | Ga0265342_10352392 | |||
| 1552 | Ga0373926_0208252 | |||
| 1553 | Ga0373934_0001924 | |||
| 1554 | Ga0373934_0034130 | |||
| 1555 | Ga0373934_0048464 | |||
| 1556 | Ga0373923_0015943 | |||
| 1557 | Ga0373936_0139542 | |||
| 1558 | Ga0373945_0359735 | |||
| 1559 | Ga0373953_0266112 | |||
| 1560 | Ga0373953_0289914 | |||
| 1561 | Ga0373954_0002014 | |||
| 1562 | Ga0373954_0217849 | |||
| 1563 | Ga0373956_0038601 | |||
| 1564 | Ga0373956_0473747 | |||
| 1565 | Ga0373957_0169538 | |||
| 1566 | Ga0373960_0344921 | |||
| 1567 | Ga0373943_0014711 | |||
| 1568 | Ga0373943_0038001 | |||
| 1569 | Ga0373943_0367708 | |||
| 1570 | Ga0373943_0527193 | |||
| 1571 | Ga0373946_0121181 | |||
| 1572 | Ga0373955_0023707 | |||
| 1573 | Ga0373955_0123148 | |||
| 1574 | Ga0373955_0142744 | |||
| 1575 | Ga0373924_0148084 | |||
| 1576 | Ga0373935_0162041 | |||
| 1577 | Ga0373935_0362754 | |||
| 1578 | Ga0373935_0420553 | |||
| 1579 | Ga0373935_0843837 | |||
| 1580 | Ga0373927_0003424 | |||
| 1581 | Ga0373927_0075373 | |||
| 1582 | Ga0373927_0258526 | |||
| 1583 | Ga0373927_0260657 | |||
| 1584 | Ga0373927_0596064 | |||
| 1585 | Ga0373933_0079161 | |||
| 1586 | Ga0373933_0448942 | |||
| 1587 | Ga0373933_0512078 | |||
| 1588 | Ga0373947_0003449 | |||
| 1589 | Ga0373947_0274520 | |||
| 1590 | Ga0373947_0678450 | |||
| 1591 | Ga0373947_0880674 | |||
| 1592 | Ga0373947_0965936 | |||
| 1593 | Ga0373947_1265034 | |||
| 1594 | Ga0373937_0001907 | |||
| 1595 | Ga0373937_0020084 | |||
| 1596 | Ga0373937_0057467 | |||
| 1597 | Ga0373937_0137776 | |||
| 1598 | Ga0373937_0197728 | |||
| 1599 | Ga0373937_0368066 | |||
| 1600 | Ga0373937_0389586 | |||
| 1601 | Ga0373937_0492129 | |||
| 1602 | Ga0373925_0001244 | |||
| 1603 | Ga0373925_0017973 | |||
| 1604 | Ga0373925_0079912 | |||
| 1605 | Ga0373925_0099449 | |||
| 1606 | Ga0373925_0246478 | |||
| 1607 | Ga0373925_0292436 | |||
| 1608 | Ga0373925_0328371 | |||
| 1609 | Ga0373925_0417960 | |||
| 1610 | Ga0373925_0974647 | |||
| 1611 | Ga0436364_0634814 | |||
| 1612 | Ga0436364_0680395 | |||
| 1613 | Ga0436364_1261791 | |||
| 1614 | Ga0436364_1424376 | |||
| 1615 | Ga0242420_118898 | |||
| 1616 | Ga0436365_0496136 | |||
| 1617 | Ga0436365_1778402 | |||
| 1618 | Ga0436360_1273375 | |||
| 1619 | Ga0451839_1534484 | |||
| 1620 | Ga0451853_2905678 | |||
| 1621 | Ga0453684_0251538 | |||
| 1622 | Ga0451576_0026734 | |||
| 1623 | Ga0451576_0566931 | |||
| 1624 | Ga0451576_0936164 | |||
| 1625 | Ga0451576_2298897 | |||
| 1626 | Ga0495592_0012783 | |||
| 1627 | Ga0495592_0029959 | |||
| 1628 | Ga0495651_0029066 | |||
| 1629 | Ga0495651_0239089 | |||
| 1630 | Ga0495653_0282738 | |||
| 1631 | Ga0495653_0397888 | |||
| 1632 | Ga0495653_0712770 | |||
| 1633 | Ga0495580_0000307 | |||
| 1634 | Ga0495580_0061918 | |||
| 1635 | Ga0495580_0269560 | |||
| 1636 | Ga0495580_0345047 | |||
| 1637 | Ga0495580_0346643 | |||
| 1638 | Ga0495580_0546433 | |||
| 1639 | Ga0495582_0011352 | |||
| 1640 | Ga0495639_0414826 | |||
| 1641 | Ga0495664_0013254 | |||
| 1642 | Ga0495664_0508738 | |||
| 1643 | Ga0495664_0581877 | |||
| 1644 | Ga0495594_0131671 | |||
| 1645 | Ga0495594_0178198 | |||
| 1646 | Ga0495594_0240751 | |||
| 1647 | Ga0495594_0356019 | |||
| 1648 | Ga0495618_0255258 | |||
| 1649 | Ga0495628_0024119 | |||
| 1650 | Ga0495628_0059017 | |||
| 1651 | Ga0495628_0068257 | |||
| 1652 | Ga0495628_0591773 | |||
| 1653 | Ga0495628_0720547 | |||
| 1654 | Ga0495630_0018918 | |||
| 1655 | Ga0495630_0168767 | |||
| 1656 | Ga0495666_0085266 | |||
| 1657 | Ga0495652_0040924 | |||
| 1658 | Ga0495652_0118195 | |||
| 1659 | Ga0495652_0175855 | |||
| 1660 | Ga0495652_0253109 | |||
| 1661 | Ga0495652_0646580 | |||
| 1662 | Ga0495665_0085194 | |||
| 1663 | Ga0495665_0181226 | |||
| 1664 | Ga0495665_0198207 | |||
| 1665 | Ga0495665_0208968 | |||
| 1666 | Ga0495640_0048723 | |||
| 1667 | Ga0495586_0111443 | |||
| 1668 | Ga0495586_0273994 | |||
| 1669 | Ga0495586_0288036 | |||
| 1670 | Ga0495587_0001113 | |||
| 1671 | Ga0495587_0045658 | |||
| 1672 | Ga0495587_0076792 | |||
| 1673 | Ga0495587_0178035 | |||
| 1674 | Ga0495645_0002625 | |||
| 1675 | Ga0495645_0343442 | |||
| 1676 | Ga0495645_0670234 | |||
| 1677 | Ga0495633_0214867 | |||
| 1678 | Ga0495667_0300376 | |||
| 1679 | Ga0495634_0071303 | |||
| 1680 | Ga0495634_0077186 | |||
| 1681 | Ga0495635_0882156 | |||
| 1682 | Ga0495599_0004841 | |||
| 1683 | Ga0495599_0007068 | |||
| 1684 | Ga0495599_0058293 | |||
| 1685 | Ga0495599_0312479 | |||
| 1686 | Ga0495623_0171961 | |||
| 1687 | Ga0495623_0363307 | |||
| 1688 | Ga0495623_0501937 | |||
| 1689 | Ga0495623_0624217 | |||
| 1690 | Ga0495646_0257567 | |||
| 1691 | Ga0495658_0166869 | |||
| 1692 | Ga0495658_0603580 | |||
| 1693 | Ga0495669_0133631 | |||
| 1694 | Ga0495669_0388141 | |||
| 1695 | Ga0495613_0090378 | |||
| 1696 | Ga0495613_0132561 | |||
| 1697 | Ga0495613_0247721 | |||
| 1698 | Ga0495613_0961336 | |||
| 1699 | Ga0495600_0053298 | |||
| 1700 | Ga0495600_0305439 | |||
| 1701 | Ga0495604_0153282 | |||
| 1702 | Ga0495604_0156996 | |||
| 1703 | Ga0495604_0923559 | |||
| 1704 | Ga0495636_0088624 | |||
| 1705 | Ga0495674_0045746 | |||
| 1706 | Ga0495674_0051721 | |||
| 1707 | Ga0495674_0287979 | |||
| 1708 | Ga0495674_0308153 | |||
| 1709 | Ga0495674_0406935 | |||
| 1710 | Ga0495674_0715622 | |||
| 1711 | Ga0495680_0247480 | |||
| 1712 | Ga0495680_0479888 | |||
| 1713 | Ga0495675_0068772 | |||
| 1714 | Ga0495675_0115713 | |||
| 1715 | Ga0495675_0136572 | |||
| 1716 | Ga0495684_0004128 | |||
| 1717 | Ga0495684_0016021 | |||
| 1718 | Ga0495684_0024166 | |||
| 1719 | Ga0495684_0065364 | |||
| 1720 | Ga0495684_0180024 | |||
| 1721 | Ga0495684_0272439 | |||
| 1722 | Ga0495684_0720098 | |||
| 1723 | Ga0495593_0133971 | |||
| 1724 | Ga0495593_0138230 | |||
| 1725 | Ga0495602_0001372 | |||
| 1726 | Ga0495602_0118037 | |||
| 1727 | Ga0495602_0180894 | |||
| 1728 | Ga0495602_0184490 | |||
| 1729 | Ga0496102_1062717 | |||
| 1730 | Ga0496104_0259643 | |||
| 1731 | Ga0496105_0216939 | |||
| 1732 | Ga0496115_0046537 | |||
| 1733 | Ga0496115_0162753 | |||
| 1734 | Ga0496115_0285517 | |||
| 1735 | Ga0501073_0931105 | |||
| 1736 | nmdc:mga05p37_108043_c1 | |||
| 1737 | nmdc:mga06r32_59860_c1 | |||
| 1738 | nmdc:mga08y16_526036_c1 | |||
| 1739 | nmdc:mga0n895_1485647_c1 | |||
| 1740 | Ga0495601_0077502 | |||
| 1741 | Ga0495601_0166533 | |||
| 1742 | Ga0495601_0232250 | |||
| 1743 | Ga0495601_0277554 | |||
| 1744 | Ga0495619_0784833 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r2d-assembly1.cif.gz_A | crystal structure of antitermination factors nusb and nuse in complex with dsrna | 0.8789 | 1 | 137 |
| 4eya-assembly1.cif.gz_A | crystal structure of a plectonemic rna supercoil | 0.8628 | 1 | 142 |
| 1eyv-assembly1.cif.gz_A | the crystal structure of nusb from mycobacterium tuberculosis | 0.8622 | 4 | 134 |
| 3r2d-assembly1.cif.gz_A | crystal structure of antitermination factors nusb and nuse in complex with dsrna | 0.8605 | 1 | 137 |
| 4eya-assembly1.cif.gz_A | crystal structure of a plectonemic rna supercoil | 0.8569 | 1 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r2cB00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.8913 | 1 | 137 | 1.10.940.10 |
| af_P9WIV1_1_139_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.8828 | 1 | 134 | 1.10.940.10 |
| af_P9WGX3_13_148_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.8709 | 7 | 134 | 1.10.940.10 |
| af_Q2FY45_1_129_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.8707 | 4 | 134 | 1.10.940.10 |
| 4eyaA00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.8628 | 1 | 142 | 1.10.940.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0NFI9-F1-model_v4 | Transcription antitermination factor NusB | 0.9714 | 57 | 139 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-X0VZ87-F1-model_v4 | NusB/RsmB/TIM44 domain-containing protein | 0.9693 | 50 | 136 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A7V9VDP9-F1-model_v4 | Transcription antitermination protein NusB | 0.9633 | 53 | 139 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A5T1FJI6-F1-model_v4 | Transcription antitermination factor NusB | 0.9631 | 51 | 138 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A7R8GCD7-F1-model_v4 | deleted | 0.9627 | 1 | 138 |
|