F484076

General Info

Members Datasets Scaffolds Average Seq Length
868 274 1736 145

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100136020|Ga0070711_1001360202
Length 157
Sequence LTVRVSETTVRVRYAETDQMGVVYHANYLVWFEVGRVEFLRQLGFSYKDMELQDGCHIAVVDARCRYKAPARYDDEVIVRTHLKNVRESLVHFGYELMRASDGTLLAEGETTHVVIDRDMKKRPIPEKYMVLFKEAVGRESQEATGTTTKDTKLHQG

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
184 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 6.34
Rhizosphere 92.97
Stem 0
Stem Tuber 0
Unclassified 13.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100136020 3300005439 Bacteria 1836
2 JGI24751J29686_10077680 3300002459 Bacteria 687
3 Ga0070658_10183734 3300005327 Bacteria 1760
4 Ga0070658_10473684 3300005327 Unclassified 1080
5 Ga0070676_10120072 3300005328 Bacteria 1649
6 Ga0070676_10150941 3300005328 Bacteria 1487
7 Ga0070683_100006636 3300005329 Bacteria 9718
8 Ga0070683_100022644 3300005329 Bacteria 5618
9 Ga0070683_100053077 3300005329 Bacteria 3756
10 Ga0070683_100058646 3300005329 Bacteria 3576
11 Ga0070690_100109213 3300005330 Bacteria 1843
12 Ga0070670_100038874 3300005331 Bacteria 4091
13 Ga0070670_100042905 3300005331 Bacteria 3889
14 Ga0070670_100553343 3300005331 Bacteria 1027
15 Ga0070677_10076385 3300005333 Bacteria 1422
16 Ga0070677_10197709 3300005333 Bacteria 968
17 Ga0068869_100079150 3300005334 Bacteria 2449
18 Ga0068869_100103590 3300005334 Bacteria 2156
19 Ga0068869_100165271 3300005334 Bacteria 1725
20 Ga0068869_100270524 3300005334 Bacteria 1363
21 Ga0070666_10074121 3300005335 Bacteria 2319
22 Ga0070666_10191695 3300005335 Unclassified 1436
23 Ga0070666_10223830 3300005335 Bacteria 1327
24 Ga0070680_100195736 3300005336 Bacteria 1704
25 Ga0070680_100221167 3300005336 Unclassified 1598
26 Ga0070682_100010473 3300005337 Bacteria 5263
27 Ga0068868_100012625 3300005338 Bacteria 6178
28 Ga0068868_100078186 3300005338 Bacteria 2648
29 Ga0068868_100138891 3300005338 Bacteria 1993
30 Ga0068868_100384827 3300005338 Bacteria 1208
31 Ga0070660_100026704 3300005339 Bacteria 4302
32 Ga0070660_100027002 3300005339 Bacteria 4281
33 Ga0070689_100005074 3300005340 Bacteria 8956
34 Ga0070689_100160663 3300005340 Bacteria 1816
35 Ga0070691_10202934 3300005341 Unclassified 1042
36 Ga0070687_100007802 3300005343 Bacteria 4492
37 Ga0070661_100003462 3300005344 Bacteria 10887
38 Ga0070661_100010336 3300005344 Bacteria 6488
39 Ga0070661_100412474 3300005344 Archaea 1069
40 Ga0070661_100423754 3300005344 Bacteria 1055
41 Ga0070668_100015936 3300005347 Bacteria 5623
42 Ga0070668_100062131 3300005347 Bacteria 2893
43 Ga0070668_100496214 3300005347 Bacteria 1056
44 Ga0070669_100047361 3300005353 Bacteria 3136
45 Ga0070669_100285297 3300005353 Bacteria 1324
46 Ga0070675_100007668 3300005354 Bacteria 8353
47 Ga0070675_100148455 3300005354 Bacteria 2009
48 Ga0070671_100062888 3300005355 Bacteria 3090
49 Ga0070671_100091166 3300005355 Bacteria 2552
50 Ga0070671_100183036 3300005355 Unclassified 1774
51 Ga0070671_100477738 3300005355 Bacteria 1071
52 Ga0070674_100716487 3300005356 Unclassified 857
53 Ga0070674_100870868 3300005356 Unclassified 783
54 Ga0070673_100009261 3300005364 Bacteria 6606
55 Ga0070673_101300112 3300005364 Bacteria 683
56 Ga0070688_100016279 3300005365 Bacteria 4248
57 Ga0070688_100626148 3300005365 Unclassified 826
58 Ga0070659_100132556 3300005366 Bacteria 2025
59 Ga0070659_100369452 3300005366 Unclassified 1206
60 Ga0070659_100738416 3300005366 Bacteria 853
61 Ga0070667_100098177 3300005367 Bacteria 2527
62 Ga0070667_100114229 3300005367 Bacteria 2344
63 Ga0070667_100238981 3300005367 Bacteria 1621
64 Ga0070709_10004498 3300005434 Bacteria 7521
65 Ga0070709_10005976 3300005434 Bacteria 6611
66 Ga0070709_10007306 3300005434 Bacteria 6054
67 Ga0070709_10023147 3300005434 Bacteria 3644
68 Ga0070709_10465670 3300005434 Bacteria 955
69 Ga0070714_100001723 3300005435 Bacteria 15936
70 Ga0070714_100132644 3300005435 Bacteria 2227
71 Ga0070714_100184613 3300005435 Bacteria 1900
72 Ga0070714_100185920 3300005435 Bacteria 1893
73 Ga0070714_100196833 3300005435 Bacteria 1842
74 Ga0070714_100456735 3300005435 Unclassified 1214
75 Ga0070714_100462952 3300005435 Bacteria 1206
76 Ga0070714_100884008 3300005435 Bacteria 867
77 Ga0070714_101391905 3300005435 Bacteria 685
78 Ga0070713_100008149 3300005436 Bacteria 7418
79 Ga0070713_100019702 3300005436 Bacteria 5159
80 Ga0070713_100041872 3300005436 Bacteria 3734
81 Ga0070713_100078087 3300005436 Bacteria 2817
82 Ga0070713_100136459 3300005436 Unclassified 2168
83 Ga0070713_100222094 3300005436 Unclassified 1714
84 Ga0070713_100322670 3300005436 Bacteria 1427
85 Ga0070713_100850179 3300005436 Bacteria 876
86 Ga0070713_100974931 3300005436 Bacteria 817
87 Ga0070710_10011514 3300005437 Bacteria 4371
88 Ga0070710_10014736 3300005437 Bacteria 3940
89 Ga0070710_10057296 3300005437 Bacteria 2208
90 Ga0070710_10151247 3300005437 Bacteria 1432
91 Ga0070710_10604282 3300005437 Bacteria 764
92 Ga0070711_100006475 3300005439 Bacteria 7062
93 Ga0070711_100060506 3300005439 Bacteria 2633
94 Ga0070711_100143547 3300005439 Unclassified 1793
95 Ga0070711_100327222 3300005439 Bacteria 1226
96 Ga0070711_100463904 3300005439 Bacteria 1039
97 Ga0070711_101538795 3300005439 Bacteria 581
98 Ga0070694_100129345 3300005444 Bacteria 1822
99 Ga0070694_100302295 3300005444 Bacteria 1226
100 Ga0070708_100006976 3300005445 Bacteria 9015
101 Ga0070708_100107434 3300005445 Bacteria 2562
102 Ga0070708_100204161 3300005445 Bacteria 1851
103 Ga0070663_100012400 3300005455 Bacteria 5391
104 Ga0070663_100042296 3300005455 Bacteria 3201
105 Ga0070663_100156493 3300005455 Bacteria 1751
106 Ga0070678_100012210 3300005456 Bacteria 5329
107 Ga0070678_100043842 3300005456 Bacteria 3189
108 Ga0070678_100135024 3300005456 Bacteria 1966
109 Ga0070662_100015996 3300005457 Bacteria 5033
110 Ga0070662_100171614 3300005457 Bacteria 1703
111 Ga0070662_100388605 3300005457 Bacteria 1150
112 Ga0070681_10000091 3300005458 Bacteria 67429
113 Ga0070681_10004214 3300005458 Bacteria 13624
114 Ga0070681_10072143 3300005458 Bacteria 3416
115 Ga0070681_10252259 3300005458 Bacteria 1677
116 Ga0070681_10500111 3300005458 Bacteria 1129
117 Ga0068867_100009336 3300005459 Bacteria 6923
118 Ga0068867_100028544 3300005459 Bacteria 4018
119 Ga0068867_101358641 3300005459 Unclassified 658
120 Ga0070685_10006781 3300005466 Bacteria 5845
121 Ga0070706_100000723 3300005467 Bacteria 37178
122 Ga0070706_100001205 3300005467 Bacteria 27687
123 Ga0070706_100935337 3300005467 Unclassified 800
124 Ga0070707_100001499 3300005468 Bacteria 22754
125 Ga0070707_100289777 3300005468 Bacteria 1591
126 Ga0070707_100293207 3300005468 Bacteria 1581
127 Ga0070707_101340160 3300005468 Unclassified 682
128 Ga0070698_100000131 3300005471 Bacteria 65450
129 Ga0070699_100004921 3300005518 Bacteria 11785
130 Ga0070699_100007791 3300005518 Bacteria 9308
131 Ga0070699_100444565 3300005518 Unclassified 1175
132 Ga0070699_100823529 3300005518 Bacteria 850
133 Ga0070679_100103519 3300005530 Bacteria 2833
134 Ga0070679_100359089 3300005530 Bacteria 1404
135 Ga0070679_100900282 3300005530 Bacteria 828
136 Ga0070684_100014426 3300005535 Bacteria 6402
137 Ga0070684_100024985 3300005535 Bacteria 5017
138 Ga0070684_100085898 3300005535 Unclassified 2791
139 Ga0070684_100305737 3300005535 Bacteria 1460
140 Ga0070697_100000553 3300005536 Bacteria 28150
141 Ga0070697_100000581 3300005536 Bacteria 27631
142 Ga0070697_100006547 3300005536 Bacteria 9022
143 Ga0070697_100014030 3300005536 Bacteria 6293
144 Ga0070697_100114162 3300005536 Bacteria 2254
145 Ga0070697_100891589 3300005536 Bacteria 789
146 Ga0068853_100011303 3300005539 Bacteria 7246
147 Ga0068853_100015687 3300005539 Bacteria 6223
148 Ga0068853_100052920 3300005539 Bacteria 3496
149 Ga0068853_100303119 3300005539 Bacteria 1477
150 Ga0068853_100600122 3300005539 Bacteria 1045
151 Ga0070672_100035545 3300005543 Bacteria 3788
152 Ga0070686_100266454 3300005544 Unclassified 1258
153 Ga0070686_101643056 3300005544 Bacteria 544
154 Ga0070695_100010945 3300005545 Bacteria 5421
155 Ga0070696_100053833 3300005546 Bacteria 2802
156 Ga0070693_100219153 3300005547 Unclassified 1246
157 Ga0070693_100223443 3300005547 Bacteria 1235
158 Ga0070693_100242393 3300005547 Unclassified 1191
159 Ga0070693_100263181 3300005547 Bacteria 1148
160 Ga0070665_100042318 3300005548 Bacteria 4578
161 Ga0070665_100165128 3300005548 Bacteria 2216
162 Ga0068855_100001406 3300005563 Bacteria 29877
163 Ga0068855_100001496 3300005563 Bacteria 29261
164 Ga0068855_100015256 3300005563 Bacteria 9248
165 Ga0068855_100152192 3300005563 Unclassified 2630
166 Ga0068855_100179221 3300005563 Bacteria 2396
167 Ga0068855_100244722 3300005563 Bacteria 2002
168 Ga0068855_100345247 3300005563 Bacteria 1640
169 Ga0068855_100521743 3300005563 Bacteria 1289
170 Ga0070664_100008528 3300005564 Bacteria 8287
171 Ga0070664_100023244 3300005564 Bacteria 5119
172 Ga0070664_100454936 3300005564 Bacteria 1176
173 Ga0070664_100459794 3300005564 Bacteria 1169
174 Ga0070664_100664886 3300005564 Bacteria 969
175 Ga0068857_100001930 3300005577 Bacteria 16712
176 Ga0068857_100009751 3300005577 Bacteria 8340
177 Ga0068857_100476265 3300005577 Bacteria 1169
178 Ga0068857_101198993 3300005577 Bacteria 735
179 Ga0068857_101392871 3300005577 Bacteria 682
180 Ga0068854_100001611 3300005578 Bacteria 13714
181 Ga0068854_100057385 3300005578 Bacteria 2808
182 Ga0068854_100068067 3300005578 Unclassified 2596
183 Ga0068856_100000685 3300005614 Bacteria 36811
184 Ga0068856_100001014 3300005614 Bacteria 29891
185 Ga0068856_100003158 3300005614 Bacteria 16799
186 Ga0068856_100025481 3300005614 Bacteria 5768
187 Ga0068856_100026883 3300005614 Bacteria 5612
188 Ga0068856_100031867 3300005614 Bacteria 5158
189 Ga0068856_100123663 3300005614 Bacteria 2590
190 Ga0068856_100595613 3300005614 Bacteria 1126
191 Ga0068856_100985816 3300005614 Bacteria 861
192 Ga0070702_100094074 3300005615 Bacteria 1824
193 Ga0070702_100270121 3300005615 Bacteria 1162
194 Ga0068852_100015747 3300005616 Bacteria 5878
195 Ga0068852_100033657 3300005616 Bacteria 4257
196 Ga0068852_100060954 3300005616 Bacteria 3277
197 Ga0068852_100116257 3300005616 Bacteria 2440
198 Ga0068852_100620395 3300005616 Bacteria 1087
199 Ga0068852_101022707 3300005616 Bacteria 845
200 Ga0068859_100001599 3300005617 Bacteria 23127
201 Ga0068859_100017494 3300005617 Bacteria 7206
202 Ga0068859_100195419 3300005617 Bacteria 2107
203 Ga0068859_100801232 3300005617 Unclassified 1030
204 Ga0068859_101782537 3300005617 Bacteria 680
205 Ga0068864_100002783 3300005618 Bacteria 14448
206 Ga0068864_100024773 3300005618 Bacteria 5048
207 Ga0068864_100085958 3300005618 Bacteria 2766
208 Ga0068864_100268678 3300005618 Bacteria 1588
209 Ga0068866_10002099 3300005718 Bacteria 8292
210 Ga0068866_10002683 3300005718 Bacteria 7346
211 Ga0068866_10007219 3300005718 Bacteria 4649
212 Ga0068866_10127722 3300005718 Unclassified 1441
213 Ga0068861_100064364 3300005719 Bacteria 2821
214 Ga0068861_100180909 3300005719 Bacteria 1755
215 Ga0068861_100645400 3300005719 Bacteria 977
216 Ga0068851_10013182 3300005834 Bacteria 3910
217 Ga0068851_10025116 3300005834 Bacteria 2921
218 Ga0068851_10045721 3300005834 Bacteria 2213
219 Ga0068851_10332927 3300005834 Unclassified 880
220 Ga0068870_10035040 3300005840 Bacteria 2573
221 Ga0068870_11459381 3300005840 Bacteria 503
222 Ga0068863_100029982 3300005841 Bacteria 5196
223 Ga0068863_100048280 3300005841 Bacteria 4037
224 Ga0068863_100065479 3300005841 Bacteria 3438
225 Ga0068863_100097671 3300005841 Unclassified 2789
226 Ga0068863_100142534 3300005841 Bacteria 2291
227 Ga0068863_100343740 3300005841 Bacteria 1452
228 Ga0068863_100372516 3300005841 Bacteria 1394
229 Ga0068858_100006528 3300005842 Bacteria 11349
230 Ga0068858_100008868 3300005842 Bacteria 9644
231 Ga0068858_100122287 3300005842 Bacteria 2435
232 Ga0068858_100149905 3300005842 Bacteria 2192
233 Ga0068858_100264867 3300005842 Bacteria 1634
234 Ga0068860_100015978 3300005843 Bacteria 7326
235 Ga0068860_100021939 3300005843 Bacteria 6178
236 Ga0068860_100068285 3300005843 Bacteria 3377
237 Ga0068860_100139848 3300005843 Bacteria 2326
238 Ga0068860_100391797 3300005843 Bacteria 1373
239 Ga0068862_100017271 3300005844 Bacteria 6006
240 Ga0068862_100065048 3300005844 Bacteria 3140
241 Ga0081540_1094157 3300005983 Bacteria 1309
242 Ga0070717_10001834 3300006028 Bacteria 14846
243 Ga0070717_10012640 3300006028 Bacteria 6441
244 Ga0070717_10021004 3300006028 Bacteria 5143
245 Ga0070717_10025062 3300006028 Bacteria 4738
246 Ga0070717_10279754 3300006028 Bacteria 1480
247 Ga0070717_10386864 3300006028 Bacteria 1255
248 Ga0070717_10414846 3300006028 Bacteria 1211
249 Ga0070717_10415275 3300006028 Bacteria 1210
250 Ga0070717_10574097 3300006028 Bacteria 1022
251 Ga0070715_10000310 3300006163 Bacteria 12021
252 Ga0070715_10697538 3300006163 Bacteria 606
253 Ga0070716_100000485 3300006173 Bacteria 16467
254 Ga0070716_100003566 3300006173 Bacteria 7346
255 Ga0070716_100076857 3300006173 Bacteria 1980
256 Ga0070716_100111070 3300006173 Bacteria 1699
257 Ga0070716_100211706 3300006173 Bacteria 1296
258 Ga0070716_100454173 3300006173 Bacteria 935
259 Ga0070716_100467272 3300006173 Unclassified 923
260 Ga0070712_100000813 3300006175 Bacteria 18539
261 Ga0070712_100005656 3300006175 Bacteria 7729
262 Ga0070712_100009221 3300006175 Bacteria 6214
263 Ga0070712_100013811 3300006175 Bacteria 5167
264 Ga0070712_100171528 3300006175 Unclassified 1684
265 Ga0070712_100548448 3300006175 Bacteria 974
266 Ga0070712_100752713 3300006175 Bacteria 834
267 Ga0070712_101109067 3300006175 Bacteria 687
268 Ga0070712_101516390 3300006175 Bacteria 586
269 Ga0097621_100001438 3300006237 Bacteria 16333
270 Ga0097621_100001799 3300006237 Bacteria 14719
271 Ga0097621_100054871 3300006237 Bacteria 3252
272 Ga0097621_100097084 3300006237 Bacteria 2473
273 Ga0097621_100105478 3300006237 Bacteria 2376
274 Ga0068871_100000261 3300006358 Bacteria 36328
275 Ga0068871_100000279 3300006358 Bacteria 35392
276 Ga0068871_100032097 3300006358 Bacteria 4145
277 Ga0068871_100061315 3300006358 Bacteria 3071
278 Ga0068871_100069562 3300006358 Bacteria 2891
279 Ga0068871_100082262 3300006358 Bacteria 2669
280 Ga0068871_100121662 3300006358 Bacteria 2205
281 Ga0068871_100295252 3300006358 Bacteria 1421
282 Ga0068871_100328505 3300006358 Unclassified 1348
283 Ga0068871_100940713 3300006358 Unclassified 802
284 Ga0075433_10783870 3300006852 Unclassified 833
285 Ga0075434_100343288 3300006871 Bacteria 1514
286 Ga0068865_100008272 3300006881 Bacteria 6425
287 Ga0068865_100014844 3300006881 Bacteria 4957
288 Ga0068865_100205945 3300006881 Bacteria 1530
289 Ga0075436_100005852 3300006914 Bacteria 8446
290 Ga0075436_100006248 3300006914 Bacteria 8162
291 Ga0075436_100012348 3300006914 Bacteria 5853
292 Ga0075436_100050826 3300006914 Bacteria 2861
293 Ga0075436_100059202 3300006914 Unclassified 2646
294 Ga0075436_100191019 3300006914 Bacteria 1449
295 Ga0075436_100288319 3300006914 Bacteria 1175
296 Ga0075436_100365063 3300006914 Unclassified 1042
297 Ga0097620_100001599 3300006931 Bacteria 23127
298 Ga0097620_100017494 3300006931 Bacteria 7206
299 Ga0097620_100195414 3300006931 Bacteria 2107
300 Ga0097620_100801291 3300006931 Unclassified 1030
301 Ga0097620_101782702 3300006931 Bacteria 680
302 Ga0075435_100022143 3300007076 Bacteria 4900
303 Ga0075435_100050257 3300007076 Bacteria 3355
304 Ga0075435_100357212 3300007076 Bacteria 1253
305 Ga0075435_100417610 3300007076 Bacteria 1155
306 Ga0075435_100924603 3300007076 Bacteria 761
307 Ga0105250_10176313 3300009092 Unclassified 896
308 Ga0105240_10006436 3300009093 Bacteria 17263
309 Ga0105240_10009266 3300009093 Bacteria 13963
310 Ga0105240_10059992 3300009093 Bacteria 4744
311 Ga0105240_10210837 3300009093 Bacteria 2270
312 Ga0105240_10394481 3300009093 Bacteria 1560
313 Ga0105240_10558245 3300009093 Bacteria 1266
314 Ga0105240_11764307 3300009093 Bacteria 645
315 Ga0105245_10036243 3300009098 Bacteria 4381
316 Ga0105245_10152812 3300009098 Bacteria 2184
317 Ga0105245_10319440 3300009098 Unclassified 1529
318 Ga0105245_10501057 3300009098 Bacteria 1230
319 Ga0105245_10516017 3300009098 Bacteria 1213
320 Ga0105245_10709440 3300009098 Unclassified 1040
321 Ga0105247_10002075 3300009101 Bacteria 13871
322 Ga0105247_10088032 3300009101 Bacteria 1967
323 Ga0105241_10000696 3300009174 Bacteria 25359
324 Ga0105241_10014797 3300009174 Bacteria 5711
325 Ga0105241_10021731 3300009174 Bacteria 4746
326 Ga0105241_10024511 3300009174 Bacteria 4480
327 Ga0105241_10069274 3300009174 Unclassified 2735
328 Ga0105241_10088983 3300009174 Unclassified 2432
329 Ga0105241_10094980 3300009174 Bacteria 2359
330 Ga0105241_10132596 3300009174 Unclassified 2019
331 Ga0105241_10240993 3300009174 Bacteria 1529
332 Ga0105241_10732465 3300009174 Bacteria 905
333 Ga0105241_11225802 3300009174 Bacteria 712
334 Ga0105241_11347186 3300009174 Bacteria 681
335 Ga0105241_11887703 3300009174 Bacteria 585
336 Ga0105242_10119118 3300009176 Unclassified 2262
337 Ga0105242_10164569 3300009176 Bacteria 1945
338 Ga0105248_10028314 3300009177 Bacteria 6242
339 Ga0105248_10088747 3300009177 Bacteria 3480
340 Ga0105248_10141670 3300009177 Bacteria 2712
341 Ga0105248_10151713 3300009177 Bacteria 2614
342 Ga0105248_10171018 3300009177 Bacteria 2449
343 Ga0105248_10282743 3300009177 Unclassified 1868
344 Ga0105248_10465462 3300009177 Bacteria 1425
345 Ga0105237_10045252 3300009545 Bacteria 4429
346 Ga0105237_10292934 3300009545 Bacteria 1630
347 Ga0105237_10368245 3300009545 Bacteria 1442
348 Ga0105237_11401787 3300009545 Bacteria 705
349 Ga0105237_12151759 3300009545 Bacteria 567
350 Ga0105238_10000090 3300009551 Bacteria 102374
351 Ga0105238_10043595 3300009551 Bacteria 4539
352 Ga0105238_10152859 3300009551 Bacteria 2283
353 Ga0105238_10248400 3300009551 Bacteria 1757
354 Ga0105238_10481047 3300009551 Bacteria 1241
355 Ga0105238_10620748 3300009551 Unclassified 1090
356 Ga0105249_10022406 3300009553 Bacteria 5658
357 Ga0105249_10246440 3300009553 Bacteria 1769
358 Ga0105249_11067129 3300009553 Bacteria 877
359 Ga0105239_10014134 3300010375 Bacteria 8859
360 Ga0105239_10069470 3300010375 Bacteria 3870
361 Ga0105239_10250532 3300010375 Bacteria 1989
362 Ga0105239_10380888 3300010375 Bacteria 1595
363 Ga0105239_10449522 3300010375 Unclassified 1462
364 Ga0105239_10789634 3300010375 Unclassified 1088
365 Ga0105239_11008550 3300010375 Bacteria 957
366 Ga0105239_11151922 3300010375 Bacteria 893
367 Ga0105246_10060573 3300011119 Bacteria 2630
368 Ga0105246_10166707 3300011119 Unclassified 1683
369 Ga0157347_1051203 3300012502 Bacteria 570
370 Ga0157373_10001626 3300013100 Bacteria 17148
371 Ga0157373_10038599 3300013100 Bacteria 3423
372 Ga0157373_10072291 3300013100 Bacteria 2435
373 Ga0157373_10166056 3300013100 Unclassified 1553
374 Ga0157371_10008304 3300013102 Bacteria 8291
375 Ga0157371_10034344 3300013102 Bacteria 3638
376 Ga0157371_10052006 3300013102 Bacteria 2910
377 Ga0157371_10458225 3300013102 Bacteria 938
378 Ga0157370_10975379 3300013104 Bacteria 768
379 Ga0157369_10000102 3300013105 Bacteria 118470
380 Ga0157369_10002294 3300013105 Bacteria 23006
381 Ga0157369_10026983 3300013105 Bacteria 6370
382 Ga0157369_10030101 3300013105 Bacteria 5990
383 Ga0157369_10050779 3300013105 Bacteria 4489
384 Ga0157369_10072988 3300013105 Bacteria 3682
385 Ga0157369_10168341 3300013105 Bacteria 2310
386 Ga0157369_10471941 3300013105 Bacteria 1299
387 Ga0157374_10000097 3300013296 Bacteria 81947
388 Ga0157374_10000523 3300013296 Bacteria 34513
389 Ga0157374_10002997 3300013296 Bacteria 14129
390 Ga0157374_10009521 3300013296 Bacteria 8341
391 Ga0157374_10022301 3300013296 Bacteria 5647
392 Ga0157374_10028709 3300013296 Bacteria 5028
393 Ga0157374_10061514 3300013296 Bacteria 3517
394 Ga0157374_10108420 3300013296 Bacteria 2669
395 Ga0157374_10138335 3300013296 Bacteria 2362
396 Ga0157374_10223285 3300013296 Bacteria 1849
397 Ga0157374_10881272 3300013296 Bacteria 912
398 Ga0157378_10000104 3300013297 Bacteria 80068
399 Ga0157378_10000254 3300013297 Bacteria 52323
400 Ga0157378_10085151 3300013297 Bacteria 2863
401 Ga0157378_10140032 3300013297 Bacteria 2246
402 Ga0157378_10141875 3300013297 Bacteria 2231
403 Ga0157378_10164947 3300013297 Bacteria 2075
404 Ga0157378_10639914 3300013297 Bacteria 1078
405 Ga0157378_10866389 3300013297 Bacteria 932
406 Ga0163162_10003507 3300013306 Bacteria 15002
407 Ga0163162_10108201 3300013306 Bacteria 2876
408 Ga0163162_10110634 3300013306 Bacteria 2844
409 Ga0163162_10139619 3300013306 Bacteria 2535
410 Ga0163162_10171028 3300013306 Bacteria 2297
411 Ga0163162_10221238 3300013306 Bacteria 2023
412 Ga0163162_11431639 3300013306 Bacteria 787
413 Ga0157372_10000242 3300013307 Bacteria 60460
414 Ga0157372_10000340 3300013307 Bacteria 51471
415 Ga0157372_10008280 3300013307 Bacteria 11056
416 Ga0157372_10012134 3300013307 Bacteria 9179
417 Ga0157372_10015522 3300013307 Bacteria 8164
418 Ga0157372_10078657 3300013307 Bacteria 3727
419 Ga0157372_10202094 3300013307 Bacteria 2302
420 Ga0157372_10262235 3300013307 Bacteria 2007
421 Ga0157372_10400868 3300013307 Unclassified 1599
422 Ga0157372_11016516 3300013307 Bacteria 960
423 Ga0157375_10178052 3300013308 Bacteria 2277
424 Ga0157375_10203446 3300013308 Bacteria 2136
425 Ga0157375_10454756 3300013308 Bacteria 1446
426 Ga0163163_10032125 3300014325 Bacteria 5071
427 Ga0163163_10304485 3300014325 Bacteria 1646
428 Ga0163163_10331952 3300014325 Bacteria 1575
429 Ga0163163_10363024 3300014325 Bacteria 1505
430 Ga0182008_10079261 3300014497 Bacteria 1616
431 Ga0182008_10088243 3300014497 Bacteria 1528
432 Ga0157377_10005547 3300014745 Bacteria 5939
433 Ga0157377_10335291 3300014745 Bacteria 1010
434 Ga0157376_10003662 3300014969 Bacteria 10609
435 Ga0157376_10007622 3300014969 Bacteria 7748
436 Ga0157376_10014408 3300014969 Bacteria 5935
437 Ga0157376_10146626 3300014969 Bacteria 2124
438 Ga0157376_10881337 3300014969 Unclassified 912
439 Ga0182007_10017327 3300015262 Bacteria 2633
440 Ga0182007_10076532 3300015262 Bacteria 1097
441 Ga0182007_10088192 3300015262 Unclassified 1021
442 Ga0182005_1007383 3300015265 Bacteria 3300
443 Ga0163161_10064628 3300017792 Bacteria 2669
444 Ga0163161_11577292 3300017792 Unclassified 578
445 Ga0213874_10275908 3300021377 Unclassified 626
446 Ga0213876_10114907 3300021384 Bacteria 1429
447 Ga0224572_1000186 3300024225 Bacteria 5809
448 Ga0228598_1000090 3300024227 Bacteria 14640
449 Ga0228598_1068910 3300024227 Unclassified 707
450 Ga0207697_10019277 3300025315 Bacteria 2793
451 Ga0207656_10014169 3300025321 Bacteria 3066
452 Ga0207656_10024376 3300025321 Bacteria 2446
453 Ga0207656_10240241 3300025321 Bacteria 885
454 Ga0207696_1212212 3300025711 Bacteria 507
455 Ga0207692_10021831 3300025898 Bacteria 2935
456 Ga0207692_10046466 3300025898 Bacteria 2176
457 Ga0207692_10689179 3300025898 Bacteria 662
458 Ga0207642_10011782 3300025899 Bacteria 3133
459 Ga0207642_10086783 3300025899 Unclassified 1535
460 Ga0207642_10192485 3300025899 Bacteria 1120
461 Ga0207642_10219546 3300025899 Unclassified 1061
462 Ga0207710_10154456 3300025900 Bacteria 1115
463 Ga0207710_10173559 3300025900 Unclassified 1055
464 Ga0207710_10241997 3300025900 Bacteria 900
465 Ga0207680_10018310 3300025903 Bacteria 3720
466 Ga0207680_10046750 3300025903 Bacteria 2560
467 Ga0207647_10027429 3300025904 Bacteria 3711
468 Ga0207647_10406824 3300025904 Unclassified 766
469 Ga0207685_10003902 3300025905 Bacteria 3701
470 Ga0207685_10007449 3300025905 Bacteria 3050
471 Ga0207685_10204843 3300025905 Bacteria 929
472 Ga0207699_10006444 3300025906 Bacteria 5684
473 Ga0207699_10010824 3300025906 Bacteria 4592
474 Ga0207699_10034611 3300025906 Bacteria 2867
475 Ga0207699_10063951 3300025906 Bacteria 2225
476 Ga0207699_10067716 3300025906 Unclassified 2172
477 Ga0207699_10078221 3300025906 Unclassified 2043
478 Ga0207699_10363617 3300025906 Bacteria 1024
479 Ga0207699_10514133 3300025906 Bacteria 865
480 Ga0207699_10554432 3300025906 Bacteria 834
481 Ga0207645_10001273 3300025907 Bacteria 20747
482 Ga0207645_10057032 3300025907 Bacteria 2493
483 Ga0207645_10156875 3300025907 Bacteria 1487
484 Ga0207643_10001563 3300025908 Bacteria 13019
485 Ga0207705_10338220 3300025909 Bacteria 1158
486 Ga0207684_10000755 3300025910 Bacteria 37749
487 Ga0207684_10011651 3300025910 Bacteria 7676
488 Ga0207684_10190317 3300025910 Bacteria 1770
489 Ga0207684_10982594 3300025910 Bacteria 707
490 Ga0207654_10008632 3300025911 Bacteria 5164
491 Ga0207654_10012565 3300025911 Bacteria 4341
492 Ga0207654_10035509 3300025911 Bacteria 2778
493 Ga0207654_10093317 3300025911 Bacteria 1840
494 Ga0207654_10093869 3300025911 Unclassified 1835
495 Ga0207654_10111827 3300025911 Bacteria 1701
496 Ga0207654_10715876 3300025911 Bacteria 720
497 Ga0207707_10000127 3300025912 Bacteria 78669
498 Ga0207707_10014543 3300025912 Bacteria 6854
499 Ga0207707_10234334 3300025912 Unclassified 1597
500 Ga0207707_10255788 3300025912 Bacteria 1520
501 Ga0207695_10004843 3300025913 Bacteria 18170
502 Ga0207695_10008434 3300025913 Bacteria 12905
503 Ga0207695_10020320 3300025913 Bacteria 7609
504 Ga0207695_10179257 3300025913 Bacteria 2040
505 Ga0207695_10783895 3300025913 Unclassified 833
506 Ga0207671_10100237 3300025914 Bacteria 2193
507 Ga0207671_10467789 3300025914 Unclassified 1005
508 Ga0207671_10511993 3300025914 Bacteria 957
509 Ga0207693_10000329 3300025915 Bacteria 43804
510 Ga0207693_10007832 3300025915 Bacteria 8771
511 Ga0207693_10008241 3300025915 Bacteria 8531
512 Ga0207693_10008458 3300025915 Bacteria 8424
513 Ga0207693_10010390 3300025915 Bacteria 7558
514 Ga0207693_10110685 3300025915 Bacteria 2153
515 Ga0207693_10243405 3300025915 Bacteria 1412
516 Ga0207693_10356101 3300025915 Bacteria 1145
517 Ga0207693_10453370 3300025915 Bacteria 1002
518 Ga0207693_10698593 3300025915 Bacteria 786
519 Ga0207663_10007243 3300025916 Bacteria 5742
520 Ga0207663_10018376 3300025916 Unclassified 3918
521 Ga0207663_10036837 3300025916 Bacteria 2945
522 Ga0207663_10055239 3300025916 Unclassified 2491
523 Ga0207663_10057303 3300025916 Bacteria 2454
524 Ga0207663_10324833 3300025916 Bacteria 1157
525 Ga0207660_10251554 3300025917 Unclassified 1395
526 Ga0207660_10268144 3300025917 Bacteria 1352
527 Ga0207662_10002135 3300025918 Bacteria 9837
528 Ga0207657_10004695 3300025919 Bacteria 14420
529 Ga0207657_10008758 3300025919 Bacteria 10242
530 Ga0207657_10014589 3300025919 Bacteria 7659
531 Ga0207649_10000355 3300025920 Bacteria 34488
532 Ga0207649_10006209 3300025920 Bacteria 6488
533 Ga0207652_10008934 3300025921 Bacteria 8074
534 Ga0207652_10021153 3300025921 Bacteria 5367
535 Ga0207652_11093016 3300025921 Bacteria 698
536 Ga0207646_10000299 3300025922 Bacteria 67366
537 Ga0207646_10073139 3300025922 Unclassified 3062
538 Ga0207646_10076784 3300025922 Bacteria 2985
539 Ga0207646_10834465 3300025922 Bacteria 820
540 Ga0207646_11181368 3300025922 Unclassified 671
541 Ga0207681_10006833 3300025923 Bacteria 6999
542 Ga0207681_10024685 3300025923 Bacteria 3859
543 Ga0207694_10001202 3300025924 Bacteria 22454
544 Ga0207694_10187273 3300025924 Bacteria 1680
545 Ga0207650_10000884 3300025925 Bacteria 22676
546 Ga0207650_10026937 3300025925 Bacteria 4108
547 Ga0207659_10007950 3300025926 Bacteria 6559
548 Ga0207659_10657003 3300025926 Bacteria 896
549 Ga0207687_10003342 3300025927 Bacteria 10839
550 Ga0207687_10020555 3300025927 Bacteria 4380
551 Ga0207687_10362438 3300025927 Bacteria 1183
552 Ga0207687_10577006 3300025927 Bacteria 946
553 Ga0207700_10020153 3300025928 Bacteria 4521
554 Ga0207700_10029544 3300025928 Bacteria 3869
555 Ga0207700_10066071 3300025928 Bacteria 2763
556 Ga0207700_10107614 3300025928 Bacteria 2237
557 Ga0207700_10242096 3300025928 Bacteria 1538
558 Ga0207700_10324875 3300025928 Unclassified 1334
559 Ga0207700_10334361 3300025928 Bacteria 1315
560 Ga0207700_10403198 3300025928 Bacteria 1199
561 Ga0207700_10674793 3300025928 Bacteria 922
562 Ga0207700_10750400 3300025928 Bacteria 872
563 Ga0207700_10845682 3300025928 Bacteria 819
564 Ga0207664_10012448 3300025929 Bacteria 6083
565 Ga0207664_10055818 3300025929 Bacteria 3135
566 Ga0207664_10171335 3300025929 Bacteria 1858
567 Ga0207664_10241493 3300025929 Bacteria 1573
568 Ga0207664_10304645 3300025929 Unclassified 1402
569 Ga0207664_10330206 3300025929 Bacteria 1347
570 Ga0207664_10417527 3300025929 Bacteria 1195
571 Ga0207664_10565044 3300025929 Unclassified 1021
572 Ga0207664_11516953 3300025929 Bacteria 592
573 Ga0207644_10014908 3300025931 Bacteria 5210
574 Ga0207644_10117802 3300025931 Bacteria 2017
575 Ga0207644_10170147 3300025931 Unclassified 1700
576 Ga0207644_10266412 3300025931 Bacteria 1372
577 Ga0207690_10029685 3300025932 Bacteria 3480
578 Ga0207690_10767733 3300025932 Bacteria 795
579 Ga0207706_10001115 3300025933 Bacteria 27316
580 Ga0207706_10001302 3300025933 Bacteria 25124
581 Ga0207706_10200076 3300025933 Bacteria 1752
582 Ga0207706_10344227 3300025933 Bacteria 1297
583 Ga0207686_10285370 3300025934 Bacteria 1220
584 Ga0207709_10608613 3300025935 Bacteria 866
585 Ga0207670_10015041 3300025936 Bacteria 4612
586 Ga0207669_10757492 3300025937 Unclassified 802
587 Ga0207704_10008160 3300025938 Unclassified 4988
588 Ga0207704_10019382 3300025938 Bacteria 3571
589 Ga0207704_10092443 3300025938 Bacteria 1991
590 Ga0207665_10000707 3300025939 Bacteria 22630
591 Ga0207665_10008074 3300025939 Bacteria 6946
592 Ga0207665_10018674 3300025939 Bacteria 4555
593 Ga0207665_10064875 3300025939 Bacteria 2482
594 Ga0207665_10102776 3300025939 Bacteria 1998
595 Ga0207665_10172450 3300025939 Bacteria 1563
596 Ga0207665_10354008 3300025939 Bacteria 1109
597 Ga0207665_11110619 3300025939 Bacteria 630
598 Ga0207691_10099391 3300025940 Bacteria 2598
599 Ga0207711_10003254 3300025941 Bacteria 14153
600 Ga0207711_10018478 3300025941 Bacteria 5796
601 Ga0207711_10133830 3300025941 Bacteria 2225
602 Ga0207711_10191300 3300025941 Unclassified 1865
603 Ga0207711_10217020 3300025941 Bacteria 1748
604 Ga0207711_10368086 3300025941 Bacteria 1333
605 Ga0207711_11096173 3300025941 Unclassified 737
606 Ga0207689_10015489 3300025942 Bacteria 6457
607 Ga0207689_10077709 3300025942 Bacteria 2728
608 Ga0207689_10098843 3300025942 Bacteria 2397
609 Ga0207661_10001953 3300025944 Bacteria 14176
610 Ga0207661_10030678 3300025944 Unclassified 4144
611 Ga0207661_10073165 3300025944 Bacteria 2806
612 Ga0207679_10000065 3300025945 Bacteria 97825
613 Ga0207679_10558254 3300025945 Bacteria 1028
614 Ga0207667_10000606 3300025949 Bacteria 46386
615 Ga0207667_10002559 3300025949 Bacteria 22617
616 Ga0207667_10012218 3300025949 Bacteria 9918
617 Ga0207667_10053472 3300025949 Bacteria 4249
618 Ga0207667_10206713 3300025949 Bacteria 2013
619 Ga0207667_10275618 3300025949 Unclassified 1719
620 Ga0207667_10492413 3300025949 Bacteria 1244
621 Ga0207651_10003090 3300025960 Bacteria 8090
622 Ga0207712_10088521 3300025961 Bacteria 2274
623 Ga0207712_10144035 3300025961 Bacteria 1832
624 Ga0207712_10894086 3300025961 Bacteria 784
625 Ga0207668_10007280 3300025972 Bacteria 6570
626 Ga0207668_10134677 3300025972 Bacteria 1891
627 Ga0207668_10238032 3300025972 Bacteria 1471
628 Ga0207640_10004325 3300025981 Bacteria 7690
629 Ga0207640_10041651 3300025981 Bacteria 2922
630 Ga0207640_10060488 3300025981 Unclassified 2504
631 Ga0207640_10221101 3300025981 Bacteria 1450
632 Ga0207640_10248384 3300025981 Bacteria 1379
633 Ga0207658_10033650 3300025986 Bacteria 3657
634 Ga0207658_10151789 3300025986 Bacteria 1888
635 Ga0207677_10028419 3300026023 Unclassified 3536
636 Ga0207677_10047248 3300026023 Bacteria 2889
637 Ga0207677_10065902 3300026023 Bacteria 2529
638 Ga0207677_10117047 3300026023 Bacteria 1997
639 Ga0207677_10131830 3300026023 Bacteria 1899
640 Ga0207677_10244747 3300026023 Bacteria 1453
641 Ga0207677_10329154 3300026023 Unclassified 1272
642 Ga0207703_10005430 3300026035 Bacteria 10256
643 Ga0207703_10015693 3300026035 Bacteria 5908
644 Ga0207703_10035952 3300026035 Bacteria 3939
645 Ga0207703_10096687 3300026035 Bacteria 2494
646 Ga0207639_10007870 3300026041 Bacteria 7279
647 Ga0207639_10060078 3300026041 Bacteria 2932
648 Ga0207639_10739085 3300026041 Bacteria 914
649 Ga0207678_10021841 3300026067 Bacteria 5613
650 Ga0207678_10033561 3300026067 Bacteria 4470
651 Ga0207678_10840111 3300026067 Unclassified 811
652 Ga0207708_10371539 3300026075 Unclassified 1177
653 Ga0207702_10000704 3300026078 Bacteria 35989
654 Ga0207702_10003921 3300026078 Bacteria 13401
655 Ga0207702_10007831 3300026078 Bacteria 9062
656 Ga0207702_10013102 3300026078 Bacteria 6893
657 Ga0207702_10026616 3300026078 Bacteria 4802
658 Ga0207702_10078542 3300026078 Unclassified 2858
659 Ga0207702_10083397 3300026078 Bacteria 2781
660 Ga0207641_10001498 3300026088 Bacteria 22856
661 Ga0207641_10030801 3300026088 Bacteria 4446
662 Ga0207641_10277459 3300026088 Bacteria 1575
663 Ga0207648_10001532 3300026089 Bacteria 25442
664 Ga0207648_10016963 3300026089 Bacteria 6636
665 Ga0207648_10024585 3300026089 Bacteria 5375
666 Ga0207648_10746085 3300026089 Bacteria 909
667 Ga0207676_10011902 3300026095 Bacteria 6225
668 Ga0207676_10016818 3300026095 Bacteria 5295
669 Ga0207676_10018366 3300026095 Bacteria 5082
670 Ga0207674_10000404 3300026116 Bacteria 56025
671 Ga0207674_10006025 3300026116 Bacteria 14339
672 Ga0207674_10082427 3300026116 Bacteria 3217
673 Ga0207674_10136552 3300026116 Bacteria 2414
674 Ga0207674_11125822 3300026116 Bacteria 754
675 Ga0207675_100048098 3300026118 Bacteria 3981
676 Ga0207675_100069688 3300026118 Bacteria 3287
677 Ga0207675_100338499 3300026118 Bacteria 1472
678 Ga0207675_100809031 3300026118 Bacteria 951
679 Ga0207683_10073373 3300026121 Bacteria 3027
680 Ga0207683_10123499 3300026121 Bacteria 2326
681 Ga0207683_10148997 3300026121 Bacteria 2111
682 Ga0207683_11429344 3300026121 Bacteria 639
683 Ga0207698_10050885 3300026142 Bacteria 3164
684 Ga0207698_10434886 3300026142 Bacteria 1263
685 Ga0265354_1004614 3300028016 Bacteria 1436
686 Ga0265355_1013096 3300028036 Bacteria 691
687 Ga0268266_10021034 3300028379 Bacteria 5561
688 Ga0268266_10146360 3300028379 Bacteria 2124
689 Ga0268266_10402387 3300028379 Bacteria 1294
690 Ga0268265_10016219 3300028380 Bacteria 5113
691 Ga0268265_10031616 3300028380 Bacteria 3824
692 Ga0268264_10032041 3300028381 Bacteria 4313
693 Ga0268264_10068115 3300028381 Bacteria 3006
694 Ga0268264_10294989 3300028381 Bacteria 1524
695 Ga0268264_10763349 3300028381 Bacteria 964
696 Ga0265338_10268769 3300028800 Bacteria 1250
697 Ga0265760_10011095 3300031090 Bacteria 2574
698 Ga0373930_0020536 3300034816 Unclassified 1288
699 Ga0373938_0087512 3300034957 Unclassified 767
700 Ga0373940_0040177 3300035088 Bacteria 1283
701 Ga0373944_0044857 3300035089 Unclassified 1378
702 Ga0373949_0105638 3300035090 Bacteria 776
703 Ga0373923_0032542 3300035111 Bacteria 2107
704 Ga0373932_0035194 3300035112 Bacteria 1415
705 Ga0373932_0057097 3300035112 Bacteria 1176
706 Ga0373932_0165912 3300035112 Bacteria 767
707 Ga0373936_0020957 3300035113 Bacteria 2541
708 Ga0373939_0254712 3300035114 Bacteria 684
709 Ga0373939_0256837 3300035114 Bacteria 682
710 Ga0373941_0423610 3300035115 Bacteria 554
711 Ga0373945_0018163 3300035116 Bacteria 2391
712 Ga0373960_0238975 3300035121 Unclassified 656
713 Ga0373943_0019696 3300035170 Bacteria 3105
714 Ga0373943_0132951 3300035170 Bacteria 1333
715 Ga0373943_0194506 3300035170 Unclassified 1120
716 Ga0373943_0258972 3300035170 Bacteria 979
717 Ga0373946_0076381 3300035171 Unclassified 1458
718 Ga0373942_0022184 3300035207 Bacteria 1609
719 Ga0373931_0005211 3300035691 Bacteria 5996
720 Ga0373931_0021254 3300035691 Bacteria 3255
721 Ga0373931_0031443 3300035691 Bacteria 2740
722 Ga0373935_0002781 3300035692 Bacteria 10061
723 Ga0373935_0223361 3300035692 Bacteria 1309
724 Ga0373927_0022380 3300035695 Bacteria 4141
725 Ga0373927_0048315 3300035695 Bacteria 2752
726 Ga0373927_0356662 3300035695 Bacteria 964
727 Ga0373947_0014842 3300035725 Bacteria 4470
728 Ga0373947_0119208 3300035725 Bacteria 1675
729 Ga0373937_0056334 3300036401 Bacteria 3610
730 Ga0373937_0258006 3300036401 Bacteria 1644
731 Ga0373925_0008134 3300037068 Bacteria 7636
732 Ga0373925_0008971 3300037068 Bacteria 7288
733 Ga0373925_0082985 3300037068 Bacteria 2440
734 Ga0373925_0188589 3300037068 Unclassified 1635
735 Ga0373925_0215708 3300037068 Bacteria 1530
736 Ga0436365_0755887 3300039437 Bacteria 2055
737 Ga0436360_1208113 3300039438 Unclassified 527
738 Ga0436363_0890929 3300039450 Bacteria 2905
739 Ga0436363_1045307 3300039450 Bacteria 5767
740 Ga0436362_0123581 3300039453 Bacteria 1424
741 Ga0436362_0841557 3300039453 Unclassified 1173
742 Ga0436362_1176072 3300039453 Bacteria 673
743 Ga0451577_0305742 3300042876 Bacteria 1441
744 Ga0451577_0683934 3300042876 Bacteria 930
745 Ga0453683_0993320 3300044673 Bacteria 557
746 Ga0466961_0097945 3300044693 Bacteria 1849
747 Ga0466963_0134604 3300044694 Bacteria 1709
748 Ga0466964_0187057 3300044706 Bacteria 986
749 Ga0453684_0339485 3300044712 Bacteria 1697
750 Ga0466968_0721900 3300044735 Unclassified 510
751 Ga0466957_0657204 3300044842 Bacteria 737
752 Ga0466959_0249029 3300045049 Bacteria 1226
753 Ga0466959_0586505 3300045049 Unclassified 750
754 Ga0451576_0094988 3300045051 Unclassified 3101
755 Ga0451576_0257072 3300045051 Bacteria 1825
756 Ga0466958_0208050 3300045836 Unclassified 1246
757 Ga0466958_0298762 3300045836 Bacteria 1034
758 Ga0466967_0009278 3300045976 Bacteria 7290
759 Ga0466967_0198602 3300045976 Bacteria 1899
760 Ga0466967_0826455 3300045976 Bacteria 920
761 Ga0495580_0000461 3300046472 Bacteria 33757
762 Ga0495580_0001484 3300046472 Bacteria 20584
763 Ga0495580_0001584 3300046472 Bacteria 19969
764 Ga0495580_0010637 3300046472 Bacteria 7149
765 Ga0495580_0012540 3300046472 Bacteria 6498
766 Ga0495580_0021329 3300046472 Bacteria 4780
767 Ga0495580_0050637 3300046472 Bacteria 2936
768 Ga0495580_0074749 3300046472 Bacteria 2365
769 Ga0495580_0231571 3300046472 Bacteria 1268
770 Ga0495580_0475767 3300046472 Bacteria 836
771 Ga0495582_0001798 3300046473 Bacteria 12116
772 Ga0495639_0203197 3300046475 Bacteria 970
773 Ga0495594_0043135 3300046499 Bacteria 2472
774 Ga0495663_0367817 3300046525 Bacteria 526
775 Ga0495666_0053972 3300046526 Unclassified 1928
776 Ga0495665_0003996 3300046531 Bacteria 7951
777 Ga0495665_0012360 3300046531 Bacteria 4618
778 Ga0495665_0183990 3300046531 Bacteria 1085
779 Ga0495586_0222528 3300046535 Bacteria 1073
780 Ga0495634_0228061 3300046642 Bacteria 1147
781 Ga0495635_0520083 3300046663 Bacteria 782
782 Ga0495658_0057523 3300046683 Bacteria 2221
783 Ga0495669_0030202 3300046684 Bacteria 2379
784 Ga0495624_0112562 3300046690 Bacteria 1673
785 Ga0495624_0281949 3300046690 Bacteria 1003
786 Ga0495581_0007643 3300047315 Bacteria 6255
787 Ga0495674_0252633 3300047319 Bacteria 1450
788 Ga0495674_0554662 3300047319 Bacteria 914
789 Ga0495684_0203577 3300047471 Bacteria 1458
790 Ga0495593_0185865 3300047673 Bacteria 1046
791 Ga0496100_0512380 3300048903 Unclassified 925
792 Ga0496100_1302086 3300048903 Unclassified 573
793 Ga0496101_0054464 3300048904 Bacteria 2888
794 Ga0496102_0001755 3300048905 Bacteria 18917
795 Ga0496102_0022938 3300048905 Bacteria 5537
796 Ga0496102_0037275 3300048905 Bacteria 4385
797 Ga0496102_0119194 3300048905 Bacteria 2464
798 Ga0496102_0294518 3300048905 Bacteria 1529
799 Ga0496102_0430774 3300048905 Bacteria 1238
800 Ga0496102_0823855 3300048905 Bacteria 850
801 Ga0496103_0012744 3300048906 Bacteria 4987
802 Ga0496103_0036618 3300048906 Bacteria 3005
803 Ga0496103_0144491 3300048906 Bacteria 1522
804 Ga0496104_0025254 3300048907 Bacteria 5477
805 Ga0496104_0032040 3300048907 Bacteria 4892
806 Ga0496104_0106257 3300048907 Bacteria 2690
807 Ga0496105_0191134 3300048908 Bacteria 1674
808 Ga0496105_0250442 3300048908 Bacteria 1435
809 Ga0496105_0433101 3300048908 Bacteria 1040
810 Ga0496105_0540549 3300048908 Unclassified 911
811 Ga0496106_0187133 3300048909 Bacteria 1645
812 Ga0496106_0207598 3300048909 Bacteria 1560
813 Ga0496106_0580463 3300048909 Unclassified 898
814 Ga0496107_0202953 3300048910 Bacteria 1474
815 Ga0496107_0248065 3300048910 Unclassified 1325
816 Ga0496107_0320407 3300048910 Bacteria 1154
817 Ga0496108_0000263 3300048911 Bacteria 45358
818 Ga0496108_0107129 3300048911 Bacteria 2387
819 Ga0496108_0802405 3300048911 Bacteria 812
820 Ga0496109_0000336 3300048912 Bacteria 43748
821 Ga0496109_0279334 3300048912 Unclassified 1574
822 Ga0496109_0491401 3300048912 Bacteria 1158
823 Ga0496109_1130891 3300048912 Bacteria 720
824 Ga0496110_0000474 3300048913 Bacteria 27301
825 Ga0496110_0396420 3300048913 Bacteria 1258
826 Ga0496111_0056663 3300048914 Bacteria 2836
827 Ga0496111_0899920 3300048914 Bacteria 637
828 Ga0496112_0000176 3300048915 Bacteria 40747
829 Ga0496112_0051864 3300048915 Bacteria 4024
830 Ga0496112_0125755 3300048915 Bacteria 2535
831 Ga0496112_0181363 3300048915 Bacteria 2069
832 Ga0496112_0319655 3300048915 Bacteria 1496
833 Ga0496112_0357613 3300048915 Bacteria 1402
834 Ga0496112_0645771 3300048915 Bacteria 988
835 Ga0496112_0793595 3300048915 Bacteria 872
836 Ga0496113_0002059 3300048916 Bacteria 11556
837 Ga0496113_0127011 3300048916 Bacteria 1998
838 Ga0496113_0582446 3300048916 Bacteria 896
839 Ga0496114_0514800 3300048917 Bacteria 1058
840 Ga0496114_0527210 3300048917 Bacteria 1044
841 Ga0496114_1672011 3300048917 Unclassified 525
842 Ga0496115_0042810 3300048918 Bacteria 3609
843 Ga0496115_0067699 3300048918 Bacteria 2889
844 Ga0496115_0124421 3300048918 Bacteria 2124
845 Ga0496115_0314393 3300048918 Bacteria 1282
846 Ga0501067_0112909 3300049583 Bacteria 1511
847 Ga0501070_0080886 3300049586 Bacteria 2688
848 Ga0501080_0556574 3300049742 Bacteria 1021
849 Ga0501083_0165272 3300049744 Unclassified 1447
850 nmdc:mga0n895_191485_c1 3300050512 Bacteria 2076
851 nmdc:mga0n895_303945_c1 3300050512 Unclassified 1617
852 nmdc:mga0n895_328480_c1 3300050512 Bacteria 1550
853 nmdc:mga0rr50_15735_c1 3300050513 Bacteria 5001
854 nmdc:mga0rr50_88956_c1 3300050513 Bacteria 2400
855 nmdc:mga08x19_1019001_c1 3300050514 Bacteria 588
856 nmdc:mga08x19_28678_c1 3300050514 Bacteria 3488
857 nmdc:mga08x19_348049_c1 3300050514 Unclassified 1034
858 nmdc:mga08x19_4356_c1 3300050514 Bacteria 8393
859 nmdc:mga08x19_60075_c1 3300050514 Bacteria 2462
860 nmdc:mga08x19_678_c1 3300050514 Bacteria 21836
861 nmdc:mga0a205_740300_c1 3300050515 Unclassified 832
862 Ga0495601_0088453 3300053077 Bacteria 1992
863 Ga0495612_0035581 3300053078 Unclassified 2019
864 Ga0495619_0665059 3300053085 Unclassified 710
865 Ga0500590_057461 3300053148 Unclassified 1963
866 Ga0501084_1179463 3300054114 Unclassified 642
867 Ga0501082_0264231 3300060353 Unclassified 1497
868 Ga0466962_0303385 3300061719 Bacteria 790
869 Ga0070711_100136020
870 JGI24751J29686_10077680
871 Ga0070658_10183734
872 Ga0070658_10473684
873 Ga0070676_10120072
874 Ga0070676_10150941
875 Ga0070683_100006636
876 Ga0070683_100022644
877 Ga0070683_100053077
878 Ga0070683_100058646
879 Ga0070690_100109213
880 Ga0070670_100038874
881 Ga0070670_100042905
882 Ga0070670_100553343
883 Ga0070677_10076385
884 Ga0070677_10197709
885 Ga0068869_100079150
886 Ga0068869_100103590
887 Ga0068869_100165271
888 Ga0068869_100270524
889 Ga0070666_10074121
890 Ga0070666_10191695
891 Ga0070666_10223830
892 Ga0070680_100195736
893 Ga0070680_100221167
894 Ga0070682_100010473
895 Ga0068868_100012625
896 Ga0068868_100078186
897 Ga0068868_100138891
898 Ga0068868_100384827
899 Ga0070660_100026704
900 Ga0070660_100027002
901 Ga0070689_100005074
902 Ga0070689_100160663
903 Ga0070691_10202934
904 Ga0070687_100007802
905 Ga0070661_100003462
906 Ga0070661_100010336
907 Ga0070661_100412474
908 Ga0070661_100423754
909 Ga0070668_100015936
910 Ga0070668_100062131
911 Ga0070668_100496214
912 Ga0070669_100047361
913 Ga0070669_100285297
914 Ga0070675_100007668
915 Ga0070675_100148455
916 Ga0070671_100062888
917 Ga0070671_100091166
918 Ga0070671_100183036
919 Ga0070671_100477738
920 Ga0070674_100716487
921 Ga0070674_100870868
922 Ga0070673_100009261
923 Ga0070673_101300112
924 Ga0070688_100016279
925 Ga0070688_100626148
926 Ga0070659_100132556
927 Ga0070659_100369452
928 Ga0070659_100738416
929 Ga0070667_100098177
930 Ga0070667_100114229
931 Ga0070667_100238981
932 Ga0070709_10004498
933 Ga0070709_10005976
934 Ga0070709_10007306
935 Ga0070709_10023147
936 Ga0070709_10465670
937 Ga0070714_100001723
938 Ga0070714_100132644
939 Ga0070714_100184613
940 Ga0070714_100185920
941 Ga0070714_100196833
942 Ga0070714_100456735
943 Ga0070714_100462952
944 Ga0070714_100884008
945 Ga0070714_101391905
946 Ga0070713_100008149
947 Ga0070713_100019702
948 Ga0070713_100041872
949 Ga0070713_100078087
950 Ga0070713_100136459
951 Ga0070713_100222094
952 Ga0070713_100322670
953 Ga0070713_100850179
954 Ga0070713_100974931
955 Ga0070710_10011514
956 Ga0070710_10014736
957 Ga0070710_10057296
958 Ga0070710_10151247
959 Ga0070710_10604282
960 Ga0070711_100006475
961 Ga0070711_100060506
962 Ga0070711_100143547
963 Ga0070711_100327222
964 Ga0070711_100463904
965 Ga0070711_101538795
966 Ga0070694_100129345
967 Ga0070694_100302295
968 Ga0070708_100006976
969 Ga0070708_100107434
970 Ga0070708_100204161
971 Ga0070663_100012400
972 Ga0070663_100042296
973 Ga0070663_100156493
974 Ga0070678_100012210
975 Ga0070678_100043842
976 Ga0070678_100135024
977 Ga0070662_100015996
978 Ga0070662_100171614
979 Ga0070662_100388605
980 Ga0070681_10000091
981 Ga0070681_10004214
982 Ga0070681_10072143
983 Ga0070681_10252259
984 Ga0070681_10500111
985 Ga0068867_100009336
986 Ga0068867_100028544
987 Ga0068867_101358641
988 Ga0070685_10006781
989 Ga0070706_100000723
990 Ga0070706_100001205
991 Ga0070706_100935337
992 Ga0070707_100001499
993 Ga0070707_100289777
994 Ga0070707_100293207
995 Ga0070707_101340160
996 Ga0070698_100000131
997 Ga0070699_100004921
998 Ga0070699_100007791
999 Ga0070699_100444565
1000 Ga0070699_100823529
1001 Ga0070679_100103519
1002 Ga0070679_100359089
1003 Ga0070679_100900282
1004 Ga0070684_100014426
1005 Ga0070684_100024985
1006 Ga0070684_100085898
1007 Ga0070684_100305737
1008 Ga0070697_100000553
1009 Ga0070697_100000581
1010 Ga0070697_100006547
1011 Ga0070697_100014030
1012 Ga0070697_100114162
1013 Ga0070697_100891589
1014 Ga0068853_100011303
1015 Ga0068853_100015687
1016 Ga0068853_100052920
1017 Ga0068853_100303119
1018 Ga0068853_100600122
1019 Ga0070672_100035545
1020 Ga0070686_100266454
1021 Ga0070686_101643056
1022 Ga0070695_100010945
1023 Ga0070696_100053833
1024 Ga0070693_100219153
1025 Ga0070693_100223443
1026 Ga0070693_100242393
1027 Ga0070693_100263181
1028 Ga0070665_100042318
1029 Ga0070665_100165128
1030 Ga0068855_100001406
1031 Ga0068855_100001496
1032 Ga0068855_100015256
1033 Ga0068855_100152192
1034 Ga0068855_100179221
1035 Ga0068855_100244722
1036 Ga0068855_100345247
1037 Ga0068855_100521743
1038 Ga0070664_100008528
1039 Ga0070664_100023244
1040 Ga0070664_100454936
1041 Ga0070664_100459794
1042 Ga0070664_100664886
1043 Ga0068857_100001930
1044 Ga0068857_100009751
1045 Ga0068857_100476265
1046 Ga0068857_101198993
1047 Ga0068857_101392871
1048 Ga0068854_100001611
1049 Ga0068854_100057385
1050 Ga0068854_100068067
1051 Ga0068856_100000685
1052 Ga0068856_100001014
1053 Ga0068856_100003158
1054 Ga0068856_100025481
1055 Ga0068856_100026883
1056 Ga0068856_100031867
1057 Ga0068856_100123663
1058 Ga0068856_100595613
1059 Ga0068856_100985816
1060 Ga0070702_100094074
1061 Ga0070702_100270121
1062 Ga0068852_100015747
1063 Ga0068852_100033657
1064 Ga0068852_100060954
1065 Ga0068852_100116257
1066 Ga0068852_100620395
1067 Ga0068852_101022707
1068 Ga0068859_100001599
1069 Ga0068859_100017494
1070 Ga0068859_100195419
1071 Ga0068859_100801232
1072 Ga0068859_101782537
1073 Ga0068864_100002783
1074 Ga0068864_100024773
1075 Ga0068864_100085958
1076 Ga0068864_100268678
1077 Ga0068866_10002099
1078 Ga0068866_10002683
1079 Ga0068866_10007219
1080 Ga0068866_10127722
1081 Ga0068861_100064364
1082 Ga0068861_100180909
1083 Ga0068861_100645400
1084 Ga0068851_10013182
1085 Ga0068851_10025116
1086 Ga0068851_10045721
1087 Ga0068851_10332927
1088 Ga0068870_10035040
1089 Ga0068870_11459381
1090 Ga0068863_100029982
1091 Ga0068863_100048280
1092 Ga0068863_100065479
1093 Ga0068863_100097671
1094 Ga0068863_100142534
1095 Ga0068863_100343740
1096 Ga0068863_100372516
1097 Ga0068858_100006528
1098 Ga0068858_100008868
1099 Ga0068858_100122287
1100 Ga0068858_100149905
1101 Ga0068858_100264867
1102 Ga0068860_100015978
1103 Ga0068860_100021939
1104 Ga0068860_100068285
1105 Ga0068860_100139848
1106 Ga0068860_100391797
1107 Ga0068862_100017271
1108 Ga0068862_100065048
1109 Ga0081540_1094157
1110 Ga0070717_10001834
1111 Ga0070717_10012640
1112 Ga0070717_10021004
1113 Ga0070717_10025062
1114 Ga0070717_10279754
1115 Ga0070717_10386864
1116 Ga0070717_10414846
1117 Ga0070717_10415275
1118 Ga0070717_10574097
1119 Ga0070715_10000310
1120 Ga0070715_10697538
1121 Ga0070716_100000485
1122 Ga0070716_100003566
1123 Ga0070716_100076857
1124 Ga0070716_100111070
1125 Ga0070716_100211706
1126 Ga0070716_100454173
1127 Ga0070716_100467272
1128 Ga0070712_100000813
1129 Ga0070712_100005656
1130 Ga0070712_100009221
1131 Ga0070712_100013811
1132 Ga0070712_100171528
1133 Ga0070712_100548448
1134 Ga0070712_100752713
1135 Ga0070712_101109067
1136 Ga0070712_101516390
1137 Ga0097621_100001438
1138 Ga0097621_100001799
1139 Ga0097621_100054871
1140 Ga0097621_100097084
1141 Ga0097621_100105478
1142 Ga0068871_100000261
1143 Ga0068871_100000279
1144 Ga0068871_100032097
1145 Ga0068871_100061315
1146 Ga0068871_100069562
1147 Ga0068871_100082262
1148 Ga0068871_100121662
1149 Ga0068871_100295252
1150 Ga0068871_100328505
1151 Ga0068871_100940713
1152 Ga0075433_10783870
1153 Ga0075434_100343288
1154 Ga0068865_100008272
1155 Ga0068865_100014844
1156 Ga0068865_100205945
1157 Ga0075436_100005852
1158 Ga0075436_100006248
1159 Ga0075436_100012348
1160 Ga0075436_100050826
1161 Ga0075436_100059202
1162 Ga0075436_100191019
1163 Ga0075436_100288319
1164 Ga0075436_100365063
1165 Ga0097620_100001599
1166 Ga0097620_100017494
1167 Ga0097620_100195414
1168 Ga0097620_100801291
1169 Ga0097620_101782702
1170 Ga0075435_100022143
1171 Ga0075435_100050257
1172 Ga0075435_100357212
1173 Ga0075435_100417610
1174 Ga0075435_100924603
1175 Ga0105250_10176313
1176 Ga0105240_10006436
1177 Ga0105240_10009266
1178 Ga0105240_10059992
1179 Ga0105240_10210837
1180 Ga0105240_10394481
1181 Ga0105240_10558245
1182 Ga0105240_11764307
1183 Ga0105245_10036243
1184 Ga0105245_10152812
1185 Ga0105245_10319440
1186 Ga0105245_10501057
1187 Ga0105245_10516017
1188 Ga0105245_10709440
1189 Ga0105247_10002075
1190 Ga0105247_10088032
1191 Ga0105241_10000696
1192 Ga0105241_10014797
1193 Ga0105241_10021731
1194 Ga0105241_10024511
1195 Ga0105241_10069274
1196 Ga0105241_10088983
1197 Ga0105241_10094980
1198 Ga0105241_10132596
1199 Ga0105241_10240993
1200 Ga0105241_10732465
1201 Ga0105241_11225802
1202 Ga0105241_11347186
1203 Ga0105241_11887703
1204 Ga0105242_10119118
1205 Ga0105242_10164569
1206 Ga0105248_10028314
1207 Ga0105248_10088747
1208 Ga0105248_10141670
1209 Ga0105248_10151713
1210 Ga0105248_10171018
1211 Ga0105248_10282743
1212 Ga0105248_10465462
1213 Ga0105237_10045252
1214 Ga0105237_10292934
1215 Ga0105237_10368245
1216 Ga0105237_11401787
1217 Ga0105237_12151759
1218 Ga0105238_10000090
1219 Ga0105238_10043595
1220 Ga0105238_10152859
1221 Ga0105238_10248400
1222 Ga0105238_10481047
1223 Ga0105238_10620748
1224 Ga0105249_10022406
1225 Ga0105249_10246440
1226 Ga0105249_11067129
1227 Ga0105239_10014134
1228 Ga0105239_10069470
1229 Ga0105239_10250532
1230 Ga0105239_10380888
1231 Ga0105239_10449522
1232 Ga0105239_10789634
1233 Ga0105239_11008550
1234 Ga0105239_11151922
1235 Ga0105246_10060573
1236 Ga0105246_10166707
1237 Ga0157347_1051203
1238 Ga0157373_10001626
1239 Ga0157373_10038599
1240 Ga0157373_10072291
1241 Ga0157373_10166056
1242 Ga0157371_10008304
1243 Ga0157371_10034344
1244 Ga0157371_10052006
1245 Ga0157371_10458225
1246 Ga0157370_10975379
1247 Ga0157369_10000102
1248 Ga0157369_10002294
1249 Ga0157369_10026983
1250 Ga0157369_10030101
1251 Ga0157369_10050779
1252 Ga0157369_10072988
1253 Ga0157369_10168341
1254 Ga0157369_10471941
1255 Ga0157374_10000097
1256 Ga0157374_10000523
1257 Ga0157374_10002997
1258 Ga0157374_10009521
1259 Ga0157374_10022301
1260 Ga0157374_10028709
1261 Ga0157374_10061514
1262 Ga0157374_10108420
1263 Ga0157374_10138335
1264 Ga0157374_10223285
1265 Ga0157374_10881272
1266 Ga0157378_10000104
1267 Ga0157378_10000254
1268 Ga0157378_10085151
1269 Ga0157378_10140032
1270 Ga0157378_10141875
1271 Ga0157378_10164947
1272 Ga0157378_10639914
1273 Ga0157378_10866389
1274 Ga0163162_10003507
1275 Ga0163162_10108201
1276 Ga0163162_10110634
1277 Ga0163162_10139619
1278 Ga0163162_10171028
1279 Ga0163162_10221238
1280 Ga0163162_11431639
1281 Ga0157372_10000242
1282 Ga0157372_10000340
1283 Ga0157372_10008280
1284 Ga0157372_10012134
1285 Ga0157372_10015522
1286 Ga0157372_10078657
1287 Ga0157372_10202094
1288 Ga0157372_10262235
1289 Ga0157372_10400868
1290 Ga0157372_11016516
1291 Ga0157375_10178052
1292 Ga0157375_10203446
1293 Ga0157375_10454756
1294 Ga0163163_10032125
1295 Ga0163163_10304485
1296 Ga0163163_10331952
1297 Ga0163163_10363024
1298 Ga0182008_10079261
1299 Ga0182008_10088243
1300 Ga0157377_10005547
1301 Ga0157377_10335291
1302 Ga0157376_10003662
1303 Ga0157376_10007622
1304 Ga0157376_10014408
1305 Ga0157376_10146626
1306 Ga0157376_10881337
1307 Ga0182007_10017327
1308 Ga0182007_10076532
1309 Ga0182007_10088192
1310 Ga0182005_1007383
1311 Ga0163161_10064628
1312 Ga0163161_11577292
1313 Ga0213874_10275908
1314 Ga0213876_10114907
1315 Ga0224572_1000186
1316 Ga0228598_1000090
1317 Ga0228598_1068910
1318 Ga0207697_10019277
1319 Ga0207656_10014169
1320 Ga0207656_10024376
1321 Ga0207656_10240241
1322 Ga0207696_1212212
1323 Ga0207692_10021831
1324 Ga0207692_10046466
1325 Ga0207692_10689179
1326 Ga0207642_10011782
1327 Ga0207642_10086783
1328 Ga0207642_10192485
1329 Ga0207642_10219546
1330 Ga0207710_10154456
1331 Ga0207710_10173559
1332 Ga0207710_10241997
1333 Ga0207680_10018310
1334 Ga0207680_10046750
1335 Ga0207647_10027429
1336 Ga0207647_10406824
1337 Ga0207685_10003902
1338 Ga0207685_10007449
1339 Ga0207685_10204843
1340 Ga0207699_10006444
1341 Ga0207699_10010824
1342 Ga0207699_10034611
1343 Ga0207699_10063951
1344 Ga0207699_10067716
1345 Ga0207699_10078221
1346 Ga0207699_10363617
1347 Ga0207699_10514133
1348 Ga0207699_10554432
1349 Ga0207645_10001273
1350 Ga0207645_10057032
1351 Ga0207645_10156875
1352 Ga0207643_10001563
1353 Ga0207705_10338220
1354 Ga0207684_10000755
1355 Ga0207684_10011651
1356 Ga0207684_10190317
1357 Ga0207684_10982594
1358 Ga0207654_10008632
1359 Ga0207654_10012565
1360 Ga0207654_10035509
1361 Ga0207654_10093317
1362 Ga0207654_10093869
1363 Ga0207654_10111827
1364 Ga0207654_10715876
1365 Ga0207707_10000127
1366 Ga0207707_10014543
1367 Ga0207707_10234334
1368 Ga0207707_10255788
1369 Ga0207695_10004843
1370 Ga0207695_10008434
1371 Ga0207695_10020320
1372 Ga0207695_10179257
1373 Ga0207695_10783895
1374 Ga0207671_10100237
1375 Ga0207671_10467789
1376 Ga0207671_10511993
1377 Ga0207693_10000329
1378 Ga0207693_10007832
1379 Ga0207693_10008241
1380 Ga0207693_10008458
1381 Ga0207693_10010390
1382 Ga0207693_10110685
1383 Ga0207693_10243405
1384 Ga0207693_10356101
1385 Ga0207693_10453370
1386 Ga0207693_10698593
1387 Ga0207663_10007243
1388 Ga0207663_10018376
1389 Ga0207663_10036837
1390 Ga0207663_10055239
1391 Ga0207663_10057303
1392 Ga0207663_10324833
1393 Ga0207660_10251554
1394 Ga0207660_10268144
1395 Ga0207662_10002135
1396 Ga0207657_10004695
1397 Ga0207657_10008758
1398 Ga0207657_10014589
1399 Ga0207649_10000355
1400 Ga0207649_10006209
1401 Ga0207652_10008934
1402 Ga0207652_10021153
1403 Ga0207652_11093016
1404 Ga0207646_10000299
1405 Ga0207646_10073139
1406 Ga0207646_10076784
1407 Ga0207646_10834465
1408 Ga0207646_11181368
1409 Ga0207681_10006833
1410 Ga0207681_10024685
1411 Ga0207694_10001202
1412 Ga0207694_10187273
1413 Ga0207650_10000884
1414 Ga0207650_10026937
1415 Ga0207659_10007950
1416 Ga0207659_10657003
1417 Ga0207687_10003342
1418 Ga0207687_10020555
1419 Ga0207687_10362438
1420 Ga0207687_10577006
1421 Ga0207700_10020153
1422 Ga0207700_10029544
1423 Ga0207700_10066071
1424 Ga0207700_10107614
1425 Ga0207700_10242096
1426 Ga0207700_10324875
1427 Ga0207700_10334361
1428 Ga0207700_10403198
1429 Ga0207700_10674793
1430 Ga0207700_10750400
1431 Ga0207700_10845682
1432 Ga0207664_10012448
1433 Ga0207664_10055818
1434 Ga0207664_10171335
1435 Ga0207664_10241493
1436 Ga0207664_10304645
1437 Ga0207664_10330206
1438 Ga0207664_10417527
1439 Ga0207664_10565044
1440 Ga0207664_11516953
1441 Ga0207644_10014908
1442 Ga0207644_10117802
1443 Ga0207644_10170147
1444 Ga0207644_10266412
1445 Ga0207690_10029685
1446 Ga0207690_10767733
1447 Ga0207706_10001115
1448 Ga0207706_10001302
1449 Ga0207706_10200076
1450 Ga0207706_10344227
1451 Ga0207686_10285370
1452 Ga0207709_10608613
1453 Ga0207670_10015041
1454 Ga0207669_10757492
1455 Ga0207704_10008160
1456 Ga0207704_10019382
1457 Ga0207704_10092443
1458 Ga0207665_10000707
1459 Ga0207665_10008074
1460 Ga0207665_10018674
1461 Ga0207665_10064875
1462 Ga0207665_10102776
1463 Ga0207665_10172450
1464 Ga0207665_10354008
1465 Ga0207665_11110619
1466 Ga0207691_10099391
1467 Ga0207711_10003254
1468 Ga0207711_10018478
1469 Ga0207711_10133830
1470 Ga0207711_10191300
1471 Ga0207711_10217020
1472 Ga0207711_10368086
1473 Ga0207711_11096173
1474 Ga0207689_10015489
1475 Ga0207689_10077709
1476 Ga0207689_10098843
1477 Ga0207661_10001953
1478 Ga0207661_10030678
1479 Ga0207661_10073165
1480 Ga0207679_10000065
1481 Ga0207679_10558254
1482 Ga0207667_10000606
1483 Ga0207667_10002559
1484 Ga0207667_10012218
1485 Ga0207667_10053472
1486 Ga0207667_10206713
1487 Ga0207667_10275618
1488 Ga0207667_10492413
1489 Ga0207651_10003090
1490 Ga0207712_10088521
1491 Ga0207712_10144035
1492 Ga0207712_10894086
1493 Ga0207668_10007280
1494 Ga0207668_10134677
1495 Ga0207668_10238032
1496 Ga0207640_10004325
1497 Ga0207640_10041651
1498 Ga0207640_10060488
1499 Ga0207640_10221101
1500 Ga0207640_10248384
1501 Ga0207658_10033650
1502 Ga0207658_10151789
1503 Ga0207677_10028419
1504 Ga0207677_10047248
1505 Ga0207677_10065902
1506 Ga0207677_10117047
1507 Ga0207677_10131830
1508 Ga0207677_10244747
1509 Ga0207677_10329154
1510 Ga0207703_10005430
1511 Ga0207703_10015693
1512 Ga0207703_10035952
1513 Ga0207703_10096687
1514 Ga0207639_10007870
1515 Ga0207639_10060078
1516 Ga0207639_10739085
1517 Ga0207678_10021841
1518 Ga0207678_10033561
1519 Ga0207678_10840111
1520 Ga0207708_10371539
1521 Ga0207702_10000704
1522 Ga0207702_10003921
1523 Ga0207702_10007831
1524 Ga0207702_10013102
1525 Ga0207702_10026616
1526 Ga0207702_10078542
1527 Ga0207702_10083397
1528 Ga0207641_10001498
1529 Ga0207641_10030801
1530 Ga0207641_10277459
1531 Ga0207648_10001532
1532 Ga0207648_10016963
1533 Ga0207648_10024585
1534 Ga0207648_10746085
1535 Ga0207676_10011902
1536 Ga0207676_10016818
1537 Ga0207676_10018366
1538 Ga0207674_10000404
1539 Ga0207674_10006025
1540 Ga0207674_10082427
1541 Ga0207674_10136552
1542 Ga0207674_11125822
1543 Ga0207675_100048098
1544 Ga0207675_100069688
1545 Ga0207675_100338499
1546 Ga0207675_100809031
1547 Ga0207683_10073373
1548 Ga0207683_10123499
1549 Ga0207683_10148997
1550 Ga0207683_11429344
1551 Ga0207698_10050885
1552 Ga0207698_10434886
1553 Ga0265354_1004614
1554 Ga0265355_1013096
1555 Ga0268266_10021034
1556 Ga0268266_10146360
1557 Ga0268266_10402387
1558 Ga0268265_10016219
1559 Ga0268265_10031616
1560 Ga0268264_10032041
1561 Ga0268264_10068115
1562 Ga0268264_10294989
1563 Ga0268264_10763349
1564 Ga0265338_10268769
1565 Ga0265760_10011095
1566 Ga0373930_0020536
1567 Ga0373938_0087512
1568 Ga0373940_0040177
1569 Ga0373944_0044857
1570 Ga0373949_0105638
1571 Ga0373923_0032542
1572 Ga0373932_0035194
1573 Ga0373932_0057097
1574 Ga0373932_0165912
1575 Ga0373936_0020957
1576 Ga0373939_0254712
1577 Ga0373939_0256837
1578 Ga0373941_0423610
1579 Ga0373945_0018163
1580 Ga0373960_0238975
1581 Ga0373943_0019696
1582 Ga0373943_0132951
1583 Ga0373943_0194506
1584 Ga0373943_0258972
1585 Ga0373946_0076381
1586 Ga0373942_0022184
1587 Ga0373931_0005211
1588 Ga0373931_0021254
1589 Ga0373931_0031443
1590 Ga0373935_0002781
1591 Ga0373935_0223361
1592 Ga0373927_0022380
1593 Ga0373927_0048315
1594 Ga0373927_0356662
1595 Ga0373947_0014842
1596 Ga0373947_0119208
1597 Ga0373937_0056334
1598 Ga0373937_0258006
1599 Ga0373925_0008134
1600 Ga0373925_0008971
1601 Ga0373925_0082985
1602 Ga0373925_0188589
1603 Ga0373925_0215708
1604 Ga0436365_0755887
1605 Ga0436360_1208113
1606 Ga0436363_0890929
1607 Ga0436363_1045307
1608 Ga0436362_0123581
1609 Ga0436362_0841557
1610 Ga0436362_1176072
1611 Ga0451577_0305742
1612 Ga0451577_0683934
1613 Ga0453683_0993320
1614 Ga0466961_0097945
1615 Ga0466963_0134604
1616 Ga0466964_0187057
1617 Ga0453684_0339485
1618 Ga0466968_0721900
1619 Ga0466957_0657204
1620 Ga0466959_0249029
1621 Ga0466959_0586505
1622 Ga0451576_0094988
1623 Ga0451576_0257072
1624 Ga0466958_0208050
1625 Ga0466958_0298762
1626 Ga0466967_0009278
1627 Ga0466967_0198602
1628 Ga0466967_0826455
1629 Ga0495580_0000461
1630 Ga0495580_0001484
1631 Ga0495580_0001584
1632 Ga0495580_0010637
1633 Ga0495580_0012540
1634 Ga0495580_0021329
1635 Ga0495580_0050637
1636 Ga0495580_0074749
1637 Ga0495580_0231571
1638 Ga0495580_0475767
1639 Ga0495582_0001798
1640 Ga0495639_0203197
1641 Ga0495594_0043135
1642 Ga0495663_0367817
1643 Ga0495666_0053972
1644 Ga0495665_0003996
1645 Ga0495665_0012360
1646 Ga0495665_0183990
1647 Ga0495586_0222528
1648 Ga0495634_0228061
1649 Ga0495635_0520083
1650 Ga0495658_0057523
1651 Ga0495669_0030202
1652 Ga0495624_0112562
1653 Ga0495624_0281949
1654 Ga0495581_0007643
1655 Ga0495674_0252633
1656 Ga0495674_0554662
1657 Ga0495684_0203577
1658 Ga0495593_0185865
1659 Ga0496100_0512380
1660 Ga0496100_1302086
1661 Ga0496101_0054464
1662 Ga0496102_0001755
1663 Ga0496102_0022938
1664 Ga0496102_0037275
1665 Ga0496102_0119194
1666 Ga0496102_0294518
1667 Ga0496102_0430774
1668 Ga0496102_0823855
1669 Ga0496103_0012744
1670 Ga0496103_0036618
1671 Ga0496103_0144491
1672 Ga0496104_0025254
1673 Ga0496104_0032040
1674 Ga0496104_0106257
1675 Ga0496105_0191134
1676 Ga0496105_0250442
1677 Ga0496105_0433101
1678 Ga0496105_0540549
1679 Ga0496106_0187133
1680 Ga0496106_0207598
1681 Ga0496106_0580463
1682 Ga0496107_0202953
1683 Ga0496107_0248065
1684 Ga0496107_0320407
1685 Ga0496108_0000263
1686 Ga0496108_0107129
1687 Ga0496108_0802405
1688 Ga0496109_0000336
1689 Ga0496109_0279334
1690 Ga0496109_0491401
1691 Ga0496109_1130891
1692 Ga0496110_0000474
1693 Ga0496110_0396420
1694 Ga0496111_0056663
1695 Ga0496111_0899920
1696 Ga0496112_0000176
1697 Ga0496112_0051864
1698 Ga0496112_0125755
1699 Ga0496112_0181363
1700 Ga0496112_0319655
1701 Ga0496112_0357613
1702 Ga0496112_0645771
1703 Ga0496112_0793595
1704 Ga0496113_0002059
1705 Ga0496113_0127011
1706 Ga0496113_0582446
1707 Ga0496114_0514800
1708 Ga0496114_0527210
1709 Ga0496114_1672011
1710 Ga0496115_0042810
1711 Ga0496115_0067699
1712 Ga0496115_0124421
1713 Ga0496115_0314393
1714 Ga0501067_0112909
1715 Ga0501070_0080886
1716 Ga0501080_0556574
1717 Ga0501083_0165272
1718 nmdc:mga0n895_191485_c1
1719 nmdc:mga0n895_303945_c1
1720 nmdc:mga0n895_328480_c1
1721 nmdc:mga0rr50_15735_c1
1722 nmdc:mga0rr50_88956_c1
1723 nmdc:mga08x19_1019001_c1
1724 nmdc:mga08x19_28678_c1
1725 nmdc:mga08x19_348049_c1
1726 nmdc:mga08x19_4356_c1
1727 nmdc:mga08x19_60075_c1
1728 nmdc:mga08x19_678_c1
1729 nmdc:mga0a205_740300_c1
1730 Ga0495601_0088453
1731 Ga0495612_0035581
1732 Ga0495619_0665059
1733 Ga0500590_057461
1734 Ga0501084_1179463
1735 Ga0501082_0264231
1736 Ga0466962_0303385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

20

106

0.97

PF13279

4HBT_2

Thioesterase-like superfamily

12

136

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.964 15 142
5t06-assembly1.cif.gz_C crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa 0.9603 14 142
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9592 13 142
1z54-assembly1.cif.gz_C crystal structure of a hypothetical protein tt1821 from thermus thermophilus 0.9557 16 145
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9531 13 142
ID Description Score Start End Superfamily
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.964 15 142 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9604 14 142 3.10.129.10
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9595 13 144 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9492 15 123 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9424 15 142 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V9SWB7-F1-model_v4 Acyl-CoA thioesterase 0.9867 29 148 GO:0047617
AF-A0A6L4ZNP2-F1-model_v4 Acyl-CoA thioester hydrolase 0.9831 14 146 GO:0047617
AF-A0A2V9PIV4-F1-model_v4 Acyl-CoA thioesterase 0.9822 29 146 GO:0047617
AF-A0A5R9GTI4-F1-model_v4 Tol-pal system-associated acyl-CoA thioesterase 0.9803 15 145 GO:0047617
AF-A0A3M1TGM7-F1-model_v4 Acyl-CoA thioesterase 0.9802 13 146 GO:0047617

Map