F484221

General Info

Members Datasets Scaffolds Average Seq Length
872 236 1744 140

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10318326|Ga0265316_103183262
Length 166
Sequence MPSRHKSRQRALQILFLWDARRQPEAAEAYPLAAAIDAYYDTLFPEEAPERDPFTAALVSGTVERLPEMDELIAKHAEHWRMERMPNVDRNILRLAAYEMAHGGTPAAVAIDEALELARKFSNEESVQFVNGVLDAIHRGLAAPGGGTPREGLSDPGASAEADAAS

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10318326 3300031344 Bacteria 1130
2 Ga0070658_10015689 3300005327 Bacteria 6059
3 Ga0070658_10355692 3300005327 Bacteria 1254
4 Ga0070676_10908687 3300005328 Bacteria 656
5 Ga0070683_100001320 3300005329 Bacteria 18868
6 Ga0070683_100050718 3300005329 Bacteria 3843
7 Ga0070683_100080053 3300005329 Bacteria 3058
8 Ga0070683_100080252 3300005329 Bacteria 3054
9 Ga0070683_100170856 3300005329 Bacteria 2063
10 Ga0070683_100186158 3300005329 Bacteria 1971
11 Ga0070683_100334677 3300005329 Bacteria 1441
12 Ga0070683_100583276 3300005329 Unclassified 1069
13 Ga0070683_100939060 3300005329 Unclassified 830
14 Ga0070690_100029704 3300005330 Bacteria 3392
15 Ga0070670_101130193 3300005331 Bacteria 715
16 Ga0070677_10502500 3300005333 Bacteria 657
17 Ga0068869_100006386 3300005334 Bacteria 7474
18 Ga0068869_100285526 3300005334 Bacteria 1328
19 Ga0068869_100361691 3300005334 Unclassified 1185
20 Ga0068869_102121466 3300005334 Unclassified 505
21 Ga0070666_10066266 3300005335 Bacteria 2450
22 Ga0070666_10071960 3300005335 Bacteria 2354
23 Ga0070666_10239150 3300005335 Bacteria 1284
24 Ga0070666_10678038 3300005335 Bacteria 755
25 Ga0070666_11179637 3300005335 Unclassified 570
26 Ga0070680_100104591 3300005336 Bacteria 2353
27 Ga0070680_100432699 3300005336 Bacteria 1123
28 Ga0068868_100001744 3300005338 Bacteria 14909
29 Ga0068868_100053470 3300005338 Bacteria 3181
30 Ga0068868_100132719 3300005338 Bacteria 2039
31 Ga0068868_100281096 3300005338 Bacteria 1409
32 Ga0068868_100436916 3300005338 Bacteria 1136
33 Ga0068868_101936356 3300005338 Unclassified 559
34 Ga0070660_100102518 3300005339 Bacteria 2268
35 Ga0070660_100172120 3300005339 Bacteria 1749
36 Ga0070660_101291229 3300005339 Unclassified 619
37 Ga0070661_100112172 3300005344 Bacteria 2037
38 Ga0070692_10264130 3300005345 Bacteria 1036
39 Ga0070669_101003533 3300005353 Bacteria 716
40 Ga0070675_100355876 3300005354 Bacteria 1299
41 Ga0070671_100007174 3300005355 Bacteria 8910
42 Ga0070671_100829009 3300005355 Bacteria 806
43 Ga0070671_100957374 3300005355 Unclassified 749
44 Ga0070674_100331670 3300005356 Bacteria 1223
45 Ga0070674_100374899 3300005356 Unclassified 1156
46 Ga0070674_100423931 3300005356 Bacteria 1092
47 Ga0070674_102091490 3300005356 Unclassified 516
48 Ga0070673_100012445 3300005364 Bacteria 5842
49 Ga0070673_100643639 3300005364 Bacteria 970
50 Ga0070659_100020791 3300005366 Bacteria 4991
51 Ga0070659_100393609 3300005366 Bacteria 1169
52 Ga0070667_100056048 3300005367 Bacteria 3329
53 Ga0070667_100840407 3300005367 Bacteria 853
54 Ga0070709_10264129 3300005434 Unclassified 1245
55 Ga0070709_10272504 3300005434 Bacteria 1227
56 Ga0070709_10568777 3300005434 Bacteria 869
57 Ga0070709_11434257 3300005434 Unclassified 559
58 Ga0070709_11458823 3300005434 Bacteria 555
59 Ga0070714_100012429 3300005435 Bacteria 6798
60 Ga0070714_100463491 3300005435 Bacteria 1205
61 Ga0070714_100674412 3300005435 Bacteria 996
62 Ga0070714_101222568 3300005435 Bacteria 733
63 Ga0070713_100025779 3300005436 Bacteria 4603
64 Ga0070713_100200151 3300005436 Bacteria 1803
65 Ga0070713_100220185 3300005436 Bacteria 1721
66 Ga0070713_100279253 3300005436 Bacteria 1532
67 Ga0070713_100323441 3300005436 Bacteria 1425
68 Ga0070713_100697699 3300005436 Bacteria 969
69 Ga0070713_100762342 3300005436 Unclassified 926
70 Ga0070713_102163661 3300005436 Unclassified 539
71 Ga0070710_11053418 3300005437 Unclassified 595
72 Ga0070710_11165808 3300005437 Bacteria 568
73 Ga0070710_11171025 3300005437 Unclassified 567
74 Ga0070711_100287619 3300005439 Bacteria 1303
75 Ga0070711_100472720 3300005439 Bacteria 1029
76 Ga0070711_100884634 3300005439 Bacteria 761
77 Ga0070711_101170802 3300005439 Unclassified 664
78 Ga0070705_101110132 3300005440 Bacteria 647
79 Ga0070708_100901636 3300005445 Bacteria 830
80 Ga0070678_100851390 3300005456 Bacteria 831
81 Ga0070678_100954362 3300005456 Unclassified 786
82 Ga0070662_100043876 3300005457 Unclassified 3201
83 Ga0070681_10005962 3300005458 Bacteria 11798
84 Ga0070681_10022598 3300005458 Bacteria 6316
85 Ga0070681_10081652 3300005458 Bacteria 3189
86 Ga0070681_10582423 3300005458 Bacteria 1033
87 Ga0070681_10934700 3300005458 Unclassified 786
88 Ga0070681_11264776 3300005458 Bacteria 660
89 Ga0068867_100115638 3300005459 Bacteria 2066
90 Ga0068867_100171948 3300005459 Bacteria 1717
91 Ga0068867_100911976 3300005459 Bacteria 791
92 Ga0068867_101885925 3300005459 Bacteria 563
93 Ga0070685_10247082 3300005466 Bacteria 1180
94 Ga0070706_102040920 3300005467 Bacteria 519
95 Ga0070698_100868665 3300005471 Bacteria 847
96 Ga0070699_100118807 3300005518 Bacteria 2324
97 Ga0070679_100027969 3300005530 Bacteria 5556
98 Ga0070679_100113318 3300005530 Unclassified 2697
99 Ga0070679_100650400 3300005530 Bacteria 997
100 Ga0070679_100922093 3300005530 Bacteria 817
101 Ga0070684_100023948 3300005535 Bacteria 5115
102 Ga0070684_100067426 3300005535 Bacteria 3143
103 Ga0070684_100146401 3300005535 Bacteria 2138
104 Ga0070684_100503423 3300005535 Unclassified 1122
105 Ga0070684_100838306 3300005535 Bacteria 860
106 Ga0070684_101276142 3300005535 Bacteria 691
107 Ga0070697_100303270 3300005536 Bacteria 1373
108 Ga0070697_101216812 3300005536 Unclassified 671
109 Ga0068853_100082083 3300005539 Bacteria 2823
110 Ga0068853_100185918 3300005539 Bacteria 1886
111 Ga0068853_100495514 3300005539 Bacteria 1153
112 Ga0068853_100789554 3300005539 Bacteria 909
113 Ga0070686_100373484 3300005544 Bacteria 1077
114 Ga0070693_100102548 3300005547 Bacteria 1745
115 Ga0070693_100733955 3300005547 Bacteria 726
116 Ga0070665_100008566 3300005548 Bacteria 10349
117 Ga0070665_100573409 3300005548 Bacteria 1141
118 Ga0070665_101687377 3300005548 Bacteria 641
119 Ga0070704_101002270 3300005549 Unclassified 755
120 Ga0068855_100005945 3300005563 Bacteria 14877
121 Ga0068855_100010509 3300005563 Bacteria 11167
122 Ga0068855_100100226 3300005563 Bacteria 3335
123 Ga0068855_100113686 3300005563 Bacteria 3105
124 Ga0068855_100134125 3300005563 Unclassified 2826
125 Ga0068855_100137356 3300005563 Unclassified 2788
126 Ga0068855_100259923 3300005563 Bacteria 1934
127 Ga0068855_100602952 3300005563 Unclassified 1184
128 Ga0068855_100682187 3300005563 Bacteria 1101
129 Ga0070664_100250560 3300005564 Bacteria 1592
130 Ga0070664_100313761 3300005564 Bacteria 1419
131 Ga0070664_100780039 3300005564 Bacteria 893
132 Ga0070664_101682295 3300005564 Unclassified 601
133 Ga0070664_101701966 3300005564 Bacteria 598
134 Ga0068857_100002818 3300005577 Bacteria 14302
135 Ga0068857_100533172 3300005577 Bacteria 1104
136 Ga0068857_100695890 3300005577 Bacteria 965
137 Ga0068854_100135051 3300005578 Unclassified 1888
138 Ga0068854_100563776 3300005578 Unclassified 968
139 Ga0068856_100025021 3300005614 Bacteria 5818
140 Ga0068856_100066090 3300005614 Bacteria 3573
141 Ga0068856_100194620 3300005614 Bacteria 2041
142 Ga0068856_100253203 3300005614 Bacteria 1776
143 Ga0068856_100260362 3300005614 Bacteria 1750
144 Ga0068856_100475033 3300005614 Bacteria 1271
145 Ga0068856_100480456 3300005614 Bacteria 1263
146 Ga0068856_100931953 3300005614 Unclassified 887
147 Ga0070702_100833148 3300005615 Unclassified 716
148 Ga0068852_100008043 3300005616 Bacteria 7735
149 Ga0068852_100174804 3300005616 Bacteria 2015
150 Ga0068859_100020418 3300005617 Bacteria 6649
151 Ga0068859_100178016 3300005617 Bacteria 2209
152 Ga0068859_100370092 3300005617 Bacteria 1528
153 Ga0068859_100426099 3300005617 Bacteria 1423
154 Ga0068859_101207000 3300005617 Bacteria 833
155 Ga0068864_100047345 3300005618 Bacteria 3692
156 Ga0068864_100355570 3300005618 Unclassified 1383
157 Ga0068864_100381523 3300005618 Bacteria 1336
158 Ga0068864_100464192 3300005618 Bacteria 1213
159 Ga0068864_100616238 3300005618 Bacteria 1054
160 Ga0068864_101886380 3300005618 Bacteria 603
161 Ga0068866_10143807 3300005718 Bacteria 1373
162 Ga0068866_10453919 3300005718 Bacteria 839
163 Ga0068866_10697109 3300005718 Bacteria 696
164 Ga0068866_11387748 3300005718 Bacteria 513
165 Ga0068863_100031885 3300005841 Bacteria 5027
166 Ga0068863_100140513 3300005841 Bacteria 2308
167 Ga0068863_100762428 3300005841 Bacteria 964
168 Ga0068858_100073443 3300005842 Bacteria 3174
169 Ga0068858_100141925 3300005842 Unclassified 2255
170 Ga0068858_100161660 3300005842 Bacteria 2109
171 Ga0068858_100194691 3300005842 Bacteria 1916
172 Ga0068858_100218591 3300005842 Bacteria 1804
173 Ga0068858_100424993 3300005842 Bacteria 1278
174 Ga0068858_102130629 3300005842 Unclassified 554
175 Ga0068860_100036657 3300005843 Bacteria 4697
176 Ga0068860_100258421 3300005843 Bacteria 1697
177 Ga0068860_100428836 3300005843 Bacteria 1312
178 Ga0068860_100861299 3300005843 Bacteria 921
179 Ga0068860_101527928 3300005843 Unclassified 689
180 Ga0068860_102153782 3300005843 Bacteria 579
181 Ga0070717_10022785 3300006028 Bacteria 4954
182 Ga0070717_10724752 3300006028 Bacteria 904
183 Ga0070715_10338888 3300006163 Bacteria 817
184 Ga0070715_10419491 3300006163 Bacteria 748
185 Ga0070712_100423408 3300006175 Bacteria 1104
186 Ga0070712_100493249 3300006175 Unclassified 1026
187 Ga0097621_100007230 3300006237 Bacteria 7925
188 Ga0097621_100029491 3300006237 Bacteria 4333
189 Ga0097621_100035287 3300006237 Bacteria 3995
190 Ga0097621_100036622 3300006237 Bacteria 3926
191 Ga0097621_100036646 3300006237 Bacteria 3924
192 Ga0097621_100124371 3300006237 Bacteria 2190
193 Ga0097621_100256693 3300006237 Bacteria 1532
194 Ga0097621_100451670 3300006237 Bacteria 1158
195 Ga0097621_100762528 3300006237 Unclassified 894
196 Ga0097621_100872834 3300006237 Bacteria 837
197 Ga0068871_100041681 3300006358 Bacteria 3682
198 Ga0068871_100059348 3300006358 Unclassified 3117
199 Ga0068871_100063272 3300006358 Bacteria 3026
200 Ga0068871_100069414 3300006358 Bacteria 2894
201 Ga0068871_100111964 3300006358 Bacteria 2296
202 Ga0068871_100266292 3300006358 Bacteria 1496
203 Ga0068871_100278824 3300006358 Unclassified 1462
204 Ga0068871_100328810 3300006358 Bacteria 1348
205 Ga0068871_100400741 3300006358 Bacteria 1222
206 Ga0068871_100718066 3300006358 Bacteria 917
207 Ga0068871_100778094 3300006358 Bacteria 881
208 Ga0068871_100854086 3300006358 Bacteria 841
209 Ga0075428_101059817 3300006844 Unclassified 857
210 Ga0075431_100022765 3300006847 Bacteria 6404
211 Ga0075434_100931815 3300006871 Bacteria 883
212 Ga0075434_101967340 3300006871 Unclassified 590
213 Ga0068865_100021719 3300006881 Unclassified 4178
214 Ga0068865_100426901 3300006881 Bacteria 1091
215 Ga0068865_100488717 3300006881 Bacteria 1024
216 Ga0075436_101028988 3300006914 Unclassified 619
217 Ga0097620_100020418 3300006931 Bacteria 6649
218 Ga0097620_100178009 3300006931 Bacteria 2209
219 Ga0097620_100370077 3300006931 Bacteria 1528
220 Ga0097620_100426109 3300006931 Bacteria 1423
221 Ga0097620_101206734 3300006931 Bacteria 833
222 Ga0099794_10461738 3300007265 Bacteria 666
223 Ga0105240_10001445 3300009093 Bacteria 40579
224 Ga0105240_10013455 3300009093 Bacteria 11237
225 Ga0105240_10014978 3300009093 Bacteria 10565
226 Ga0105240_10050088 3300009093 Bacteria 5268
227 Ga0105240_10051197 3300009093 Bacteria 5199
228 Ga0105240_10061008 3300009093 Bacteria 4700
229 Ga0105240_10160138 3300009093 Bacteria 2674
230 Ga0105240_10168597 3300009093 Bacteria 2595
231 Ga0105240_10277150 3300009093 Bacteria 1928
232 Ga0105240_10284196 3300009093 Bacteria 1899
233 Ga0105240_10316251 3300009093 Unclassified 1781
234 Ga0105240_11117380 3300009093 Bacteria 838
235 Ga0105240_11483725 3300009093 Bacteria 711
236 Ga0111539_10570661 3300009094 Bacteria 1318
237 Ga0105245_10001935 3300009098 Bacteria 18814
238 Ga0105245_10006150 3300009098 Bacteria 10564
239 Ga0105245_10046178 3300009098 Bacteria 3892
240 Ga0105245_10084207 3300009098 Bacteria 2912
241 Ga0105245_10087198 3300009098 Bacteria 2865
242 Ga0105245_10121343 3300009098 Bacteria 2442
243 Ga0105245_10178990 3300009098 Bacteria 2024
244 Ga0105245_10229961 3300009098 Unclassified 1793
245 Ga0105245_10273191 3300009098 Bacteria 1649
246 Ga0105245_10277754 3300009098 Bacteria 1636
247 Ga0105245_10327107 3300009098 Bacteria 1512
248 Ga0105245_10546923 3300009098 Bacteria 1179
249 Ga0105245_10567099 3300009098 Bacteria 1159
250 Ga0105245_12710646 3300009098 Unclassified 549
251 Ga0105247_10018459 3300009101 Bacteria 4183
252 Ga0105247_10230713 3300009101 Bacteria 1257
253 Ga0114129_10148036 3300009147 Bacteria 3215
254 Ga0105243_10184172 3300009148 Bacteria 1818
255 Ga0105243_10358414 3300009148 Bacteria 1341
256 Ga0105243_11085734 3300009148 Bacteria 808
257 Ga0105243_11630761 3300009148 Bacteria 672
258 Ga0105241_10002797 3300009174 Bacteria 13060
259 Ga0105241_10006036 3300009174 Bacteria 8937
260 Ga0105241_10035266 3300009174 Unclassified 3762
261 Ga0105241_10052247 3300009174 Bacteria 3119
262 Ga0105241_10076277 3300009174 Bacteria 2614
263 Ga0105241_10133384 3300009174 Unclassified 2013
264 Ga0105241_10281487 3300009174 Bacteria 1420
265 Ga0105241_10522697 3300009174 Bacteria 1061
266 Ga0105241_10529675 3300009174 Unclassified 1055
267 Ga0105241_11317101 3300009174 Bacteria 688
268 Ga0105241_11626683 3300009174 Bacteria 625
269 Ga0105241_11931604 3300009174 Bacteria 579
270 Ga0105241_12383015 3300009174 Bacteria 528
271 Ga0105242_10022206 3300009176 Bacteria 4987
272 Ga0105242_10071782 3300009176 Bacteria 2874
273 Ga0105242_10092386 3300009176 Unclassified 2549
274 Ga0105242_10104238 3300009176 Bacteria 2407
275 Ga0105242_10162167 3300009176 Bacteria 1958
276 Ga0105242_10204027 3300009176 Bacteria 1758
277 Ga0105242_10216133 3300009176 Bacteria 1711
278 Ga0105242_10382985 3300009176 Bacteria 1308
279 Ga0105242_11508197 3300009176 Bacteria 703
280 Ga0105242_11536258 3300009176 Bacteria 697
281 Ga0105242_12423912 3300009176 Bacteria 572
282 Ga0105242_12647641 3300009176 Unclassified 551
283 Ga0105242_12847815 3300009176 Unclassified 534
284 Ga0105242_12958796 3300009176 Unclassified 525
285 Ga0105248_10018112 3300009177 Bacteria 7776
286 Ga0105248_10052214 3300009177 Bacteria 4587
287 Ga0105248_10068791 3300009177 Unclassified 3975
288 Ga0105248_10080276 3300009177 Bacteria 3666
289 Ga0105248_10275286 3300009177 Bacteria 1895
290 Ga0105248_10315442 3300009177 Bacteria 1761
291 Ga0105248_10369150 3300009177 Bacteria 1616
292 Ga0105248_10543542 3300009177 Bacteria 1310
293 Ga0105248_10684976 3300009177 Bacteria 1156
294 Ga0105248_10700855 3300009177 Bacteria 1142
295 Ga0105248_10701089 3300009177 Bacteria 1142
296 Ga0105248_10855586 3300009177 Bacteria 1026
297 Ga0105248_11107949 3300009177 Bacteria 895
298 Ga0105248_11461382 3300009177 Bacteria 774
299 Ga0105237_10008991 3300009545 Bacteria 10747
300 Ga0105237_10036849 3300009545 Bacteria 4947
301 Ga0105237_10081124 3300009545 Bacteria 3234
302 Ga0105237_10084194 3300009545 Bacteria 3171
303 Ga0105237_10185440 3300009545 Bacteria 2081
304 Ga0105237_10194821 3300009545 Unclassified 2026
305 Ga0105237_10390575 3300009545 Bacteria 1396
306 Ga0105237_10398653 3300009545 Bacteria 1381
307 Ga0105237_10416059 3300009545 Bacteria 1349
308 Ga0105237_10798416 3300009545 Bacteria 951
309 Ga0105238_10000599 3300009551 Bacteria 37847
310 Ga0105238_10003339 3300009551 Bacteria 16014
311 Ga0105238_10010862 3300009551 Bacteria 9152
312 Ga0105238_10017202 3300009551 Bacteria 7345
313 Ga0105238_10025296 3300009551 Bacteria 6050
314 Ga0105238_10045342 3300009551 Unclassified 4441
315 Ga0105238_10123966 3300009551 Bacteria 2563
316 Ga0105238_10176056 3300009551 Bacteria 2116
317 Ga0105238_10193604 3300009551 Bacteria 2009
318 Ga0105238_10444872 3300009551 Bacteria 1292
319 Ga0105238_10492215 3300009551 Unclassified 1226
320 Ga0105238_11217027 3300009551 Bacteria 778
321 Ga0105249_10126209 3300009553 Bacteria 2437
322 Ga0105249_10411436 3300009553 Bacteria 1385
323 Ga0105249_11565999 3300009553 Bacteria 731
324 Ga0105249_12024599 3300009553 Bacteria 648
325 Ga0105249_12851589 3300009553 Bacteria 555
326 Ga0105239_10000963 3300010375 Bacteria 40408
327 Ga0105239_10002731 3300010375 Bacteria 22158
328 Ga0105239_10003562 3300010375 Bacteria 19042
329 Ga0105239_10005855 3300010375 Bacteria 14331
330 Ga0105239_10014036 3300010375 Bacteria 8892
331 Ga0105239_10032014 3300010375 Bacteria 5779
332 Ga0105239_10157271 3300010375 Unclassified 2539
333 Ga0105239_10233093 3300010375 Bacteria 2066
334 Ga0105239_10315634 3300010375 Bacteria 1762
335 Ga0105239_10544048 3300010375 Bacteria 1322
336 Ga0105239_12177551 3300010375 Bacteria 645
337 Ga0105246_10051444 3300011119 Bacteria 2829
338 Ga0105246_10052668 3300011119 Bacteria 2798
339 Ga0105246_10074202 3300011119 Bacteria 2404
340 Ga0105246_10307800 3300011119 Bacteria 1282
341 Ga0105246_10427261 3300011119 Bacteria 1107
342 Ga0105246_10791298 3300011119 Bacteria 840
343 Ga0105246_11394829 3300011119 Bacteria 653
344 Ga0157373_10239584 3300013100 Bacteria 1282
345 Ga0157373_11155402 3300013100 Bacteria 582
346 Ga0157371_10359554 3300013102 Bacteria 1061
347 Ga0157370_10006562 3300013104 Bacteria 12816
348 Ga0157370_10012942 3300013104 Bacteria 8624
349 Ga0157370_10035171 3300013104 Bacteria 4872
350 Ga0157370_10141654 3300013104 Bacteria 2240
351 Ga0157370_10196040 3300013104 Bacteria 1874
352 Ga0157369_10000449 3300013105 Bacteria 54630
353 Ga0157369_10006340 3300013105 Bacteria 13729
354 Ga0157369_10007671 3300013105 Bacteria 12417
355 Ga0157369_10021520 3300013105 Bacteria 7213
356 Ga0157369_10346714 3300013105 Bacteria 1543
357 Ga0157369_10546326 3300013105 Archaea 1198
358 Ga0157374_10047482 3300013296 Unclassified 3981
359 Ga0157374_10108795 3300013296 Bacteria 2664
360 Ga0157374_10119809 3300013296 Bacteria 2538
361 Ga0157374_10160638 3300013296 Bacteria 2188
362 Ga0157374_10431942 3300013296 Unclassified 1317
363 Ga0157374_11020632 3300013296 Unclassified 847
364 Ga0157374_11975835 3300013296 Bacteria 609
365 Ga0157378_10087923 3300013297 Bacteria 2819
366 Ga0157378_10113687 3300013297 Bacteria 2486
367 Ga0157378_10140783 3300013297 Bacteria 2240
368 Ga0157378_10686175 3300013297 Bacteria 1042
369 Ga0157378_10972907 3300013297 Bacteria 882
370 Ga0157378_11395065 3300013297 Bacteria 743
371 Ga0157378_11742899 3300013297 Bacteria 670
372 Ga0163162_10003010 3300013306 Bacteria 16108
373 Ga0163162_10136983 3300013306 Bacteria 2559
374 Ga0163162_10418741 3300013306 Bacteria 1472
375 Ga0163162_10650201 3300013306 Bacteria 1178
376 Ga0163162_10752080 3300013306 Bacteria 1094
377 Ga0163162_10831141 3300013306 Unclassified 1040
378 Ga0163162_11811040 3300013306 Bacteria 698
379 Ga0163162_11829522 3300013306 Unclassified 694
380 Ga0163162_11909113 3300013306 Unclassified 680
381 Ga0157372_10036561 3300013307 Bacteria 5412
382 Ga0157372_10049671 3300013307 Unclassified 4665
383 Ga0157372_10051720 3300013307 Bacteria 4573
384 Ga0157372_10054407 3300013307 Bacteria 4464
385 Ga0157372_10426072 3300013307 Unclassified 1546
386 Ga0157372_10636266 3300013307 Bacteria 1242
387 Ga0157372_10758853 3300013307 Unclassified 1128
388 Ga0157375_10002947 3300013308 Bacteria 14769
389 Ga0157375_10038859 3300013308 Bacteria 4573
390 Ga0157375_10074787 3300013308 Bacteria 3410
391 Ga0157375_10149301 3300013308 Bacteria 2471
392 Ga0157375_10674014 3300013308 Bacteria 1189
393 Ga0157375_10950784 3300013308 Bacteria 1001
394 Ga0157375_11213890 3300013308 Bacteria 885
395 Ga0157375_11531132 3300013308 Bacteria 787
396 Ga0157375_11582330 3300013308 Unclassified 775
397 Ga0157375_11802770 3300013308 Unclassified 725
398 Ga0163163_10008110 3300014325 Bacteria 9306
399 Ga0163163_10041562 3300014325 Bacteria 4497
400 Ga0163163_10077713 3300014325 Bacteria 3314
401 Ga0163163_10151063 3300014325 Bacteria 2366
402 Ga0163163_10228107 3300014325 Bacteria 1911
403 Ga0163163_10251044 3300014325 Bacteria 1819
404 Ga0163163_10385418 3300014325 Unclassified 1459
405 Ga0163163_10801860 3300014325 Bacteria 1005
406 Ga0163163_11101884 3300014325 Bacteria 857
407 Ga0157380_10198119 3300014326 Bacteria 1779
408 Ga0157380_11746540 3300014326 Bacteria 680
409 Ga0157379_10041952 3300014968 Bacteria 4083
410 Ga0157379_10121375 3300014968 Bacteria 2351
411 Ga0157379_10229016 3300014968 Bacteria 1684
412 Ga0157379_10350977 3300014968 Bacteria 1350
413 Ga0157379_10357927 3300014968 Bacteria 1337
414 Ga0157379_10384995 3300014968 Bacteria 1287
415 Ga0157379_11491411 3300014968 Unclassified 658
416 Ga0157376_10153947 3300014969 Bacteria 2076
417 Ga0157376_10167198 3300014969 Bacteria 1999
418 Ga0157376_10200505 3300014969 Bacteria 1836
419 Ga0157376_10351217 3300014969 Bacteria 1411
420 Ga0157376_10426426 3300014969 Bacteria 1288
421 Ga0157376_10507554 3300014969 Bacteria 1186
422 Ga0157376_10559199 3300014969 Bacteria 1133
423 Ga0157376_10967514 3300014969 Bacteria 872
424 Ga0157376_11124465 3300014969 Unclassified 812
425 Ga0157376_11210917 3300014969 Unclassified 783
426 Ga0157376_11292195 3300014969 Bacteria 759
427 Ga0163161_10666915 3300017792 Bacteria 863
428 Ga0163161_11598543 3300017792 Bacteria 575
429 Ga0213875_10019213 3300021388 Bacteria 3288
430 Ga0207692_10134819 3300025898 Bacteria 1398
431 Ga0207642_10080071 3300025899 Bacteria 1583
432 Ga0207642_10093423 3300025899 Bacteria 1492
433 Ga0207642_10261660 3300025899 Bacteria 987
434 Ga0207642_10415692 3300025899 Bacteria 808
435 Ga0207710_10226736 3300025900 Bacteria 929
436 Ga0207680_10013109 3300025903 Bacteria 4246
437 Ga0207680_10133057 3300025903 Bacteria 1641
438 Ga0207680_10682820 3300025903 Bacteria 736
439 Ga0207680_10881402 3300025903 Unclassified 641
440 Ga0207699_10111091 3300025906 Bacteria 1757
441 Ga0207699_10372619 3300025906 Bacteria 1012
442 Ga0207645_10083743 3300025907 Bacteria 2046
443 Ga0207705_10037989 3300025909 Bacteria 3446
444 Ga0207654_10008097 3300025911 Bacteria 5300
445 Ga0207654_10019251 3300025911 Unclassified 3600
446 Ga0207654_10021079 3300025911 Bacteria 3462
447 Ga0207654_10030947 3300025911 Bacteria 2943
448 Ga0207654_10041382 3300025911 Bacteria 2601
449 Ga0207654_10211585 3300025911 Bacteria 1282
450 Ga0207654_10534043 3300025911 Bacteria 831
451 Ga0207707_10003018 3300025912 Bacteria 14966
452 Ga0207707_10078056 3300025912 Bacteria 2891
453 Ga0207707_10089651 3300025912 Bacteria 2688
454 Ga0207707_10165548 3300025912 Bacteria 1932
455 Ga0207707_10383262 3300025912 Bacteria 1208
456 Ga0207707_10769701 3300025912 Unclassified 804
457 Ga0207695_10001453 3300025913 Bacteria 39659
458 Ga0207695_10003944 3300025913 Bacteria 20511
459 Ga0207695_10007981 3300025913 Bacteria 13346
460 Ga0207695_10008516 3300025913 Bacteria 12824
461 Ga0207695_10021195 3300025913 Bacteria 7422
462 Ga0207695_10067594 3300025913 Bacteria 3665
463 Ga0207695_10075970 3300025913 Unclassified 3416
464 Ga0207695_10430677 3300025913 Bacteria 1203
465 Ga0207695_11056820 3300025913 Unclassified 692
466 Ga0207695_11420756 3300025913 Bacteria 574
467 Ga0207671_10023873 3300025914 Bacteria 4606
468 Ga0207671_10047667 3300025914 Bacteria 3172
469 Ga0207671_10055126 3300025914 Unclassified 2945
470 Ga0207671_10067572 3300025914 Bacteria 2662
471 Ga0207671_10292895 3300025914 Bacteria 1285
472 Ga0207671_11014997 3300025914 Unclassified 653
473 Ga0207671_11085881 3300025914 Unclassified 629
474 Ga0207671_11260160 3300025914 Bacteria 577
475 Ga0207693_10176885 3300025915 Bacteria 1679
476 Ga0207663_10133221 3300025916 Bacteria 1720
477 Ga0207663_10186163 3300025916 Unclassified 1487
478 Ga0207663_10189239 3300025916 Bacteria 1476
479 Ga0207663_10268209 3300025916 Bacteria 1263
480 Ga0207660_10080060 3300025917 Bacteria 2398
481 Ga0207660_10323751 3300025917 Bacteria 1231
482 Ga0207657_10001616 3300025919 Bacteria 24238
483 Ga0207657_10067678 3300025919 Bacteria 3036
484 Ga0207657_10100986 3300025919 Bacteria 2395
485 Ga0207657_10169808 3300025919 Bacteria 1768
486 Ga0207657_11042485 3300025919 Unclassified 626
487 Ga0207649_10082921 3300025920 Bacteria 2080
488 Ga0207652_10001181 3300025921 Bacteria 23479
489 Ga0207652_10038658 3300025921 Bacteria 4047
490 Ga0207652_10384541 3300025921 Unclassified 1266
491 Ga0207652_10748180 3300025921 Bacteria 870
492 Ga0207694_10000448 3300025924 Bacteria 38251
493 Ga0207694_10003244 3300025924 Bacteria 12965
494 Ga0207694_10007766 3300025924 Bacteria 8123
495 Ga0207694_10025523 3300025924 Bacteria 4492
496 Ga0207694_10031802 3300025924 Bacteria 4034
497 Ga0207694_10032283 3300025924 Bacteria 4006
498 Ga0207694_10045660 3300025924 Bacteria 3384
499 Ga0207694_10248954 3300025924 Bacteria 1454
500 Ga0207694_10462252 3300025924 Unclassified 1060
501 Ga0207694_10843245 3300025924 Bacteria 775
502 Ga0207650_10539876 3300025925 Bacteria 977
503 Ga0207659_10228439 3300025926 Bacteria 1500
504 Ga0207687_10001795 3300025927 Bacteria 14771
505 Ga0207687_10007087 3300025927 Bacteria 7389
506 Ga0207687_10015219 3300025927 Bacteria 5040
507 Ga0207687_10026024 3300025927 Bacteria 3917
508 Ga0207687_10064372 3300025927 Bacteria 2600
509 Ga0207687_10090074 3300025927 Bacteria 2235
510 Ga0207687_10181524 3300025927 Bacteria 1631
511 Ga0207687_10315338 3300025927 Bacteria 1264
512 Ga0207687_10334041 3300025927 Bacteria 1230
513 Ga0207687_10346954 3300025927 Bacteria 1208
514 Ga0207687_10425539 3300025927 Bacteria 1096
515 Ga0207687_10893910 3300025927 Bacteria 760
516 Ga0207687_11756041 3300025927 Unclassified 531
517 Ga0207700_10006564 3300025928 Bacteria 7042
518 Ga0207700_10019238 3300025928 Bacteria 4609
519 Ga0207700_10024933 3300025928 Bacteria 4146
520 Ga0207700_10239930 3300025928 Bacteria 1544
521 Ga0207700_10394727 3300025928 Bacteria 1212
522 Ga0207700_10622215 3300025928 Bacteria 962
523 Ga0207700_11491618 3300025928 Unclassified 600
524 Ga0207664_10029384 3300025929 Bacteria 4186
525 Ga0207664_10656606 3300025929 Bacteria 943
526 Ga0207644_10057523 3300025931 Bacteria 2808
527 Ga0207644_10585502 3300025931 Bacteria 926
528 Ga0207644_10702593 3300025931 Unclassified 843
529 Ga0207690_10078006 3300025932 Bacteria 2304
530 Ga0207706_10127218 3300025933 Unclassified 2240
531 Ga0207686_10006571 3300025934 Bacteria 6262
532 Ga0207686_10009264 3300025934 Bacteria 5339
533 Ga0207686_10010944 3300025934 Bacteria 4948
534 Ga0207686_10097499 3300025934 Unclassified 1956
535 Ga0207686_10274270 3300025934 Bacteria 1242
536 Ga0207686_10481943 3300025934 Bacteria 959
537 Ga0207686_10684157 3300025934 Bacteria 814
538 Ga0207709_10231814 3300025935 Bacteria 1338
539 Ga0207709_10235741 3300025935 Bacteria 1328
540 Ga0207709_10301589 3300025935 Bacteria 1191
541 Ga0207709_10516126 3300025935 Bacteria 935
542 Ga0207709_11722565 3300025935 Bacteria 521
543 Ga0207670_10883774 3300025936 Bacteria 748
544 Ga0207704_10039559 3300025938 Unclassified 2747
545 Ga0207704_10200496 3300025938 Bacteria 1460
546 Ga0207704_10270097 3300025938 Bacteria 1287
547 Ga0207704_10336029 3300025938 Bacteria 1171
548 Ga0207704_10439077 3300025938 Bacteria 1039
549 Ga0207665_10294263 3300025939 Bacteria 1212
550 Ga0207711_10002029 3300025941 Bacteria 18313
551 Ga0207711_10003043 3300025941 Bacteria 14659
552 Ga0207711_10099643 3300025941 Bacteria 2569
553 Ga0207711_10159152 3300025941 Bacteria 2043
554 Ga0207711_10174704 3300025941 Bacteria 1951
555 Ga0207711_10190267 3300025941 Bacteria 1870
556 Ga0207711_10204314 3300025941 Bacteria 1803
557 Ga0207711_10219084 3300025941 Bacteria 1740
558 Ga0207711_10258181 3300025941 Unclassified 1601
559 Ga0207711_10400987 3300025941 Unclassified 1274
560 Ga0207711_11105788 3300025941 Bacteria 733
561 Ga0207689_10153540 3300025942 Bacteria 1898
562 Ga0207689_10381544 3300025942 Unclassified 1173
563 Ga0207689_10595434 3300025942 Bacteria 930
564 Ga0207689_10929528 3300025942 Bacteria 734
565 Ga0207661_10070300 3300025944 Bacteria 2857
566 Ga0207661_10136679 3300025944 Bacteria 2106
567 Ga0207661_10182944 3300025944 Bacteria 1832
568 Ga0207661_10272446 3300025944 Bacteria 1511
569 Ga0207661_10274799 3300025944 Bacteria 1504
570 Ga0207661_10576996 3300025944 Unclassified 1031
571 Ga0207661_11109287 3300025944 Unclassified 728
572 Ga0207679_10050164 3300025945 Bacteria 3048
573 Ga0207679_10146157 3300025945 Bacteria 1918
574 Ga0207679_10184360 3300025945 Bacteria 1729
575 Ga0207679_10465691 3300025945 Bacteria 1123
576 Ga0207667_10000290 3300025949 Bacteria 69361
577 Ga0207667_10001654 3300025949 Bacteria 28076
578 Ga0207667_10004072 3300025949 Bacteria 17963
579 Ga0207667_10043852 3300025949 Bacteria 4745
580 Ga0207667_10099935 3300025949 Bacteria 2993
581 Ga0207667_10116956 3300025949 Bacteria 2747
582 Ga0207667_10244219 3300025949 Unclassified 1837
583 Ga0207667_10339766 3300025949 Bacteria 1532
584 Ga0207667_10643959 3300025949 Bacteria 1066
585 Ga0207667_11748592 3300025949 Unclassified 587
586 Ga0207667_11871916 3300025949 Unclassified 563
587 Ga0207651_10874423 3300025960 Bacteria 799
588 Ga0207712_10105483 3300025961 Bacteria 2103
589 Ga0207640_10274844 3300025981 Bacteria 1320
590 Ga0207640_11687058 3300025981 Bacteria 572
591 Ga0207677_10002199 3300026023 Bacteria 10246
592 Ga0207677_10019458 3300026023 Bacteria 4100
593 Ga0207677_10264019 3300026023 Bacteria 1405
594 Ga0207677_10289217 3300026023 Unclassified 1349
595 Ga0207677_10698716 3300026023 Bacteria 900
596 Ga0207677_10819108 3300026023 Bacteria 834
597 Ga0207677_11952363 3300026023 Unclassified 545
598 Ga0207703_10037194 3300026035 Bacteria 3877
599 Ga0207703_10115744 3300026035 Bacteria 2294
600 Ga0207703_10185424 3300026035 Bacteria 1839
601 Ga0207703_10312040 3300026035 Bacteria 1438
602 Ga0207703_10316749 3300026035 Bacteria 1427
603 Ga0207703_10970368 3300026035 Unclassified 815
604 Ga0207703_11443691 3300026035 Bacteria 662
605 Ga0207703_12068796 3300026035 Bacteria 546
606 Ga0207639_10074186 3300026041 Unclassified 2670
607 Ga0207639_10252521 3300026041 Bacteria 1538
608 Ga0207639_10309543 3300026041 Bacteria 1399
609 Ga0207639_10557003 3300026041 Bacteria 1053
610 Ga0207639_10718293 3300026041 Bacteria 928
611 Ga0207702_10004522 3300026078 Bacteria 12331
612 Ga0207702_10012004 3300026078 Bacteria 7202
613 Ga0207702_10175129 3300026078 Bacteria 1971
614 Ga0207702_10244158 3300026078 Bacteria 1684
615 Ga0207702_10263771 3300026078 Bacteria 1623
616 Ga0207702_10334649 3300026078 Bacteria 1445
617 Ga0207702_11099338 3300026078 Unclassified 789
618 Ga0207702_11993422 3300026078 Unclassified 571
619 Ga0207641_10067796 3300026088 Bacteria 3058
620 Ga0207641_10119491 3300026088 Unclassified 2349
621 Ga0207641_10336210 3300026088 Bacteria 1436
622 Ga0207641_10974748 3300026088 Bacteria 844
623 Ga0207641_11116547 3300026088 Unclassified 787
624 Ga0207641_11475762 3300026088 Bacteria 681
625 Ga0207648_10147912 3300026089 Bacteria 2072
626 Ga0207648_10168295 3300026089 Bacteria 1937
627 Ga0207648_11624835 3300026089 Bacteria 607
628 Ga0207676_10124588 3300026095 Bacteria 2180
629 Ga0207676_10254460 3300026095 Unclassified 1582
630 Ga0207676_10311152 3300026095 Bacteria 1442
631 Ga0207676_10391028 3300026095 Bacteria 1297
632 Ga0207676_10795226 3300026095 Bacteria 922
633 Ga0207676_11278122 3300026095 Bacteria 728
634 Ga0207676_11923987 3300026095 Bacteria 590
635 Ga0207674_10000985 3300026116 Bacteria 37225
636 Ga0207674_10019772 3300026116 Bacteria 7287
637 Ga0207674_10055454 3300026116 Bacteria 4029
638 Ga0207674_10059067 3300026116 Bacteria 3883
639 Ga0207674_11820290 3300026116 Unclassified 576
640 Ga0207675_101727854 3300026118 Bacteria 645
641 Ga0207683_10691174 3300026121 Bacteria 946
642 Ga0207698_10269267 3300026142 Bacteria 1569
643 Ga0207698_11091896 3300026142 Bacteria 810
644 Ga0207698_11245371 3300026142 Bacteria 758
645 Ga0207698_11344436 3300026142 Unclassified 729
646 Ga0209588_1193079 3300027671 Bacteria 636
647 Ga0268266_10003108 3300028379 Bacteria 16915
648 Ga0268266_11377961 3300028379 Bacteria 681
649 Ga0268264_10054641 3300028381 Bacteria 3335
650 Ga0268264_10137809 3300028381 Bacteria 2172
651 Ga0268264_10231885 3300028381 Bacteria 1705
652 Ga0268264_11040024 3300028381 Bacteria 826
653 Ga0268264_11932919 3300028381 Bacteria 599
654 Ga0265338_10408391 3300028800 Bacteria 967
655 Ga0265760_10071018 3300031090 Bacteria 1068
656 Ga0265332_10024535 3300031238 Bacteria 2652
657 Ga0265325_10106269 3300031241 Unclassified 1369
658 Ga0265339_10148325 3300031249 Bacteria 1188
659 Ga0265331_10040901 3300031250 Unclassified 2254
660 Ga0265331_10068858 3300031250 Unclassified 1658
661 Ga0265331_10379035 3300031250 Bacteria 634
662 Ga0265316_10007594 3300031344 Bacteria 10196
663 Ga0265316_10013946 3300031344 Bacteria 7106
664 Ga0265316_10048971 3300031344 Bacteria 3331
665 Ga0265316_10065984 3300031344 Unclassified 2802
666 Ga0265316_10070056 3300031344 Bacteria 2705
667 Ga0265316_10092048 3300031344 Bacteria 2312
668 Ga0265316_10151436 3300031344 Bacteria 1737
669 Ga0265316_10154524 3300031344 Bacteria 1717
670 Ga0265316_10227713 3300031344 Bacteria 1374
671 Ga0265313_10005690 3300031595 Bacteria 9090
672 Ga0265313_10096410 3300031595 Bacteria 1319
673 Ga0265313_10180192 3300031595 Bacteria 888
674 Ga0265314_10000559 3300031711 Bacteria 47507
675 Ga0265314_10000932 3300031711 Bacteria 34486
676 Ga0265314_10063352 3300031711 Bacteria 2508
677 Ga0265314_10109185 3300031711 Bacteria 1761
678 Ga0265314_10206687 3300031711 Bacteria 1156
679 Ga0265342_10352392 3300031712 Bacteria 766
680 Ga0373926_0208252 3300035083 Bacteria 753
681 Ga0373934_0001924 3300035086 Bacteria 7617
682 Ga0373934_0034130 3300035086 Bacteria 1999
683 Ga0373934_0048464 3300035086 Bacteria 1682
684 Ga0373923_0015943 3300035111 Bacteria 2845
685 Ga0373936_0139542 3300035113 Bacteria 1046
686 Ga0373945_0359735 3300035116 Unclassified 632
687 Ga0373953_0266112 3300035117 Bacteria 746
688 Ga0373953_0289914 3300035117 Bacteria 714
689 Ga0373954_0002014 3300035118 Bacteria 8440
690 Ga0373954_0217849 3300035118 Bacteria 939
691 Ga0373956_0038601 3300035119 Bacteria 2113
692 Ga0373956_0473747 3300035119 Bacteria 598
693 Ga0373957_0169538 3300035120 Bacteria 902
694 Ga0373960_0344921 3300035121 Bacteria 563
695 Ga0373943_0014711 3300035170 Bacteria 3548
696 Ga0373943_0038001 3300035170 Bacteria 2313
697 Ga0373943_0367708 3300035170 Unclassified 826
698 Ga0373943_0527193 3300035170 Unclassified 692
699 Ga0373946_0121181 3300035171 Bacteria 1194
700 Ga0373955_0023707 3300035172 Bacteria 3130
701 Ga0373955_0123148 3300035172 Bacteria 1509
702 Ga0373955_0142744 3300035172 Unclassified 1405
703 Ga0373924_0148084 3300035410 Bacteria 1026
704 Ga0373935_0162041 3300035692 Bacteria 1525
705 Ga0373935_0362754 3300035692 Bacteria 1035
706 Ga0373935_0420553 3300035692 Bacteria 962
707 Ga0373935_0843837 3300035692 Bacteria 677
708 Ga0373927_0003424 3300035695 Bacteria 11375
709 Ga0373927_0075373 3300035695 Bacteria 2185
710 Ga0373927_0258526 3300035695 Bacteria 1145
711 Ga0373927_0260657 3300035695 Bacteria 1140
712 Ga0373927_0596064 3300035695 Bacteria 730
713 Ga0373933_0079161 3300035724 Bacteria 2012
714 Ga0373933_0448942 3300035724 Bacteria 843
715 Ga0373933_0512078 3300035724 Unclassified 786
716 Ga0373947_0003449 3300035725 Bacteria 9346
717 Ga0373947_0274520 3300035725 Bacteria 1120
718 Ga0373947_0678450 3300035725 Unclassified 703
719 Ga0373947_0880674 3300035725 Bacteria 611
720 Ga0373947_0965936 3300035725 Unclassified 581
721 Ga0373947_1265034 3300035725 Bacteria 502
722 Ga0373937_0001907 3300036401 Bacteria 17502
723 Ga0373937_0020084 3300036401 Bacteria 5985
724 Ga0373937_0057467 3300036401 Bacteria 3574
725 Ga0373937_0137776 3300036401 Bacteria 2282
726 Ga0373937_0197728 3300036401 Unclassified 1890
727 Ga0373937_0368066 3300036401 Bacteria 1363
728 Ga0373937_0389586 3300036401 Unclassified 1322
729 Ga0373937_0492129 3300036401 Unclassified 1165
730 Ga0373925_0001244 3300037068 Bacteria 22460
731 Ga0373925_0017973 3300037068 Bacteria 5134
732 Ga0373925_0079912 3300037068 Bacteria 2485
733 Ga0373925_0099449 3300037068 Bacteria 2234
734 Ga0373925_0246478 3300037068 Bacteria 1432
735 Ga0373925_0292436 3300037068 Unclassified 1314
736 Ga0373925_0328371 3300037068 Bacteria 1239
737 Ga0373925_0417960 3300037068 Bacteria 1095
738 Ga0373925_0974647 3300037068 Bacteria 698
739 Ga0436364_0634814 3300037853 Bacteria 6872
740 Ga0436364_0680395 3300037853 Bacteria 7356
741 Ga0436364_1261791 3300037853 Unclassified 785
742 Ga0436364_1424376 3300037853 Bacteria 1372
743 Ga0242420_118898 3300038996 Unclassified 575
744 Ga0436365_0496136 3300039437 Unclassified 709
745 Ga0436365_1778402 3300039437 Bacteria 3215
746 Ga0436360_1273375 3300039438 Unclassified 692
747 Ga0451839_1534484 3300041496 Unclassified 579
748 Ga0451853_2905678 3300041512 Bacteria 653
749 Ga0453684_0251538 3300044712 Bacteria 2029
750 Ga0451576_0026734 3300045051 Bacteria 6204
751 Ga0451576_0566931 3300045051 Bacteria 1193
752 Ga0451576_0936164 3300045051 Bacteria 909
753 Ga0451576_2298897 3300045051 Unclassified 552
754 Ga0495592_0012783 3300046454 Bacteria 6382
755 Ga0495592_0029959 3300046454 Bacteria 4117
756 Ga0495651_0029066 3300046462 Bacteria 4311
757 Ga0495651_0239089 3300046462 Bacteria 1247
758 Ga0495653_0282738 3300046463 Bacteria 1088
759 Ga0495653_0397888 3300046463 Unclassified 876
760 Ga0495653_0712770 3300046463 Bacteria 609
761 Ga0495580_0000307 3300046472 Bacteria 39901
762 Ga0495580_0061918 3300046472 Bacteria 2626
763 Ga0495580_0269560 3300046472 Unclassified 1163
764 Ga0495580_0345047 3300046472 Bacteria 1009
765 Ga0495580_0346643 3300046472 Unclassified 1007
766 Ga0495580_0546433 3300046472 Unclassified 770
767 Ga0495582_0011352 3300046473 Bacteria 4909
768 Ga0495639_0414826 3300046475 Unclassified 681
769 Ga0495664_0013254 3300046477 Bacteria 4675
770 Ga0495664_0508738 3300046477 Bacteria 719
771 Ga0495664_0581877 3300046477 Unclassified 666
772 Ga0495594_0131671 3300046499 Bacteria 1417
773 Ga0495594_0178198 3300046499 Bacteria 1210
774 Ga0495594_0240751 3300046499 Bacteria 1031
775 Ga0495594_0356019 3300046499 Unclassified 834
776 Ga0495618_0255258 3300046514 Bacteria 1099
777 Ga0495628_0024119 3300046516 Bacteria 4982
778 Ga0495628_0059017 3300046516 Bacteria 3014
779 Ga0495628_0068257 3300046516 Bacteria 2775
780 Ga0495628_0591773 3300046516 Bacteria 793
781 Ga0495628_0720547 3300046516 Bacteria 703
782 Ga0495630_0018918 3300046517 Bacteria 5063
783 Ga0495630_0168767 3300046517 Bacteria 1667
784 Ga0495666_0085266 3300046526 Bacteria 1492
785 Ga0495652_0040924 3300046529 Bacteria 4003
786 Ga0495652_0118195 3300046529 Bacteria 2119
787 Ga0495652_0175855 3300046529 Bacteria 1648
788 Ga0495652_0253109 3300046529 Unclassified 1304
789 Ga0495652_0646580 3300046529 Unclassified 717
790 Ga0495665_0085194 3300046531 Bacteria 1661
791 Ga0495665_0181226 3300046531 Bacteria 1095
792 Ga0495665_0198207 3300046531 Unclassified 1041
793 Ga0495665_0208968 3300046531 Bacteria 1011
794 Ga0495640_0048723 3300046533 Bacteria 2926
795 Ga0495586_0111443 3300046535 Bacteria 1523
796 Ga0495586_0273994 3300046535 Bacteria 965
797 Ga0495586_0288036 3300046535 Bacteria 940
798 Ga0495587_0001113 3300046536 Bacteria 17614
799 Ga0495587_0045658 3300046536 Bacteria 2603
800 Ga0495587_0076792 3300046536 Bacteria 1940
801 Ga0495587_0178035 3300046536 Bacteria 1206
802 Ga0495645_0002625 3300046543 Bacteria 12222
803 Ga0495645_0343442 3300046543 Unclassified 963
804 Ga0495645_0670234 3300046543 Unclassified 632
805 Ga0495633_0214867 3300046558 Bacteria 881
806 Ga0495667_0300376 3300046559 Bacteria 1017
807 Ga0495634_0071303 3300046642 Bacteria 2288
808 Ga0495634_0077186 3300046642 Bacteria 2185
809 Ga0495635_0882156 3300046663 Bacteria 573
810 Ga0495599_0004841 3300046678 Bacteria 8009
811 Ga0495599_0007068 3300046678 Bacteria 6795
812 Ga0495599_0058293 3300046678 Bacteria 2416
813 Ga0495599_0312479 3300046678 Bacteria 947
814 Ga0495623_0171961 3300046679 Unclassified 1265
815 Ga0495623_0363307 3300046679 Bacteria 786
816 Ga0495623_0501937 3300046679 Bacteria 640
817 Ga0495623_0624217 3300046679 Unclassified 558
818 Ga0495646_0257567 3300046680 Unclassified 933
819 Ga0495658_0166869 3300046683 Bacteria 1361
820 Ga0495658_0603580 3300046683 Bacteria 703
821 Ga0495669_0133631 3300046684 Bacteria 1169
822 Ga0495669_0388141 3300046684 Bacteria 676
823 Ga0495613_0090378 3300046689 Bacteria 2218
824 Ga0495613_0132561 3300046689 Bacteria 1784
825 Ga0495613_0247721 3300046689 Bacteria 1244
826 Ga0495613_0961336 3300046689 Bacteria 550
827 Ga0495600_0053298 3300046809 Bacteria 2642
828 Ga0495600_0305439 3300046809 Unclassified 1003
829 Ga0495604_0153282 3300047317 Bacteria 1635
830 Ga0495604_0156996 3300047317 Bacteria 1611
831 Ga0495604_0923559 3300047317 Bacteria 544
832 Ga0495636_0088624 3300047318 Bacteria 1341
833 Ga0495674_0045746 3300047319 Bacteria 3886
834 Ga0495674_0051721 3300047319 Unclassified 3621
835 Ga0495674_0287979 3300047319 Bacteria 1344
836 Ga0495674_0308153 3300047319 Unclassified 1292
837 Ga0495674_0406935 3300047319 Bacteria 1098
838 Ga0495674_0715622 3300047319 Bacteria 785
839 Ga0495680_0247480 3300047322 Unclassified 1264
840 Ga0495680_0479888 3300047322 Bacteria 847
841 Ga0495675_0068772 3300047444 Bacteria 2237
842 Ga0495675_0115713 3300047444 Unclassified 1672
843 Ga0495675_0136572 3300047444 Bacteria 1522
844 Ga0495684_0004128 3300047471 Bacteria 11344
845 Ga0495684_0016021 3300047471 Bacteria 5772
846 Ga0495684_0024166 3300047471 Bacteria 4676
847 Ga0495684_0065364 3300047471 Bacteria 2765
848 Ga0495684_0180024 3300047471 Unclassified 1567
849 Ga0495684_0272439 3300047471 Bacteria 1224
850 Ga0495684_0720098 3300047471 Unclassified 660
851 Ga0495593_0133971 3300047673 Bacteria 1257
852 Ga0495593_0138230 3300047673 Bacteria 1235
853 Ga0495602_0001372 3300048088 Bacteria 24025
854 Ga0495602_0118037 3300048088 Bacteria 2141
855 Ga0495602_0180894 3300048088 Bacteria 1626
856 Ga0495602_0184490 3300048088 Bacteria 1606
857 Ga0496102_1062717 3300048905 Unclassified 729
858 Ga0496104_0259643 3300048907 Bacteria 1650
859 Ga0496105_0216939 3300048908 Bacteria 1558
860 Ga0496115_0046537 3300048918 Bacteria 3468
861 Ga0496115_0162753 3300048918 Unclassified 1844
862 Ga0496115_0285517 3300048918 Bacteria 1354
863 Ga0501073_0931105 3300049589 Bacteria 598
864 nmdc:mga05p37_108043_c1 3300050507 Bacteria 3422
865 nmdc:mga06r32_59860_c1 3300050510 Bacteria 3664
866 nmdc:mga08y16_526036_c1 3300050511 Bacteria 1199
867 nmdc:mga0n895_1485647_c1 3300050512 Bacteria 644
868 Ga0495601_0077502 3300053077 Bacteria 2129
869 Ga0495601_0166533 3300053077 Bacteria 1440
870 Ga0495601_0232250 3300053077 Bacteria 1205
871 Ga0495601_0277554 3300053077 Unclassified 1093
872 Ga0495619_0784833 3300053085 Bacteria 645
873 Ga0265316_10318326
874 Ga0070658_10015689
875 Ga0070658_10355692
876 Ga0070676_10908687
877 Ga0070683_100001320
878 Ga0070683_100050718
879 Ga0070683_100080053
880 Ga0070683_100080252
881 Ga0070683_100170856
882 Ga0070683_100186158
883 Ga0070683_100334677
884 Ga0070683_100583276
885 Ga0070683_100939060
886 Ga0070690_100029704
887 Ga0070670_101130193
888 Ga0070677_10502500
889 Ga0068869_100006386
890 Ga0068869_100285526
891 Ga0068869_100361691
892 Ga0068869_102121466
893 Ga0070666_10066266
894 Ga0070666_10071960
895 Ga0070666_10239150
896 Ga0070666_10678038
897 Ga0070666_11179637
898 Ga0070680_100104591
899 Ga0070680_100432699
900 Ga0068868_100001744
901 Ga0068868_100053470
902 Ga0068868_100132719
903 Ga0068868_100281096
904 Ga0068868_100436916
905 Ga0068868_101936356
906 Ga0070660_100102518
907 Ga0070660_100172120
908 Ga0070660_101291229
909 Ga0070661_100112172
910 Ga0070692_10264130
911 Ga0070669_101003533
912 Ga0070675_100355876
913 Ga0070671_100007174
914 Ga0070671_100829009
915 Ga0070671_100957374
916 Ga0070674_100331670
917 Ga0070674_100374899
918 Ga0070674_100423931
919 Ga0070674_102091490
920 Ga0070673_100012445
921 Ga0070673_100643639
922 Ga0070659_100020791
923 Ga0070659_100393609
924 Ga0070667_100056048
925 Ga0070667_100840407
926 Ga0070709_10264129
927 Ga0070709_10272504
928 Ga0070709_10568777
929 Ga0070709_11434257
930 Ga0070709_11458823
931 Ga0070714_100012429
932 Ga0070714_100463491
933 Ga0070714_100674412
934 Ga0070714_101222568
935 Ga0070713_100025779
936 Ga0070713_100200151
937 Ga0070713_100220185
938 Ga0070713_100279253
939 Ga0070713_100323441
940 Ga0070713_100697699
941 Ga0070713_100762342
942 Ga0070713_102163661
943 Ga0070710_11053418
944 Ga0070710_11165808
945 Ga0070710_11171025
946 Ga0070711_100287619
947 Ga0070711_100472720
948 Ga0070711_100884634
949 Ga0070711_101170802
950 Ga0070705_101110132
951 Ga0070708_100901636
952 Ga0070678_100851390
953 Ga0070678_100954362
954 Ga0070662_100043876
955 Ga0070681_10005962
956 Ga0070681_10022598
957 Ga0070681_10081652
958 Ga0070681_10582423
959 Ga0070681_10934700
960 Ga0070681_11264776
961 Ga0068867_100115638
962 Ga0068867_100171948
963 Ga0068867_100911976
964 Ga0068867_101885925
965 Ga0070685_10247082
966 Ga0070706_102040920
967 Ga0070698_100868665
968 Ga0070699_100118807
969 Ga0070679_100027969
970 Ga0070679_100113318
971 Ga0070679_100650400
972 Ga0070679_100922093
973 Ga0070684_100023948
974 Ga0070684_100067426
975 Ga0070684_100146401
976 Ga0070684_100503423
977 Ga0070684_100838306
978 Ga0070684_101276142
979 Ga0070697_100303270
980 Ga0070697_101216812
981 Ga0068853_100082083
982 Ga0068853_100185918
983 Ga0068853_100495514
984 Ga0068853_100789554
985 Ga0070686_100373484
986 Ga0070693_100102548
987 Ga0070693_100733955
988 Ga0070665_100008566
989 Ga0070665_100573409
990 Ga0070665_101687377
991 Ga0070704_101002270
992 Ga0068855_100005945
993 Ga0068855_100010509
994 Ga0068855_100100226
995 Ga0068855_100113686
996 Ga0068855_100134125
997 Ga0068855_100137356
998 Ga0068855_100259923
999 Ga0068855_100602952
1000 Ga0068855_100682187
1001 Ga0070664_100250560
1002 Ga0070664_100313761
1003 Ga0070664_100780039
1004 Ga0070664_101682295
1005 Ga0070664_101701966
1006 Ga0068857_100002818
1007 Ga0068857_100533172
1008 Ga0068857_100695890
1009 Ga0068854_100135051
1010 Ga0068854_100563776
1011 Ga0068856_100025021
1012 Ga0068856_100066090
1013 Ga0068856_100194620
1014 Ga0068856_100253203
1015 Ga0068856_100260362
1016 Ga0068856_100475033
1017 Ga0068856_100480456
1018 Ga0068856_100931953
1019 Ga0070702_100833148
1020 Ga0068852_100008043
1021 Ga0068852_100174804
1022 Ga0068859_100020418
1023 Ga0068859_100178016
1024 Ga0068859_100370092
1025 Ga0068859_100426099
1026 Ga0068859_101207000
1027 Ga0068864_100047345
1028 Ga0068864_100355570
1029 Ga0068864_100381523
1030 Ga0068864_100464192
1031 Ga0068864_100616238
1032 Ga0068864_101886380
1033 Ga0068866_10143807
1034 Ga0068866_10453919
1035 Ga0068866_10697109
1036 Ga0068866_11387748
1037 Ga0068863_100031885
1038 Ga0068863_100140513
1039 Ga0068863_100762428
1040 Ga0068858_100073443
1041 Ga0068858_100141925
1042 Ga0068858_100161660
1043 Ga0068858_100194691
1044 Ga0068858_100218591
1045 Ga0068858_100424993
1046 Ga0068858_102130629
1047 Ga0068860_100036657
1048 Ga0068860_100258421
1049 Ga0068860_100428836
1050 Ga0068860_100861299
1051 Ga0068860_101527928
1052 Ga0068860_102153782
1053 Ga0070717_10022785
1054 Ga0070717_10724752
1055 Ga0070715_10338888
1056 Ga0070715_10419491
1057 Ga0070712_100423408
1058 Ga0070712_100493249
1059 Ga0097621_100007230
1060 Ga0097621_100029491
1061 Ga0097621_100035287
1062 Ga0097621_100036622
1063 Ga0097621_100036646
1064 Ga0097621_100124371
1065 Ga0097621_100256693
1066 Ga0097621_100451670
1067 Ga0097621_100762528
1068 Ga0097621_100872834
1069 Ga0068871_100041681
1070 Ga0068871_100059348
1071 Ga0068871_100063272
1072 Ga0068871_100069414
1073 Ga0068871_100111964
1074 Ga0068871_100266292
1075 Ga0068871_100278824
1076 Ga0068871_100328810
1077 Ga0068871_100400741
1078 Ga0068871_100718066
1079 Ga0068871_100778094
1080 Ga0068871_100854086
1081 Ga0075428_101059817
1082 Ga0075431_100022765
1083 Ga0075434_100931815
1084 Ga0075434_101967340
1085 Ga0068865_100021719
1086 Ga0068865_100426901
1087 Ga0068865_100488717
1088 Ga0075436_101028988
1089 Ga0097620_100020418
1090 Ga0097620_100178009
1091 Ga0097620_100370077
1092 Ga0097620_100426109
1093 Ga0097620_101206734
1094 Ga0099794_10461738
1095 Ga0105240_10001445
1096 Ga0105240_10013455
1097 Ga0105240_10014978
1098 Ga0105240_10050088
1099 Ga0105240_10051197
1100 Ga0105240_10061008
1101 Ga0105240_10160138
1102 Ga0105240_10168597
1103 Ga0105240_10277150
1104 Ga0105240_10284196
1105 Ga0105240_10316251
1106 Ga0105240_11117380
1107 Ga0105240_11483725
1108 Ga0111539_10570661
1109 Ga0105245_10001935
1110 Ga0105245_10006150
1111 Ga0105245_10046178
1112 Ga0105245_10084207
1113 Ga0105245_10087198
1114 Ga0105245_10121343
1115 Ga0105245_10178990
1116 Ga0105245_10229961
1117 Ga0105245_10273191
1118 Ga0105245_10277754
1119 Ga0105245_10327107
1120 Ga0105245_10546923
1121 Ga0105245_10567099
1122 Ga0105245_12710646
1123 Ga0105247_10018459
1124 Ga0105247_10230713
1125 Ga0114129_10148036
1126 Ga0105243_10184172
1127 Ga0105243_10358414
1128 Ga0105243_11085734
1129 Ga0105243_11630761
1130 Ga0105241_10002797
1131 Ga0105241_10006036
1132 Ga0105241_10035266
1133 Ga0105241_10052247
1134 Ga0105241_10076277
1135 Ga0105241_10133384
1136 Ga0105241_10281487
1137 Ga0105241_10522697
1138 Ga0105241_10529675
1139 Ga0105241_11317101
1140 Ga0105241_11626683
1141 Ga0105241_11931604
1142 Ga0105241_12383015
1143 Ga0105242_10022206
1144 Ga0105242_10071782
1145 Ga0105242_10092386
1146 Ga0105242_10104238
1147 Ga0105242_10162167
1148 Ga0105242_10204027
1149 Ga0105242_10216133
1150 Ga0105242_10382985
1151 Ga0105242_11508197
1152 Ga0105242_11536258
1153 Ga0105242_12423912
1154 Ga0105242_12647641
1155 Ga0105242_12847815
1156 Ga0105242_12958796
1157 Ga0105248_10018112
1158 Ga0105248_10052214
1159 Ga0105248_10068791
1160 Ga0105248_10080276
1161 Ga0105248_10275286
1162 Ga0105248_10315442
1163 Ga0105248_10369150
1164 Ga0105248_10543542
1165 Ga0105248_10684976
1166 Ga0105248_10700855
1167 Ga0105248_10701089
1168 Ga0105248_10855586
1169 Ga0105248_11107949
1170 Ga0105248_11461382
1171 Ga0105237_10008991
1172 Ga0105237_10036849
1173 Ga0105237_10081124
1174 Ga0105237_10084194
1175 Ga0105237_10185440
1176 Ga0105237_10194821
1177 Ga0105237_10390575
1178 Ga0105237_10398653
1179 Ga0105237_10416059
1180 Ga0105237_10798416
1181 Ga0105238_10000599
1182 Ga0105238_10003339
1183 Ga0105238_10010862
1184 Ga0105238_10017202
1185 Ga0105238_10025296
1186 Ga0105238_10045342
1187 Ga0105238_10123966
1188 Ga0105238_10176056
1189 Ga0105238_10193604
1190 Ga0105238_10444872
1191 Ga0105238_10492215
1192 Ga0105238_11217027
1193 Ga0105249_10126209
1194 Ga0105249_10411436
1195 Ga0105249_11565999
1196 Ga0105249_12024599
1197 Ga0105249_12851589
1198 Ga0105239_10000963
1199 Ga0105239_10002731
1200 Ga0105239_10003562
1201 Ga0105239_10005855
1202 Ga0105239_10014036
1203 Ga0105239_10032014
1204 Ga0105239_10157271
1205 Ga0105239_10233093
1206 Ga0105239_10315634
1207 Ga0105239_10544048
1208 Ga0105239_12177551
1209 Ga0105246_10051444
1210 Ga0105246_10052668
1211 Ga0105246_10074202
1212 Ga0105246_10307800
1213 Ga0105246_10427261
1214 Ga0105246_10791298
1215 Ga0105246_11394829
1216 Ga0157373_10239584
1217 Ga0157373_11155402
1218 Ga0157371_10359554
1219 Ga0157370_10006562
1220 Ga0157370_10012942
1221 Ga0157370_10035171
1222 Ga0157370_10141654
1223 Ga0157370_10196040
1224 Ga0157369_10000449
1225 Ga0157369_10006340
1226 Ga0157369_10007671
1227 Ga0157369_10021520
1228 Ga0157369_10346714
1229 Ga0157369_10546326
1230 Ga0157374_10047482
1231 Ga0157374_10108795
1232 Ga0157374_10119809
1233 Ga0157374_10160638
1234 Ga0157374_10431942
1235 Ga0157374_11020632
1236 Ga0157374_11975835
1237 Ga0157378_10087923
1238 Ga0157378_10113687
1239 Ga0157378_10140783
1240 Ga0157378_10686175
1241 Ga0157378_10972907
1242 Ga0157378_11395065
1243 Ga0157378_11742899
1244 Ga0163162_10003010
1245 Ga0163162_10136983
1246 Ga0163162_10418741
1247 Ga0163162_10650201
1248 Ga0163162_10752080
1249 Ga0163162_10831141
1250 Ga0163162_11811040
1251 Ga0163162_11829522
1252 Ga0163162_11909113
1253 Ga0157372_10036561
1254 Ga0157372_10049671
1255 Ga0157372_10051720
1256 Ga0157372_10054407
1257 Ga0157372_10426072
1258 Ga0157372_10636266
1259 Ga0157372_10758853
1260 Ga0157375_10002947
1261 Ga0157375_10038859
1262 Ga0157375_10074787
1263 Ga0157375_10149301
1264 Ga0157375_10674014
1265 Ga0157375_10950784
1266 Ga0157375_11213890
1267 Ga0157375_11531132
1268 Ga0157375_11582330
1269 Ga0157375_11802770
1270 Ga0163163_10008110
1271 Ga0163163_10041562
1272 Ga0163163_10077713
1273 Ga0163163_10151063
1274 Ga0163163_10228107
1275 Ga0163163_10251044
1276 Ga0163163_10385418
1277 Ga0163163_10801860
1278 Ga0163163_11101884
1279 Ga0157380_10198119
1280 Ga0157380_11746540
1281 Ga0157379_10041952
1282 Ga0157379_10121375
1283 Ga0157379_10229016
1284 Ga0157379_10350977
1285 Ga0157379_10357927
1286 Ga0157379_10384995
1287 Ga0157379_11491411
1288 Ga0157376_10153947
1289 Ga0157376_10167198
1290 Ga0157376_10200505
1291 Ga0157376_10351217
1292 Ga0157376_10426426
1293 Ga0157376_10507554
1294 Ga0157376_10559199
1295 Ga0157376_10967514
1296 Ga0157376_11124465
1297 Ga0157376_11210917
1298 Ga0157376_11292195
1299 Ga0163161_10666915
1300 Ga0163161_11598543
1301 Ga0213875_10019213
1302 Ga0207692_10134819
1303 Ga0207642_10080071
1304 Ga0207642_10093423
1305 Ga0207642_10261660
1306 Ga0207642_10415692
1307 Ga0207710_10226736
1308 Ga0207680_10013109
1309 Ga0207680_10133057
1310 Ga0207680_10682820
1311 Ga0207680_10881402
1312 Ga0207699_10111091
1313 Ga0207699_10372619
1314 Ga0207645_10083743
1315 Ga0207705_10037989
1316 Ga0207654_10008097
1317 Ga0207654_10019251
1318 Ga0207654_10021079
1319 Ga0207654_10030947
1320 Ga0207654_10041382
1321 Ga0207654_10211585
1322 Ga0207654_10534043
1323 Ga0207707_10003018
1324 Ga0207707_10078056
1325 Ga0207707_10089651
1326 Ga0207707_10165548
1327 Ga0207707_10383262
1328 Ga0207707_10769701
1329 Ga0207695_10001453
1330 Ga0207695_10003944
1331 Ga0207695_10007981
1332 Ga0207695_10008516
1333 Ga0207695_10021195
1334 Ga0207695_10067594
1335 Ga0207695_10075970
1336 Ga0207695_10430677
1337 Ga0207695_11056820
1338 Ga0207695_11420756
1339 Ga0207671_10023873
1340 Ga0207671_10047667
1341 Ga0207671_10055126
1342 Ga0207671_10067572
1343 Ga0207671_10292895
1344 Ga0207671_11014997
1345 Ga0207671_11085881
1346 Ga0207671_11260160
1347 Ga0207693_10176885
1348 Ga0207663_10133221
1349 Ga0207663_10186163
1350 Ga0207663_10189239
1351 Ga0207663_10268209
1352 Ga0207660_10080060
1353 Ga0207660_10323751
1354 Ga0207657_10001616
1355 Ga0207657_10067678
1356 Ga0207657_10100986
1357 Ga0207657_10169808
1358 Ga0207657_11042485
1359 Ga0207649_10082921
1360 Ga0207652_10001181
1361 Ga0207652_10038658
1362 Ga0207652_10384541
1363 Ga0207652_10748180
1364 Ga0207694_10000448
1365 Ga0207694_10003244
1366 Ga0207694_10007766
1367 Ga0207694_10025523
1368 Ga0207694_10031802
1369 Ga0207694_10032283
1370 Ga0207694_10045660
1371 Ga0207694_10248954
1372 Ga0207694_10462252
1373 Ga0207694_10843245
1374 Ga0207650_10539876
1375 Ga0207659_10228439
1376 Ga0207687_10001795
1377 Ga0207687_10007087
1378 Ga0207687_10015219
1379 Ga0207687_10026024
1380 Ga0207687_10064372
1381 Ga0207687_10090074
1382 Ga0207687_10181524
1383 Ga0207687_10315338
1384 Ga0207687_10334041
1385 Ga0207687_10346954
1386 Ga0207687_10425539
1387 Ga0207687_10893910
1388 Ga0207687_11756041
1389 Ga0207700_10006564
1390 Ga0207700_10019238
1391 Ga0207700_10024933
1392 Ga0207700_10239930
1393 Ga0207700_10394727
1394 Ga0207700_10622215
1395 Ga0207700_11491618
1396 Ga0207664_10029384
1397 Ga0207664_10656606
1398 Ga0207644_10057523
1399 Ga0207644_10585502
1400 Ga0207644_10702593
1401 Ga0207690_10078006
1402 Ga0207706_10127218
1403 Ga0207686_10006571
1404 Ga0207686_10009264
1405 Ga0207686_10010944
1406 Ga0207686_10097499
1407 Ga0207686_10274270
1408 Ga0207686_10481943
1409 Ga0207686_10684157
1410 Ga0207709_10231814
1411 Ga0207709_10235741
1412 Ga0207709_10301589
1413 Ga0207709_10516126
1414 Ga0207709_11722565
1415 Ga0207670_10883774
1416 Ga0207704_10039559
1417 Ga0207704_10200496
1418 Ga0207704_10270097
1419 Ga0207704_10336029
1420 Ga0207704_10439077
1421 Ga0207665_10294263
1422 Ga0207711_10002029
1423 Ga0207711_10003043
1424 Ga0207711_10099643
1425 Ga0207711_10159152
1426 Ga0207711_10174704
1427 Ga0207711_10190267
1428 Ga0207711_10204314
1429 Ga0207711_10219084
1430 Ga0207711_10258181
1431 Ga0207711_10400987
1432 Ga0207711_11105788
1433 Ga0207689_10153540
1434 Ga0207689_10381544
1435 Ga0207689_10595434
1436 Ga0207689_10929528
1437 Ga0207661_10070300
1438 Ga0207661_10136679
1439 Ga0207661_10182944
1440 Ga0207661_10272446
1441 Ga0207661_10274799
1442 Ga0207661_10576996
1443 Ga0207661_11109287
1444 Ga0207679_10050164
1445 Ga0207679_10146157
1446 Ga0207679_10184360
1447 Ga0207679_10465691
1448 Ga0207667_10000290
1449 Ga0207667_10001654
1450 Ga0207667_10004072
1451 Ga0207667_10043852
1452 Ga0207667_10099935
1453 Ga0207667_10116956
1454 Ga0207667_10244219
1455 Ga0207667_10339766
1456 Ga0207667_10643959
1457 Ga0207667_11748592
1458 Ga0207667_11871916
1459 Ga0207651_10874423
1460 Ga0207712_10105483
1461 Ga0207640_10274844
1462 Ga0207640_11687058
1463 Ga0207677_10002199
1464 Ga0207677_10019458
1465 Ga0207677_10264019
1466 Ga0207677_10289217
1467 Ga0207677_10698716
1468 Ga0207677_10819108
1469 Ga0207677_11952363
1470 Ga0207703_10037194
1471 Ga0207703_10115744
1472 Ga0207703_10185424
1473 Ga0207703_10312040
1474 Ga0207703_10316749
1475 Ga0207703_10970368
1476 Ga0207703_11443691
1477 Ga0207703_12068796
1478 Ga0207639_10074186
1479 Ga0207639_10252521
1480 Ga0207639_10309543
1481 Ga0207639_10557003
1482 Ga0207639_10718293
1483 Ga0207702_10004522
1484 Ga0207702_10012004
1485 Ga0207702_10175129
1486 Ga0207702_10244158
1487 Ga0207702_10263771
1488 Ga0207702_10334649
1489 Ga0207702_11099338
1490 Ga0207702_11993422
1491 Ga0207641_10067796
1492 Ga0207641_10119491
1493 Ga0207641_10336210
1494 Ga0207641_10974748
1495 Ga0207641_11116547
1496 Ga0207641_11475762
1497 Ga0207648_10147912
1498 Ga0207648_10168295
1499 Ga0207648_11624835
1500 Ga0207676_10124588
1501 Ga0207676_10254460
1502 Ga0207676_10311152
1503 Ga0207676_10391028
1504 Ga0207676_10795226
1505 Ga0207676_11278122
1506 Ga0207676_11923987
1507 Ga0207674_10000985
1508 Ga0207674_10019772
1509 Ga0207674_10055454
1510 Ga0207674_10059067
1511 Ga0207674_11820290
1512 Ga0207675_101727854
1513 Ga0207683_10691174
1514 Ga0207698_10269267
1515 Ga0207698_11091896
1516 Ga0207698_11245371
1517 Ga0207698_11344436
1518 Ga0209588_1193079
1519 Ga0268266_10003108
1520 Ga0268266_11377961
1521 Ga0268264_10054641
1522 Ga0268264_10137809
1523 Ga0268264_10231885
1524 Ga0268264_11040024
1525 Ga0268264_11932919
1526 Ga0265338_10408391
1527 Ga0265760_10071018
1528 Ga0265332_10024535
1529 Ga0265325_10106269
1530 Ga0265339_10148325
1531 Ga0265331_10040901
1532 Ga0265331_10068858
1533 Ga0265331_10379035
1534 Ga0265316_10007594
1535 Ga0265316_10013946
1536 Ga0265316_10048971
1537 Ga0265316_10065984
1538 Ga0265316_10070056
1539 Ga0265316_10092048
1540 Ga0265316_10151436
1541 Ga0265316_10154524
1542 Ga0265316_10227713
1543 Ga0265313_10005690
1544 Ga0265313_10096410
1545 Ga0265313_10180192
1546 Ga0265314_10000559
1547 Ga0265314_10000932
1548 Ga0265314_10063352
1549 Ga0265314_10109185
1550 Ga0265314_10206687
1551 Ga0265342_10352392
1552 Ga0373926_0208252
1553 Ga0373934_0001924
1554 Ga0373934_0034130
1555 Ga0373934_0048464
1556 Ga0373923_0015943
1557 Ga0373936_0139542
1558 Ga0373945_0359735
1559 Ga0373953_0266112
1560 Ga0373953_0289914
1561 Ga0373954_0002014
1562 Ga0373954_0217849
1563 Ga0373956_0038601
1564 Ga0373956_0473747
1565 Ga0373957_0169538
1566 Ga0373960_0344921
1567 Ga0373943_0014711
1568 Ga0373943_0038001
1569 Ga0373943_0367708
1570 Ga0373943_0527193
1571 Ga0373946_0121181
1572 Ga0373955_0023707
1573 Ga0373955_0123148
1574 Ga0373955_0142744
1575 Ga0373924_0148084
1576 Ga0373935_0162041
1577 Ga0373935_0362754
1578 Ga0373935_0420553
1579 Ga0373935_0843837
1580 Ga0373927_0003424
1581 Ga0373927_0075373
1582 Ga0373927_0258526
1583 Ga0373927_0260657
1584 Ga0373927_0596064
1585 Ga0373933_0079161
1586 Ga0373933_0448942
1587 Ga0373933_0512078
1588 Ga0373947_0003449
1589 Ga0373947_0274520
1590 Ga0373947_0678450
1591 Ga0373947_0880674
1592 Ga0373947_0965936
1593 Ga0373947_1265034
1594 Ga0373937_0001907
1595 Ga0373937_0020084
1596 Ga0373937_0057467
1597 Ga0373937_0137776
1598 Ga0373937_0197728
1599 Ga0373937_0368066
1600 Ga0373937_0389586
1601 Ga0373937_0492129
1602 Ga0373925_0001244
1603 Ga0373925_0017973
1604 Ga0373925_0079912
1605 Ga0373925_0099449
1606 Ga0373925_0246478
1607 Ga0373925_0292436
1608 Ga0373925_0328371
1609 Ga0373925_0417960
1610 Ga0373925_0974647
1611 Ga0436364_0634814
1612 Ga0436364_0680395
1613 Ga0436364_1261791
1614 Ga0436364_1424376
1615 Ga0242420_118898
1616 Ga0436365_0496136
1617 Ga0436365_1778402
1618 Ga0436360_1273375
1619 Ga0451839_1534484
1620 Ga0451853_2905678
1621 Ga0453684_0251538
1622 Ga0451576_0026734
1623 Ga0451576_0566931
1624 Ga0451576_0936164
1625 Ga0451576_2298897
1626 Ga0495592_0012783
1627 Ga0495592_0029959
1628 Ga0495651_0029066
1629 Ga0495651_0239089
1630 Ga0495653_0282738
1631 Ga0495653_0397888
1632 Ga0495653_0712770
1633 Ga0495580_0000307
1634 Ga0495580_0061918
1635 Ga0495580_0269560
1636 Ga0495580_0345047
1637 Ga0495580_0346643
1638 Ga0495580_0546433
1639 Ga0495582_0011352
1640 Ga0495639_0414826
1641 Ga0495664_0013254
1642 Ga0495664_0508738
1643 Ga0495664_0581877
1644 Ga0495594_0131671
1645 Ga0495594_0178198
1646 Ga0495594_0240751
1647 Ga0495594_0356019
1648 Ga0495618_0255258
1649 Ga0495628_0024119
1650 Ga0495628_0059017
1651 Ga0495628_0068257
1652 Ga0495628_0591773
1653 Ga0495628_0720547
1654 Ga0495630_0018918
1655 Ga0495630_0168767
1656 Ga0495666_0085266
1657 Ga0495652_0040924
1658 Ga0495652_0118195
1659 Ga0495652_0175855
1660 Ga0495652_0253109
1661 Ga0495652_0646580
1662 Ga0495665_0085194
1663 Ga0495665_0181226
1664 Ga0495665_0198207
1665 Ga0495665_0208968
1666 Ga0495640_0048723
1667 Ga0495586_0111443
1668 Ga0495586_0273994
1669 Ga0495586_0288036
1670 Ga0495587_0001113
1671 Ga0495587_0045658
1672 Ga0495587_0076792
1673 Ga0495587_0178035
1674 Ga0495645_0002625
1675 Ga0495645_0343442
1676 Ga0495645_0670234
1677 Ga0495633_0214867
1678 Ga0495667_0300376
1679 Ga0495634_0071303
1680 Ga0495634_0077186
1681 Ga0495635_0882156
1682 Ga0495599_0004841
1683 Ga0495599_0007068
1684 Ga0495599_0058293
1685 Ga0495599_0312479
1686 Ga0495623_0171961
1687 Ga0495623_0363307
1688 Ga0495623_0501937
1689 Ga0495623_0624217
1690 Ga0495646_0257567
1691 Ga0495658_0166869
1692 Ga0495658_0603580
1693 Ga0495669_0133631
1694 Ga0495669_0388141
1695 Ga0495613_0090378
1696 Ga0495613_0132561
1697 Ga0495613_0247721
1698 Ga0495613_0961336
1699 Ga0495600_0053298
1700 Ga0495600_0305439
1701 Ga0495604_0153282
1702 Ga0495604_0156996
1703 Ga0495604_0923559
1704 Ga0495636_0088624
1705 Ga0495674_0045746
1706 Ga0495674_0051721
1707 Ga0495674_0287979
1708 Ga0495674_0308153
1709 Ga0495674_0406935
1710 Ga0495674_0715622
1711 Ga0495680_0247480
1712 Ga0495680_0479888
1713 Ga0495675_0068772
1714 Ga0495675_0115713
1715 Ga0495675_0136572
1716 Ga0495684_0004128
1717 Ga0495684_0016021
1718 Ga0495684_0024166
1719 Ga0495684_0065364
1720 Ga0495684_0180024
1721 Ga0495684_0272439
1722 Ga0495684_0720098
1723 Ga0495593_0133971
1724 Ga0495593_0138230
1725 Ga0495602_0001372
1726 Ga0495602_0118037
1727 Ga0495602_0180894
1728 Ga0495602_0184490
1729 Ga0496102_1062717
1730 Ga0496104_0259643
1731 Ga0496105_0216939
1732 Ga0496115_0046537
1733 Ga0496115_0162753
1734 Ga0496115_0285517
1735 Ga0501073_0931105
1736 nmdc:mga05p37_108043_c1
1737 nmdc:mga06r32_59860_c1
1738 nmdc:mga08y16_526036_c1
1739 nmdc:mga0n895_1485647_c1
1740 Ga0495601_0077502
1741 Ga0495601_0166533
1742 Ga0495601_0232250
1743 Ga0495601_0277554
1744 Ga0495619_0784833

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

5

139

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r2d-assembly1.cif.gz_A crystal structure of antitermination factors nusb and nuse in complex with dsrna 0.8789 1 137
4eya-assembly1.cif.gz_A crystal structure of a plectonemic rna supercoil 0.8628 1 142
1eyv-assembly1.cif.gz_A the crystal structure of nusb from mycobacterium tuberculosis 0.8622 4 134
3r2d-assembly1.cif.gz_A crystal structure of antitermination factors nusb and nuse in complex with dsrna 0.8605 1 137
4eya-assembly1.cif.gz_A crystal structure of a plectonemic rna supercoil 0.8569 1 142
ID Description Score Start End Superfamily
3r2cB00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8913 1 137 1.10.940.10
af_P9WIV1_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8828 1 134 1.10.940.10
af_P9WGX3_13_148_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8709 7 134 1.10.940.10
af_Q2FY45_1_129_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8707 4 134 1.10.940.10
4eyaA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8628 1 142 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A3C0NFI9-F1-model_v4 Transcription antitermination factor NusB 0.9714 57 139 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-X0VZ87-F1-model_v4 NusB/RsmB/TIM44 domain-containing protein 0.9693 50 136 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A7V9VDP9-F1-model_v4 Transcription antitermination protein NusB 0.9633 53 139 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A5T1FJI6-F1-model_v4 Transcription antitermination factor NusB 0.9631 51 138 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A7R8GCD7-F1-model_v4 deleted 0.9627 1 138

Map