F483388
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 849 | 227 | 1696 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10789076|Ga0070666_107890762 |
| Length | 115 |
| Sequence | MKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQAAGTAATVRVDDGGQLRVTGGPAVGTGSELDGYYVYDAPGPDAAIAFAARIPVARFGGTVEVRPMLER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 119 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 126 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 130 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 131 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 132 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 133 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 135 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 136 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 137 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 140 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 142 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 143 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 144 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 146 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 149 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 150 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 157 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 158 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 163 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.18 |
| Metatranscriptomes | 0.82 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.77 |
| Rhizosphere | 95.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070666_10789076 | 3300005335 | Unclassified | 699 |
| 2 | Ga0070683_100033360 | 3300005329 | Bacteria | 4695 |
| 3 | Ga0070682_100063307 | 3300005337 | Bacteria | 2345 |
| 4 | Ga0070682_100129337 | 3300005337 | Bacteria | 1707 |
| 5 | Ga0070682_100480481 | 3300005337 | Bacteria | 958 |
| 6 | Ga0068868_100131874 | 3300005338 | Bacteria | 2045 |
| 7 | Ga0068868_100245461 | 3300005338 | Bacteria | 1506 |
| 8 | Ga0070660_100400106 | 3300005339 | Bacteria | 1135 |
| 9 | Ga0070660_101038396 | 3300005339 | Unclassified | 693 |
| 10 | Ga0070687_100526423 | 3300005343 | Bacteria | 800 |
| 11 | Ga0070661_100003455 | 3300005344 | Bacteria | 10897 |
| 12 | Ga0070661_101217977 | 3300005344 | Bacteria | 630 |
| 13 | Ga0070692_10119236 | 3300005345 | Bacteria | 1469 |
| 14 | Ga0070675_101741108 | 3300005354 | Bacteria | 575 |
| 15 | Ga0070659_100272528 | 3300005366 | Bacteria | 1407 |
| 16 | Ga0070709_10003440 | 3300005434 | Bacteria | 8490 |
| 17 | Ga0070709_10031163 | 3300005434 | Bacteria | 3206 |
| 18 | Ga0070709_10063590 | 3300005434 | Bacteria | 2357 |
| 19 | Ga0070709_10109719 | 3300005434 | Bacteria | 1853 |
| 20 | Ga0070709_10935912 | 3300005434 | Bacteria | 687 |
| 21 | Ga0070714_100025916 | 3300005435 | Bacteria | 4842 |
| 22 | Ga0070714_100034826 | 3300005435 | Bacteria | 4217 |
| 23 | Ga0070714_100038801 | 3300005435 | Bacteria | 4006 |
| 24 | Ga0070714_100045593 | 3300005435 | Bacteria | 3716 |
| 25 | Ga0070714_100048787 | 3300005435 | Bacteria | 3602 |
| 26 | Ga0070714_100109834 | 3300005435 | Bacteria | 2440 |
| 27 | Ga0070714_100132173 | 3300005435 | Bacteria | 2231 |
| 28 | Ga0070714_100136282 | 3300005435 | Bacteria | 2199 |
| 29 | Ga0070714_100235133 | 3300005435 | Bacteria | 1689 |
| 30 | Ga0070714_100451173 | 3300005435 | Bacteria | 1221 |
| 31 | Ga0070714_101108199 | 3300005435 | Bacteria | 771 |
| 32 | Ga0070714_101196967 | 3300005435 | Bacteria | 741 |
| 33 | Ga0070714_101217329 | 3300005435 | Bacteria | 735 |
| 34 | Ga0070714_101517932 | 3300005435 | Unclassified | 654 |
| 35 | Ga0070714_101847489 | 3300005435 | Unclassified | 590 |
| 36 | Ga0070714_101859840 | 3300005435 | Bacteria | 588 |
| 37 | Ga0070713_100009184 | 3300005436 | Bacteria | 7059 |
| 38 | Ga0070713_100037889 | 3300005436 | Bacteria | 3901 |
| 39 | Ga0070713_100042753 | 3300005436 | Bacteria | 3700 |
| 40 | Ga0070713_100050924 | 3300005436 | Bacteria | 3423 |
| 41 | Ga0070713_100107723 | 3300005436 | Bacteria | 2425 |
| 42 | Ga0070713_100233861 | 3300005436 | Bacteria | 1671 |
| 43 | Ga0070713_100278995 | 3300005436 | Bacteria | 1532 |
| 44 | Ga0070713_100292103 | 3300005436 | Bacteria | 1498 |
| 45 | Ga0070713_100375463 | 3300005436 | Bacteria | 1324 |
| 46 | Ga0070713_100690706 | 3300005436 | Bacteria | 974 |
| 47 | Ga0070713_100900642 | 3300005436 | Bacteria | 851 |
| 48 | Ga0070713_100957689 | 3300005436 | Unclassified | 825 |
| 49 | Ga0070710_10033148 | 3300005437 | Bacteria | 2803 |
| 50 | Ga0070710_10048485 | 3300005437 | Bacteria | 2373 |
| 51 | Ga0070710_10053165 | 3300005437 | Bacteria | 2280 |
| 52 | Ga0070710_10098825 | 3300005437 | Bacteria | 1734 |
| 53 | Ga0070710_10273435 | 3300005437 | Bacteria | 1093 |
| 54 | Ga0070710_10380989 | 3300005437 | Unclassified | 941 |
| 55 | Ga0070710_10443183 | 3300005437 | Bacteria | 879 |
| 56 | Ga0070710_11223238 | 3300005437 | Bacteria | 556 |
| 57 | Ga0070710_11424781 | 3300005437 | Unclassified | 519 |
| 58 | Ga0070711_100015364 | 3300005439 | Bacteria | 4845 |
| 59 | Ga0070711_100040774 | 3300005439 | Bacteria | 3133 |
| 60 | Ga0070711_100052013 | 3300005439 | Bacteria | 2817 |
| 61 | Ga0070711_100056034 | 3300005439 | Bacteria | 2724 |
| 62 | Ga0070711_100142479 | 3300005439 | Bacteria | 1799 |
| 63 | Ga0070711_100232692 | 3300005439 | Bacteria | 1437 |
| 64 | Ga0070711_100333217 | 3300005439 | Bacteria | 1215 |
| 65 | Ga0070711_100530995 | 3300005439 | Bacteria | 974 |
| 66 | Ga0070711_100886973 | 3300005439 | Unclassified | 761 |
| 67 | Ga0070694_101166667 | 3300005444 | Bacteria | 644 |
| 68 | Ga0070708_100520534 | 3300005445 | Bacteria | 1122 |
| 69 | Ga0070708_100802365 | 3300005445 | Unclassified | 885 |
| 70 | Ga0070663_100106128 | 3300005455 | Bacteria | 2104 |
| 71 | Ga0070663_100347748 | 3300005455 | Bacteria | 1200 |
| 72 | Ga0070678_100564278 | 3300005456 | Bacteria | 1012 |
| 73 | Ga0070662_100716429 | 3300005457 | Bacteria | 847 |
| 74 | Ga0070681_10040497 | 3300005458 | Bacteria | 4667 |
| 75 | Ga0070681_10110473 | 3300005458 | Bacteria | 2689 |
| 76 | Ga0070681_10768657 | 3300005458 | Bacteria | 880 |
| 77 | Ga0070681_11043108 | 3300005458 | Bacteria | 738 |
| 78 | Ga0070706_100518393 | 3300005467 | Bacteria | 1109 |
| 79 | Ga0070706_100801068 | 3300005467 | Bacteria | 872 |
| 80 | Ga0070706_100832181 | 3300005467 | Bacteria | 854 |
| 81 | Ga0070706_100897173 | 3300005467 | Unclassified | 819 |
| 82 | Ga0070707_100099434 | 3300005468 | Bacteria | 2818 |
| 83 | Ga0070707_100116517 | 3300005468 | Bacteria | 2593 |
| 84 | Ga0070698_100010599 | 3300005471 | Bacteria | 9821 |
| 85 | Ga0070698_100130250 | 3300005471 | Bacteria | 2471 |
| 86 | Ga0070698_100219741 | 3300005471 | Bacteria | 1834 |
| 87 | Ga0070684_100130036 | 3300005535 | Bacteria | 2271 |
| 88 | Ga0070684_100330598 | 3300005535 | Bacteria | 1401 |
| 89 | Ga0070684_100420881 | 3300005535 | Bacteria | 1233 |
| 90 | Ga0070684_101819838 | 3300005535 | Unclassified | 575 |
| 91 | Ga0070697_100068065 | 3300005536 | Bacteria | 2914 |
| 92 | Ga0070697_100756518 | 3300005536 | Bacteria | 859 |
| 93 | Ga0068853_100955656 | 3300005539 | Bacteria | 824 |
| 94 | Ga0068853_101031384 | 3300005539 | Unclassified | 792 |
| 95 | Ga0070695_100406868 | 3300005545 | Bacteria | 1033 |
| 96 | Ga0070695_100835184 | 3300005545 | Bacteria | 740 |
| 97 | Ga0070665_100013044 | 3300005548 | Bacteria | 8369 |
| 98 | Ga0070665_100035520 | 3300005548 | Bacteria | 5013 |
| 99 | Ga0070665_100622861 | 3300005548 | Unclassified | 1092 |
| 100 | Ga0070704_100107928 | 3300005549 | Bacteria | 2113 |
| 101 | Ga0068855_100063832 | 3300005563 | Bacteria | 4296 |
| 102 | Ga0068855_100201909 | 3300005563 | Bacteria | 2238 |
| 103 | Ga0068855_100606667 | 3300005563 | Unclassified | 1180 |
| 104 | Ga0068855_101434677 | 3300005563 | Bacteria | 710 |
| 105 | Ga0068855_102565656 | 3300005563 | Bacteria | 506 |
| 106 | Ga0070664_102007938 | 3300005564 | Unclassified | 549 |
| 107 | Ga0068857_100059922 | 3300005577 | Bacteria | 3382 |
| 108 | Ga0068857_101881379 | 3300005577 | Bacteria | 586 |
| 109 | Ga0068856_100015593 | 3300005614 | Bacteria | 7347 |
| 110 | Ga0068856_100031822 | 3300005614 | Bacteria | 5162 |
| 111 | Ga0068856_100051473 | 3300005614 | Bacteria | 4060 |
| 112 | Ga0068856_100308304 | 3300005614 | Bacteria | 1601 |
| 113 | Ga0068856_100811921 | 3300005614 | Unclassified | 955 |
| 114 | Ga0070702_100157582 | 3300005615 | Bacteria | 1464 |
| 115 | Ga0068852_100474687 | 3300005616 | Bacteria | 1242 |
| 116 | Ga0068852_100738402 | 3300005616 | Bacteria | 996 |
| 117 | Ga0068864_100093479 | 3300005618 | Bacteria | 2656 |
| 118 | Ga0068864_100770736 | 3300005618 | Bacteria | 944 |
| 119 | Ga0068863_100029140 | 3300005841 | Bacteria | 5270 |
| 120 | Ga0068863_100293955 | 3300005841 | Bacteria | 1575 |
| 121 | Ga0068863_101641612 | 3300005841 | Unclassified | 652 |
| 122 | Ga0068858_100110114 | 3300005842 | Bacteria | 2571 |
| 123 | Ga0068858_101284392 | 3300005842 | Unclassified | 720 |
| 124 | Ga0068860_100525402 | 3300005843 | Bacteria | 1184 |
| 125 | Ga0070717_10013942 | 3300006028 | Bacteria | 6173 |
| 126 | Ga0070717_10022806 | 3300006028 | Bacteria | 4952 |
| 127 | Ga0070717_10120463 | 3300006028 | Bacteria | 2247 |
| 128 | Ga0070717_10226904 | 3300006028 | Bacteria | 1643 |
| 129 | Ga0070717_10260109 | 3300006028 | Bacteria | 1535 |
| 130 | Ga0070717_10291719 | 3300006028 | Bacteria | 1448 |
| 131 | Ga0070717_10303453 | 3300006028 | Bacteria | 1420 |
| 132 | Ga0070717_10305678 | 3300006028 | Bacteria | 1414 |
| 133 | Ga0070717_10375858 | 3300006028 | Unclassified | 1274 |
| 134 | Ga0070717_10460053 | 3300006028 | Bacteria | 1147 |
| 135 | Ga0070717_10663607 | 3300006028 | Bacteria | 947 |
| 136 | Ga0070717_11111560 | 3300006028 | Bacteria | 720 |
| 137 | Ga0070717_11259830 | 3300006028 | Bacteria | 672 |
| 138 | Ga0070717_11393951 | 3300006028 | Bacteria | 637 |
| 139 | Ga0070717_11703373 | 3300006028 | Bacteria | 570 |
| 140 | Ga0070715_10267441 | 3300006163 | Unclassified | 901 |
| 141 | Ga0070715_10428711 | 3300006163 | Unclassified | 742 |
| 142 | Ga0070716_100006018 | 3300006173 | Bacteria | 5909 |
| 143 | Ga0070716_100054974 | 3300006173 | Bacteria | 2276 |
| 144 | Ga0070716_100101112 | 3300006173 | Bacteria | 1767 |
| 145 | Ga0070716_100176539 | 3300006173 | Bacteria | 1399 |
| 146 | Ga0070716_100754981 | 3300006173 | Bacteria | 749 |
| 147 | Ga0070716_100799431 | 3300006173 | Bacteria | 730 |
| 148 | Ga0070712_100063701 | 3300006175 | Bacteria | 2612 |
| 149 | Ga0070712_100075917 | 3300006175 | Bacteria | 2418 |
| 150 | Ga0070712_100079819 | 3300006175 | Bacteria | 2366 |
| 151 | Ga0070712_100099360 | 3300006175 | Unclassified | 2148 |
| 152 | Ga0070712_100119350 | 3300006175 | Bacteria | 1982 |
| 153 | Ga0070712_100169798 | 3300006175 | Bacteria | 1691 |
| 154 | Ga0070712_100174792 | 3300006175 | Bacteria | 1669 |
| 155 | Ga0070712_100318136 | 3300006175 | Unclassified | 1265 |
| 156 | Ga0070712_100419805 | 3300006175 | Bacteria | 1108 |
| 157 | Ga0097621_100043617 | 3300006237 | Bacteria | 3616 |
| 158 | Ga0068871_100127033 | 3300006358 | Bacteria | 2159 |
| 159 | Ga0068871_100729468 | 3300006358 | Bacteria | 910 |
| 160 | Ga0075433_10402997 | 3300006852 | Bacteria | 1207 |
| 161 | Ga0075434_100423383 | 3300006871 | Bacteria | 1353 |
| 162 | Ga0075434_100843737 | 3300006871 | Bacteria | 932 |
| 163 | Ga0075436_100163477 | 3300006914 | Bacteria | 1570 |
| 164 | Ga0075435_100633662 | 3300007076 | Bacteria | 928 |
| 165 | Ga0105240_10119801 | 3300009093 | Bacteria | 3170 |
| 166 | Ga0105240_11298841 | 3300009093 | Bacteria | 767 |
| 167 | Ga0105245_10066721 | 3300009098 | Bacteria | 3257 |
| 168 | Ga0105245_10167836 | 3300009098 | Bacteria | 2088 |
| 169 | Ga0105247_10064778 | 3300009101 | Unclassified | 2272 |
| 170 | Ga0105247_11591479 | 3300009101 | Bacteria | 536 |
| 171 | Ga0105241_10172367 | 3300009174 | Bacteria | 1788 |
| 172 | Ga0105248_10290442 | 3300009177 | Bacteria | 1841 |
| 173 | Ga0105237_10013855 | 3300009545 | Bacteria | 8437 |
| 174 | Ga0105237_10319400 | 3300009545 | Bacteria | 1556 |
| 175 | Ga0105237_10376547 | 3300009545 | Bacteria | 1424 |
| 176 | Ga0105237_11278339 | 3300009545 | Bacteria | 740 |
| 177 | Ga0105238_10042698 | 3300009551 | Bacteria | 4590 |
| 178 | Ga0105238_10053420 | 3300009551 | Bacteria | 4060 |
| 179 | Ga0105238_10313124 | 3300009551 | Bacteria | 1555 |
| 180 | Ga0105249_10077484 | 3300009553 | Bacteria | 3083 |
| 181 | Ga0105239_10308772 | 3300010375 | Bacteria | 1782 |
| 182 | Ga0105239_10672042 | 3300010375 | Bacteria | 1183 |
| 183 | Ga0105246_10154594 | 3300011119 | Bacteria | 1741 |
| 184 | Ga0105246_10677107 | 3300011119 | Bacteria | 901 |
| 185 | Ga0157373_11196291 | 3300013100 | Bacteria | 573 |
| 186 | Ga0157370_10047570 | 3300013104 | Bacteria | 4112 |
| 187 | Ga0157370_10059914 | 3300013104 | Bacteria | 3616 |
| 188 | Ga0157370_10124084 | 3300013104 | Bacteria | 2411 |
| 189 | Ga0157370_10130084 | 3300013104 | Bacteria | 2348 |
| 190 | Ga0157369_10061422 | 3300013105 | Bacteria | 4051 |
| 191 | Ga0157369_10085408 | 3300013105 | Bacteria | 3372 |
| 192 | Ga0157369_10144709 | 3300013105 | Bacteria | 2513 |
| 193 | Ga0157369_10338314 | 3300013105 | Bacteria | 1563 |
| 194 | Ga0157369_11634112 | 3300013105 | Bacteria | 655 |
| 195 | Ga0157374_10135038 | 3300013296 | Unclassified | 2391 |
| 196 | Ga0157374_10215318 | 3300013296 | Bacteria | 1884 |
| 197 | Ga0157378_10295310 | 3300013297 | Bacteria | 1566 |
| 198 | Ga0163162_10596876 | 3300013306 | Bacteria | 1231 |
| 199 | Ga0163162_11971731 | 3300013306 | Bacteria | 669 |
| 200 | Ga0157372_10018230 | 3300013307 | Bacteria | 7545 |
| 201 | Ga0157372_10464066 | 3300013307 | Unclassified | 1476 |
| 202 | Ga0157372_10470221 | 3300013307 | Bacteria | 1465 |
| 203 | Ga0157372_10684274 | 3300013307 | Bacteria | 1194 |
| 204 | Ga0157372_10747686 | 3300013307 | Bacteria | 1137 |
| 205 | Ga0157375_10022374 | 3300013308 | Bacteria | 5819 |
| 206 | Ga0157375_10091448 | 3300013308 | Bacteria | 3104 |
| 207 | Ga0163163_10151628 | 3300014325 | Bacteria | 2361 |
| 208 | Ga0163163_10163090 | 3300014325 | Unclassified | 2275 |
| 209 | Ga0157379_10040373 | 3300014968 | Bacteria | 4165 |
| 210 | Ga0157379_10218137 | 3300014968 | Bacteria | 1728 |
| 211 | Ga0157379_11512358 | 3300014968 | Bacteria | 653 |
| 212 | Ga0157376_10684563 | 3300014969 | Unclassified | 1029 |
| 213 | Ga0206356_10631136 | 3300020070 | Bacteria | 1955 |
| 214 | Ga0206356_11329143 | 3300020070 | Bacteria | 2132 |
| 215 | Ga0206350_10702530 | 3300020080 | Bacteria | 525 |
| 216 | Ga0206353_10312476 | 3300020082 | Bacteria | 2528 |
| 217 | Ga0224712_10256979 | 3300022467 | Unclassified | 808 |
| 218 | Ga0224712_10591060 | 3300022467 | Unclassified | 541 |
| 219 | Ga0207653_10185517 | 3300025885 | Bacteria | 779 |
| 220 | Ga0207692_10024312 | 3300025898 | Bacteria | 2815 |
| 221 | Ga0207692_10031593 | 3300025898 | Bacteria | 2537 |
| 222 | Ga0207692_10035146 | 3300025898 | Bacteria | 2433 |
| 223 | Ga0207692_10076226 | 3300025898 | Bacteria | 1781 |
| 224 | Ga0207692_10110658 | 3300025898 | Bacteria | 1523 |
| 225 | Ga0207692_10137616 | 3300025898 | Bacteria | 1386 |
| 226 | Ga0207692_10360596 | 3300025898 | Bacteria | 898 |
| 227 | Ga0207692_10369455 | 3300025898 | Bacteria | 888 |
| 228 | Ga0207692_10373715 | 3300025898 | Bacteria | 883 |
| 229 | Ga0207692_10376202 | 3300025898 | Unclassified | 881 |
| 230 | Ga0207692_10496782 | 3300025898 | Bacteria | 774 |
| 231 | Ga0207680_10364408 | 3300025903 | Unclassified | 1017 |
| 232 | Ga0207685_10045938 | 3300025905 | Bacteria | 1659 |
| 233 | Ga0207685_10201868 | 3300025905 | Unclassified | 935 |
| 234 | Ga0207685_10230800 | 3300025905 | Bacteria | 885 |
| 235 | Ga0207685_10267956 | 3300025905 | Bacteria | 833 |
| 236 | Ga0207699_10001827 | 3300025906 | Bacteria | 10012 |
| 237 | Ga0207699_10027562 | 3300025906 | Bacteria | 3147 |
| 238 | Ga0207699_10048343 | 3300025906 | Bacteria | 2498 |
| 239 | Ga0207699_10092542 | 3300025906 | Bacteria | 1901 |
| 240 | Ga0207699_10105614 | 3300025906 | Bacteria | 1796 |
| 241 | Ga0207699_10390846 | 3300025906 | Bacteria | 989 |
| 242 | Ga0207699_10580749 | 3300025906 | Unclassified | 815 |
| 243 | Ga0207699_10596597 | 3300025906 | Bacteria | 804 |
| 244 | Ga0207699_10946073 | 3300025906 | Bacteria | 636 |
| 245 | Ga0207699_10989007 | 3300025906 | Unclassified | 622 |
| 246 | Ga0207699_11141835 | 3300025906 | Bacteria | 577 |
| 247 | Ga0207684_10441578 | 3300025910 | Bacteria | 1117 |
| 248 | Ga0207684_10570274 | 3300025910 | Bacteria | 968 |
| 249 | Ga0207684_11141805 | 3300025910 | Unclassified | 647 |
| 250 | Ga0207654_10657345 | 3300025911 | Bacteria | 751 |
| 251 | Ga0207707_10344999 | 3300025912 | Bacteria | 1283 |
| 252 | Ga0207707_10401876 | 3300025912 | Bacteria | 1176 |
| 253 | Ga0207671_10291812 | 3300025914 | Bacteria | 1288 |
| 254 | Ga0207671_10814897 | 3300025914 | Bacteria | 740 |
| 255 | Ga0207671_11225883 | 3300025914 | Unclassified | 586 |
| 256 | Ga0207693_10018279 | 3300025915 | Bacteria | 5585 |
| 257 | Ga0207693_10019025 | 3300025915 | Bacteria | 5467 |
| 258 | Ga0207693_10087943 | 3300025915 | Bacteria | 2435 |
| 259 | Ga0207693_10120263 | 3300025915 | Bacteria | 2062 |
| 260 | Ga0207693_10138815 | 3300025915 | Bacteria | 1911 |
| 261 | Ga0207693_10181805 | 3300025915 | Unclassified | 1655 |
| 262 | Ga0207693_10195613 | 3300025915 | Bacteria | 1591 |
| 263 | Ga0207693_10199126 | 3300025915 | Bacteria | 1575 |
| 264 | Ga0207693_10275837 | 3300025915 | Bacteria | 1317 |
| 265 | Ga0207663_10008551 | 3300025916 | Bacteria | 5361 |
| 266 | Ga0207663_10031037 | 3300025916 | Bacteria | 3158 |
| 267 | Ga0207663_10049670 | 3300025916 | Bacteria | 2603 |
| 268 | Ga0207663_10094159 | 3300025916 | Unclassified | 1995 |
| 269 | Ga0207663_10173143 | 3300025916 | Bacteria | 1535 |
| 270 | Ga0207663_10185934 | 3300025916 | Bacteria | 1488 |
| 271 | Ga0207663_10191175 | 3300025916 | Bacteria | 1470 |
| 272 | Ga0207663_10231596 | 3300025916 | Bacteria | 1350 |
| 273 | Ga0207663_11233438 | 3300025916 | Unclassified | 602 |
| 274 | Ga0207663_11352593 | 3300025916 | Bacteria | 574 |
| 275 | Ga0207663_11432349 | 3300025916 | Bacteria | 556 |
| 276 | Ga0207657_10019795 | 3300025919 | Bacteria | 6380 |
| 277 | Ga0207657_10025231 | 3300025919 | Bacteria | 5485 |
| 278 | Ga0207657_11046984 | 3300025919 | Bacteria | 625 |
| 279 | Ga0207649_11395674 | 3300025920 | Bacteria | 554 |
| 280 | Ga0207649_11500153 | 3300025920 | Unclassified | 534 |
| 281 | Ga0207646_10050678 | 3300025922 | Bacteria | 3715 |
| 282 | Ga0207646_10492774 | 3300025922 | Bacteria | 1104 |
| 283 | Ga0207694_10145544 | 3300025924 | Bacteria | 1907 |
| 284 | Ga0207694_10178366 | 3300025924 | Bacteria | 1722 |
| 285 | Ga0207694_10247651 | 3300025924 | Bacteria | 1457 |
| 286 | Ga0207687_10047492 | 3300025927 | Bacteria | 2976 |
| 287 | Ga0207687_10398169 | 3300025927 | Bacteria | 1132 |
| 288 | Ga0207700_10008468 | 3300025928 | Bacteria | 6375 |
| 289 | Ga0207700_10010130 | 3300025928 | Bacteria | 5928 |
| 290 | Ga0207700_10017187 | 3300025928 | Bacteria | 4826 |
| 291 | Ga0207700_10057876 | 3300025928 | Bacteria | 2925 |
| 292 | Ga0207700_10096514 | 3300025928 | Bacteria | 2347 |
| 293 | Ga0207700_10349766 | 3300025928 | Bacteria | 1287 |
| 294 | Ga0207700_10392917 | 3300025928 | Bacteria | 1214 |
| 295 | Ga0207700_10403597 | 3300025928 | Bacteria | 1198 |
| 296 | Ga0207700_10404470 | 3300025928 | Bacteria | 1197 |
| 297 | Ga0207700_10411111 | 3300025928 | Bacteria | 1187 |
| 298 | Ga0207700_10413488 | 3300025928 | Bacteria | 1184 |
| 299 | Ga0207700_10425895 | 3300025928 | Bacteria | 1166 |
| 300 | Ga0207700_10713476 | 3300025928 | Bacteria | 895 |
| 301 | Ga0207700_10714668 | 3300025928 | Bacteria | 895 |
| 302 | Ga0207700_10887183 | 3300025928 | Unclassified | 798 |
| 303 | Ga0207700_10904301 | 3300025928 | Bacteria | 790 |
| 304 | Ga0207700_11458556 | 3300025928 | Bacteria | 608 |
| 305 | Ga0207664_10011460 | 3300025929 | Bacteria | 6306 |
| 306 | Ga0207664_10012337 | 3300025929 | Bacteria | 6105 |
| 307 | Ga0207664_10018355 | 3300025929 | Bacteria | 5147 |
| 308 | Ga0207664_10024772 | 3300025929 | Bacteria | 4512 |
| 309 | Ga0207664_10024891 | 3300025929 | Bacteria | 4501 |
| 310 | Ga0207664_10031774 | 3300025929 | Bacteria | 4042 |
| 311 | Ga0207664_10036915 | 3300025929 | Bacteria | 3779 |
| 312 | Ga0207664_10064140 | 3300025929 | Bacteria | 2937 |
| 313 | Ga0207664_10071813 | 3300025929 | Bacteria | 2789 |
| 314 | Ga0207664_10091032 | 3300025929 | Bacteria | 2500 |
| 315 | Ga0207664_10103766 | 3300025929 | Bacteria | 2353 |
| 316 | Ga0207664_10107957 | 3300025929 | Bacteria | 2310 |
| 317 | Ga0207664_10187616 | 3300025929 | Bacteria | 1778 |
| 318 | Ga0207664_10226746 | 3300025929 | Bacteria | 1623 |
| 319 | Ga0207664_10237914 | 3300025929 | Bacteria | 1585 |
| 320 | Ga0207664_10306905 | 3300025929 | Bacteria | 1397 |
| 321 | Ga0207664_10319784 | 3300025929 | Bacteria | 1369 |
| 322 | Ga0207664_10789588 | 3300025929 | Bacteria | 854 |
| 323 | Ga0207664_10917609 | 3300025929 | Unclassified | 786 |
| 324 | Ga0207664_11022407 | 3300025929 | Bacteria | 740 |
| 325 | Ga0207664_11441823 | 3300025929 | Unclassified | 609 |
| 326 | Ga0207690_10134126 | 3300025932 | Bacteria | 1816 |
| 327 | Ga0207690_11842242 | 3300025932 | Unclassified | 505 |
| 328 | Ga0207665_10000449 | 3300025939 | Bacteria | 28248 |
| 329 | Ga0207665_10152230 | 3300025939 | Bacteria | 1658 |
| 330 | Ga0207665_10263442 | 3300025939 | Bacteria | 1278 |
| 331 | Ga0207665_10525305 | 3300025939 | Bacteria | 917 |
| 332 | Ga0207665_10624076 | 3300025939 | Bacteria | 843 |
| 333 | Ga0207711_10556824 | 3300025941 | Bacteria | 1069 |
| 334 | Ga0207689_10933508 | 3300025942 | Bacteria | 732 |
| 335 | Ga0207661_11187576 | 3300025944 | Unclassified | 702 |
| 336 | Ga0207679_10374004 | 3300025945 | Bacteria | 1248 |
| 337 | Ga0207667_10268231 | 3300025949 | Bacteria | 1745 |
| 338 | Ga0207667_10771402 | 3300025949 | Bacteria | 960 |
| 339 | Ga0207667_10905205 | 3300025949 | Bacteria | 874 |
| 340 | Ga0207667_11736258 | 3300025949 | Unclassified | 590 |
| 341 | Ga0207651_10575669 | 3300025960 | Bacteria | 982 |
| 342 | Ga0207668_10174281 | 3300025972 | Bacteria | 1690 |
| 343 | Ga0207677_10106176 | 3300026023 | Bacteria | 2080 |
| 344 | Ga0207677_10136237 | 3300026023 | Bacteria | 1872 |
| 345 | Ga0207703_10085015 | 3300026035 | Bacteria | 2647 |
| 346 | Ga0207703_10854722 | 3300026035 | Bacteria | 870 |
| 347 | Ga0207703_11487590 | 3300026035 | Bacteria | 651 |
| 348 | Ga0207639_11128768 | 3300026041 | Unclassified | 735 |
| 349 | Ga0207678_10805430 | 3300026067 | Unclassified | 829 |
| 350 | Ga0207702_10018026 | 3300026078 | Bacteria | 5843 |
| 351 | Ga0207702_10018213 | 3300026078 | Bacteria | 5809 |
| 352 | Ga0207702_10048101 | 3300026078 | Bacteria | 3596 |
| 353 | Ga0207702_10239955 | 3300026078 | Bacteria | 1698 |
| 354 | Ga0207702_10241053 | 3300026078 | Bacteria | 1694 |
| 355 | Ga0207702_10317307 | 3300026078 | Bacteria | 1483 |
| 356 | Ga0207702_10599648 | 3300026078 | Bacteria | 1081 |
| 357 | Ga0207702_10757290 | 3300026078 | Unclassified | 959 |
| 358 | Ga0207702_11022284 | 3300026078 | Bacteria | 820 |
| 359 | Ga0207641_10051815 | 3300026088 | Bacteria | 3476 |
| 360 | Ga0207641_10561735 | 3300026088 | Bacteria | 1114 |
| 361 | Ga0207641_10565777 | 3300026088 | Bacteria | 1110 |
| 362 | Ga0207641_10721276 | 3300026088 | Bacteria | 983 |
| 363 | Ga0207676_10153648 | 3300026095 | Bacteria | 1985 |
| 364 | Ga0207676_11310169 | 3300026095 | Bacteria | 719 |
| 365 | Ga0207674_10004830 | 3300026116 | Bacteria | 16143 |
| 366 | Ga0207674_10651255 | 3300026116 | Bacteria | 1017 |
| 367 | Ga0207674_11620842 | 3300026116 | Bacteria | 616 |
| 368 | Ga0207683_11428610 | 3300026121 | Unclassified | 639 |
| 369 | Ga0207698_10114567 | 3300026142 | Bacteria | 2268 |
| 370 | Ga0207698_11029738 | 3300026142 | Bacteria | 835 |
| 371 | Ga0268266_10033678 | 3300028379 | Bacteria | 4355 |
| 372 | Ga0268264_10201173 | 3300028381 | Bacteria | 1822 |
| 373 | Ga0265337_1011860 | 3300028556 | Bacteria | 2986 |
| 374 | Ga0265319_1037055 | 3300028563 | Bacteria | 1664 |
| 375 | Ga0265334_10049701 | 3300028573 | Bacteria | 1612 |
| 376 | Ga0265334_10093552 | 3300028573 | Bacteria | 1094 |
| 377 | Ga0265323_10093085 | 3300028653 | Bacteria | 1005 |
| 378 | Ga0265336_10054346 | 3300028666 | Bacteria | 1206 |
| 379 | Ga0265338_10804321 | 3300028800 | Unclassified | 644 |
| 380 | Ga0265324_10235692 | 3300029957 | Bacteria | 621 |
| 381 | Ga0265760_10051893 | 3300031090 | Bacteria | 1236 |
| 382 | Ga0265332_10005811 | 3300031238 | Bacteria | 5660 |
| 383 | Ga0265320_10074266 | 3300031240 | Unclassified | 1596 |
| 384 | Ga0265340_10170330 | 3300031247 | Bacteria | 986 |
| 385 | Ga0265339_10274048 | 3300031249 | Bacteria | 811 |
| 386 | Ga0265314_10228435 | 3300031711 | Bacteria | 1081 |
| 387 | Ga0265342_10047241 | 3300031712 | Bacteria | 2584 |
| 388 | Ga0373930_0114741 | 3300034816 | Unclassified | 651 |
| 389 | Ga0373959_0055114 | 3300034820 | Unclassified | 868 |
| 390 | Ga0373926_0001609 | 3300035083 | Bacteria | 6953 |
| 391 | Ga0373926_0318906 | 3300035083 | Bacteria | 608 |
| 392 | Ga0373928_0047636 | 3300035084 | Bacteria | 1003 |
| 393 | Ga0373934_0026029 | 3300035086 | Bacteria | 2268 |
| 394 | Ga0373934_0037527 | 3300035086 | Bacteria | 1908 |
| 395 | Ga0373934_0060377 | 3300035086 | Bacteria | 1510 |
| 396 | Ga0373934_0087019 | 3300035086 | Bacteria | 1258 |
| 397 | Ga0373944_0000173 | 3300035089 | Bacteria | 13181 |
| 398 | Ga0373944_0017997 | 3300035089 | Bacteria | 2014 |
| 399 | Ga0373944_0202363 | 3300035089 | Bacteria | 719 |
| 400 | Ga0373944_0237083 | 3300035089 | Bacteria | 670 |
| 401 | Ga0373923_0006475 | 3300035111 | Bacteria | 4052 |
| 402 | Ga0373923_0009964 | 3300035111 | Bacteria | 3441 |
| 403 | Ga0373923_0020895 | 3300035111 | Bacteria | 2550 |
| 404 | Ga0373923_0139083 | 3300035111 | Bacteria | 1097 |
| 405 | Ga0373923_0161386 | 3300035111 | Unclassified | 1023 |
| 406 | Ga0373923_0209047 | 3300035111 | Bacteria | 904 |
| 407 | Ga0373936_0001025 | 3300035113 | Bacteria | 9990 |
| 408 | Ga0373936_0060348 | 3300035113 | Bacteria | 1547 |
| 409 | Ga0373936_0062756 | 3300035113 | Bacteria | 1520 |
| 410 | Ga0373936_0071448 | 3300035113 | Bacteria | 1431 |
| 411 | Ga0373936_0173264 | 3300035113 | Bacteria | 944 |
| 412 | Ga0373936_0280970 | 3300035113 | Bacteria | 748 |
| 413 | Ga0373936_0613718 | 3300035113 | Bacteria | 511 |
| 414 | Ga0373945_0000210 | 3300035116 | Bacteria | 15935 |
| 415 | Ga0373945_0072646 | 3300035116 | Bacteria | 1305 |
| 416 | Ga0373945_0174187 | 3300035116 | Bacteria | 883 |
| 417 | Ga0373953_0019653 | 3300035117 | Bacteria | 2515 |
| 418 | Ga0373953_0054207 | 3300035117 | Bacteria | 1626 |
| 419 | Ga0373953_0075546 | 3300035117 | Bacteria | 1395 |
| 420 | Ga0373953_0275972 | 3300035117 | Unclassified | 732 |
| 421 | Ga0373954_0010922 | 3300035118 | Bacteria | 4014 |
| 422 | Ga0373954_0076522 | 3300035118 | Bacteria | 1595 |
| 423 | Ga0373954_0091694 | 3300035118 | Bacteria | 1460 |
| 424 | Ga0373954_0129084 | 3300035118 | Bacteria | 1230 |
| 425 | Ga0373954_0313603 | 3300035118 | Bacteria | 774 |
| 426 | Ga0373956_0005942 | 3300035119 | Bacteria | 4882 |
| 427 | Ga0373956_0163554 | 3300035119 | Bacteria | 1049 |
| 428 | Ga0373956_0273148 | 3300035119 | Unclassified | 804 |
| 429 | Ga0373956_0345464 | 3300035119 | Bacteria | 709 |
| 430 | Ga0373956_0391054 | 3300035119 | Bacteria | 663 |
| 431 | Ga0373956_0391623 | 3300035119 | Bacteria | 663 |
| 432 | Ga0373956_0534650 | 3300035119 | Bacteria | 559 |
| 433 | Ga0373957_0021710 | 3300035120 | Bacteria | 2282 |
| 434 | Ga0373957_0030214 | 3300035120 | Bacteria | 1984 |
| 435 | Ga0373957_0372966 | 3300035120 | Bacteria | 611 |
| 436 | Ga0373943_0000104 | 3300035170 | Bacteria | 30769 |
| 437 | Ga0373943_0066953 | 3300035170 | Bacteria | 1810 |
| 438 | Ga0373943_0067307 | 3300035170 | Bacteria | 1806 |
| 439 | Ga0373943_0135498 | 3300035170 | Bacteria | 1322 |
| 440 | Ga0373943_0382732 | 3300035170 | Bacteria | 810 |
| 441 | Ga0373943_0666707 | 3300035170 | Bacteria | 615 |
| 442 | Ga0373943_0730182 | 3300035170 | Bacteria | 588 |
| 443 | Ga0373946_0000015 | 3300035171 | Bacteria | 45992 |
| 444 | Ga0373946_0082964 | 3300035171 | Bacteria | 1407 |
| 445 | Ga0373946_0086754 | 3300035171 | Bacteria | 1380 |
| 446 | Ga0373946_0208295 | 3300035171 | Bacteria | 939 |
| 447 | Ga0373946_0320612 | 3300035171 | Bacteria | 770 |
| 448 | Ga0373955_0022900 | 3300035172 | Bacteria | 3175 |
| 449 | Ga0373955_0224176 | 3300035172 | Bacteria | 1123 |
| 450 | Ga0373955_0304788 | 3300035172 | Bacteria | 961 |
| 451 | Ga0373955_0685230 | 3300035172 | Unclassified | 629 |
| 452 | Ga0373955_0732150 | 3300035172 | Bacteria | 607 |
| 453 | Ga0373924_0014146 | 3300035410 | Bacteria | 3011 |
| 454 | Ga0373924_0016170 | 3300035410 | Bacteria | 2846 |
| 455 | Ga0373924_0018133 | 3300035410 | Bacteria | 2710 |
| 456 | Ga0373924_0047397 | 3300035410 | Bacteria | 1773 |
| 457 | Ga0373924_0157340 | 3300035410 | Bacteria | 996 |
| 458 | Ga0373924_0170506 | 3300035410 | Bacteria | 956 |
| 459 | Ga0373924_0235501 | 3300035410 | Unclassified | 810 |
| 460 | Ga0373924_0360944 | 3300035410 | Bacteria | 648 |
| 461 | Ga0373931_0133410 | 3300035691 | Bacteria | 1432 |
| 462 | Ga0373935_0009424 | 3300035692 | Bacteria | 5841 |
| 463 | Ga0373935_0067434 | 3300035692 | Bacteria | 2300 |
| 464 | Ga0373935_0108637 | 3300035692 | Bacteria | 1838 |
| 465 | Ga0373935_0115055 | 3300035692 | Bacteria | 1790 |
| 466 | Ga0373935_0162037 | 3300035692 | Bacteria | 1525 |
| 467 | Ga0373935_0172754 | 3300035692 | Bacteria | 1479 |
| 468 | Ga0373935_0301782 | 3300035692 | Bacteria | 1132 |
| 469 | Ga0373935_0338117 | 3300035692 | Bacteria | 1071 |
| 470 | Ga0373935_0714454 | 3300035692 | Bacteria | 737 |
| 471 | Ga0373927_0001149 | 3300035695 | Bacteria | 20019 |
| 472 | Ga0373927_0119516 | 3300035695 | Bacteria | 1720 |
| 473 | Ga0373927_0305653 | 3300035695 | Bacteria | 1047 |
| 474 | Ga0373927_0632414 | 3300035695 | Bacteria | 707 |
| 475 | Ga0373933_0022155 | 3300035724 | Bacteria | 3615 |
| 476 | Ga0373933_0027702 | 3300035724 | Bacteria | 3265 |
| 477 | Ga0373933_0064796 | 3300035724 | Bacteria | 2211 |
| 478 | Ga0373933_0069325 | 3300035724 | Bacteria | 2143 |
| 479 | Ga0373933_0092779 | 3300035724 | Bacteria | 1865 |
| 480 | Ga0373933_0146538 | 3300035724 | Bacteria | 1493 |
| 481 | Ga0373933_0691026 | 3300035724 | Bacteria | 671 |
| 482 | Ga0373947_0001353 | 3300035725 | Bacteria | 15060 |
| 483 | Ga0373947_0134832 | 3300035725 | Bacteria | 1579 |
| 484 | Ga0373947_0152013 | 3300035725 | Bacteria | 1491 |
| 485 | Ga0373947_0166958 | 3300035725 | Bacteria | 1426 |
| 486 | Ga0373947_0272575 | 3300035725 | Bacteria | 1124 |
| 487 | Ga0373947_0965327 | 3300035725 | Unclassified | 581 |
| 488 | Ga0373937_0011317 | 3300036401 | Bacteria | 7826 |
| 489 | Ga0373937_0032242 | 3300036401 | Bacteria | 4752 |
| 490 | Ga0373937_0086746 | 3300036401 | Bacteria | 2896 |
| 491 | Ga0373937_0117827 | 3300036401 | Bacteria | 2473 |
| 492 | Ga0373937_0256873 | 3300036401 | Bacteria | 1647 |
| 493 | Ga0373937_0285143 | 3300036401 | Bacteria | 1560 |
| 494 | Ga0373937_0415784 | 3300036401 | Bacteria | 1276 |
| 495 | Ga0373937_0440746 | 3300036401 | Bacteria | 1236 |
| 496 | Ga0373937_0537434 | 3300036401 | Bacteria | 1110 |
| 497 | Ga0373937_1263825 | 3300036401 | Bacteria | 686 |
| 498 | Ga0373937_1472286 | 3300036401 | Bacteria | 628 |
| 499 | Ga0373925_0001645 | 3300037068 | Bacteria | 18825 |
| 500 | Ga0373925_0009491 | 3300037068 | Bacteria | 7084 |
| 501 | Ga0373925_0073847 | 3300037068 | Bacteria | 2582 |
| 502 | Ga0373925_0093578 | 3300037068 | Bacteria | 2300 |
| 503 | Ga0373925_0098762 | 3300037068 | Bacteria | 2241 |
| 504 | Ga0373925_0105445 | 3300037068 | Bacteria | 2172 |
| 505 | Ga0373925_0181000 | 3300037068 | Bacteria | 1668 |
| 506 | Ga0373925_0811192 | 3300037068 | Bacteria | 771 |
| 507 | Ga0373925_0937887 | 3300037068 | Bacteria | 713 |
| 508 | Ga0395899_0396967 | 3300037312 | Bacteria | 913 |
| 509 | Ga0395900_0033533 | 3300037418 | Bacteria | 5284 |
| 510 | Ga0395905_0093003 | 3300037471 | Bacteria | 2828 |
| 511 | Ga0436364_1413397 | 3300037853 | Bacteria | 702 |
| 512 | Ga0395901_0029425 | 3300038443 | Bacteria | 5656 |
| 513 | Ga0439448_0373351 | 3300042005 | Bacteria | 509 |
| 514 | Ga0466963_0192694 | 3300044694 | Bacteria | 1424 |
| 515 | Ga0466963_1292076 | 3300044694 | Bacteria | 512 |
| 516 | Ga0466957_0140844 | 3300044842 | Bacteria | 1554 |
| 517 | Ga0466958_0747791 | 3300045836 | Bacteria | 637 |
| 518 | Ga0466958_0815322 | 3300045836 | Bacteria | 609 |
| 519 | Ga0466967_0255862 | 3300045976 | Bacteria | 1674 |
| 520 | Ga0466967_0423951 | 3300045976 | Bacteria | 1297 |
| 521 | Ga0466967_0437971 | 3300045976 | Bacteria | 1276 |
| 522 | Ga0466967_1103995 | 3300045976 | Bacteria | 790 |
| 523 | Ga0466967_1216645 | 3300045976 | Unclassified | 750 |
| 524 | Ga0495592_0013547 | 3300046454 | Bacteria | 6204 |
| 525 | Ga0495592_0017235 | 3300046454 | Bacteria | 5486 |
| 526 | Ga0495592_0029645 | 3300046454 | Bacteria | 4143 |
| 527 | Ga0495592_0092184 | 3300046454 | Bacteria | 2172 |
| 528 | Ga0495592_0115409 | 3300046454 | Bacteria | 1895 |
| 529 | Ga0495592_0129204 | 3300046454 | Bacteria | 1769 |
| 530 | Ga0495592_0216229 | 3300046454 | Bacteria | 1284 |
| 531 | Ga0495592_0939318 | 3300046454 | Unclassified | 506 |
| 532 | Ga0495603_0014154 | 3300046455 | Bacteria | 4827 |
| 533 | Ga0495603_0304889 | 3300046455 | Bacteria | 915 |
| 534 | Ga0495603_0516729 | 3300046455 | Bacteria | 684 |
| 535 | Ga0495629_0035792 | 3300046459 | Bacteria | 3507 |
| 536 | Ga0495629_0248084 | 3300046459 | Bacteria | 1225 |
| 537 | Ga0495629_0431903 | 3300046459 | Bacteria | 893 |
| 538 | Ga0495641_0014615 | 3300046461 | Bacteria | 4239 |
| 539 | Ga0495641_0340410 | 3300046461 | Unclassified | 678 |
| 540 | Ga0495651_0000219 | 3300046462 | Bacteria | 43615 |
| 541 | Ga0495651_0002922 | 3300046462 | Bacteria | 13231 |
| 542 | Ga0495651_0003561 | 3300046462 | Bacteria | 11944 |
| 543 | Ga0495651_0018139 | 3300046462 | Bacteria | 5449 |
| 544 | Ga0495651_0041407 | 3300046462 | Bacteria | 3578 |
| 545 | Ga0495651_0046397 | 3300046462 | Bacteria | 3362 |
| 546 | Ga0495651_0072622 | 3300046462 | Bacteria | 2613 |
| 547 | Ga0495651_0158669 | 3300046462 | Bacteria | 1623 |
| 548 | Ga0495651_0576224 | 3300046462 | Bacteria | 712 |
| 549 | Ga0495653_0000581 | 3300046463 | Bacteria | 28083 |
| 550 | Ga0495653_0011940 | 3300046463 | Bacteria | 7094 |
| 551 | Ga0495653_0028985 | 3300046463 | Bacteria | 4424 |
| 552 | Ga0495653_0035637 | 3300046463 | Bacteria | 3924 |
| 553 | Ga0495653_0036829 | 3300046463 | Bacteria | 3850 |
| 554 | Ga0495653_0046938 | 3300046463 | Bacteria | 3342 |
| 555 | Ga0495653_0047426 | 3300046463 | Bacteria | 3322 |
| 556 | Ga0495653_0132975 | 3300046463 | Bacteria | 1758 |
| 557 | Ga0495653_0142083 | 3300046463 | Bacteria | 1687 |
| 558 | Ga0495653_0314873 | 3300046463 | Bacteria | 1016 |
| 559 | Ga0495580_0850244 | 3300046472 | Bacteria | 589 |
| 560 | Ga0495582_0022670 | 3300046473 | Bacteria | 3436 |
| 561 | Ga0495582_0099556 | 3300046473 | Bacteria | 1627 |
| 562 | Ga0495639_0367910 | 3300046475 | Bacteria | 723 |
| 563 | Ga0495639_0711675 | 3300046475 | Bacteria | 519 |
| 564 | Ga0495662_0038398 | 3300046476 | Bacteria | 2314 |
| 565 | Ga0495662_0118890 | 3300046476 | Bacteria | 1297 |
| 566 | Ga0495662_0146818 | 3300046476 | Bacteria | 1161 |
| 567 | Ga0495662_0157578 | 3300046476 | Bacteria | 1118 |
| 568 | Ga0495662_0198729 | 3300046476 | Bacteria | 988 |
| 569 | Ga0495662_0261760 | 3300046476 | Bacteria | 851 |
| 570 | Ga0495664_0000070 | 3300046477 | Bacteria | 49408 |
| 571 | Ga0495664_0017539 | 3300046477 | Bacteria | 4094 |
| 572 | Ga0495664_0039715 | 3300046477 | Bacteria | 2781 |
| 573 | Ga0495664_0116725 | 3300046477 | Bacteria | 1613 |
| 574 | Ga0495664_0153389 | 3300046477 | Bacteria | 1397 |
| 575 | Ga0495664_0171885 | 3300046477 | Bacteria | 1314 |
| 576 | Ga0495664_0260402 | 3300046477 | Unclassified | 1049 |
| 577 | Ga0495664_0303149 | 3300046477 | Bacteria | 964 |
| 578 | Ga0495664_0372151 | 3300046477 | Unclassified | 859 |
| 579 | Ga0495664_0374471 | 3300046477 | Bacteria | 856 |
| 580 | Ga0495608_0001473 | 3300046511 | Bacteria | 16725 |
| 581 | Ga0495608_0018980 | 3300046511 | Bacteria | 4738 |
| 582 | Ga0495608_0025514 | 3300046511 | Bacteria | 4035 |
| 583 | Ga0495608_0030159 | 3300046511 | Bacteria | 3674 |
| 584 | Ga0495608_0055399 | 3300046511 | Bacteria | 2620 |
| 585 | Ga0495608_0073340 | 3300046511 | Bacteria | 2232 |
| 586 | Ga0495608_0116953 | 3300046511 | Bacteria | 1711 |
| 587 | Ga0495608_0828171 | 3300046511 | Bacteria | 545 |
| 588 | Ga0495618_0010668 | 3300046514 | Bacteria | 5561 |
| 589 | Ga0495618_0049813 | 3300046514 | Bacteria | 2645 |
| 590 | Ga0495618_0061596 | 3300046514 | Bacteria | 2380 |
| 591 | Ga0495618_0092011 | 3300046514 | Bacteria | 1939 |
| 592 | Ga0495618_0108969 | 3300046514 | Bacteria | 1773 |
| 593 | Ga0495618_0176978 | 3300046514 | Bacteria | 1356 |
| 594 | Ga0495618_0515086 | 3300046514 | Bacteria | 720 |
| 595 | Ga0495618_0609103 | 3300046514 | Unclassified | 649 |
| 596 | Ga0495628_0003712 | 3300046516 | Bacteria | 13599 |
| 597 | Ga0495628_0024166 | 3300046516 | Bacteria | 4977 |
| 598 | Ga0495628_0034738 | 3300046516 | Bacteria | 4054 |
| 599 | Ga0495628_0168699 | 3300046516 | Bacteria | 1660 |
| 600 | Ga0495628_0246178 | 3300046516 | Bacteria | 1336 |
| 601 | Ga0495628_0246698 | 3300046516 | Bacteria | 1334 |
| 602 | Ga0495628_0509362 | 3300046516 | Bacteria | 868 |
| 603 | Ga0495630_0003832 | 3300046517 | Bacteria | 10494 |
| 604 | Ga0495630_0020865 | 3300046517 | Bacteria | 4835 |
| 605 | Ga0495630_0052015 | 3300046517 | Bacteria | 3066 |
| 606 | Ga0495630_0096972 | 3300046517 | Bacteria | 2229 |
| 607 | Ga0495630_0415197 | 3300046517 | Unclassified | 1031 |
| 608 | Ga0495666_0176710 | 3300046526 | Bacteria | 987 |
| 609 | Ga0495666_0208721 | 3300046526 | Bacteria | 896 |
| 610 | Ga0495666_0221381 | 3300046526 | Bacteria | 867 |
| 611 | Ga0495652_0003955 | 3300046529 | Bacteria | 14362 |
| 612 | Ga0495652_0011979 | 3300046529 | Bacteria | 7837 |
| 613 | Ga0495652_0027003 | 3300046529 | Bacteria | 5063 |
| 614 | Ga0495652_0034261 | 3300046529 | Bacteria | 4427 |
| 615 | Ga0495652_0110229 | 3300046529 | Bacteria | 2214 |
| 616 | Ga0495652_0265339 | 3300046529 | Bacteria | 1265 |
| 617 | Ga0495652_0276274 | 3300046529 | Bacteria | 1232 |
| 618 | Ga0495652_0326322 | 3300046529 | Bacteria | 1107 |
| 619 | Ga0495652_0365232 | 3300046529 | Bacteria | 1030 |
| 620 | Ga0495652_0379247 | 3300046529 | Bacteria | 1006 |
| 621 | Ga0495652_0441475 | 3300046529 | Bacteria | 913 |
| 622 | Ga0495652_0823949 | 3300046529 | Bacteria | 616 |
| 623 | Ga0495665_0009934 | 3300046531 | Bacteria | 5153 |
| 624 | Ga0495665_0017630 | 3300046531 | Bacteria | 3840 |
| 625 | Ga0495665_0099107 | 3300046531 | Bacteria | 1530 |
| 626 | Ga0495665_0265488 | 3300046531 | Bacteria | 882 |
| 627 | Ga0495665_0665499 | 3300046531 | Bacteria | 518 |
| 628 | Ga0495640_0004917 | 3300046533 | Bacteria | 10619 |
| 629 | Ga0495640_0007086 | 3300046533 | Bacteria | 8823 |
| 630 | Ga0495640_0026266 | 3300046533 | Bacteria | 4210 |
| 631 | Ga0495640_0117023 | 3300046533 | Bacteria | 1736 |
| 632 | Ga0495640_0118442 | 3300046533 | Bacteria | 1723 |
| 633 | Ga0495640_0200335 | 3300046533 | Bacteria | 1265 |
| 634 | Ga0495586_0053880 | 3300046535 | Bacteria | 2179 |
| 635 | Ga0495586_0110544 | 3300046535 | Bacteria | 1529 |
| 636 | Ga0495586_0311735 | 3300046535 | Bacteria | 902 |
| 637 | Ga0495586_0573312 | 3300046535 | Bacteria | 652 |
| 638 | Ga0495587_0004757 | 3300046536 | Bacteria | 8913 |
| 639 | Ga0495587_0015588 | 3300046536 | Bacteria | 4741 |
| 640 | Ga0495587_0024591 | 3300046536 | Bacteria | 3689 |
| 641 | Ga0495587_0062202 | 3300046536 | Bacteria | 2186 |
| 642 | Ga0495587_0280150 | 3300046536 | Bacteria | 934 |
| 643 | Ga0495587_0400210 | 3300046536 | Unclassified | 763 |
| 644 | Ga0495587_0406547 | 3300046536 | Unclassified | 756 |
| 645 | Ga0495587_0460124 | 3300046536 | Bacteria | 704 |
| 646 | Ga0495645_0007226 | 3300046543 | Bacteria | 7729 |
| 647 | Ga0495645_0018561 | 3300046543 | Bacteria | 4997 |
| 648 | Ga0495645_0077790 | 3300046543 | Bacteria | 2385 |
| 649 | Ga0495645_0088327 | 3300046543 | Bacteria | 2217 |
| 650 | Ga0495645_0131406 | 3300046543 | Bacteria | 1754 |
| 651 | Ga0495645_0168415 | 3300046543 | Bacteria | 1509 |
| 652 | Ga0495667_0003183 | 3300046559 | Bacteria | 11008 |
| 653 | Ga0495667_0003646 | 3300046559 | Bacteria | 10362 |
| 654 | Ga0495667_0004238 | 3300046559 | Bacteria | 9663 |
| 655 | Ga0495667_0007051 | 3300046559 | Bacteria | 7627 |
| 656 | Ga0495667_0021133 | 3300046559 | Bacteria | 4390 |
| 657 | Ga0495667_0028136 | 3300046559 | Bacteria | 3784 |
| 658 | Ga0495667_0032304 | 3300046559 | Bacteria | 3509 |
| 659 | Ga0495667_0110845 | 3300046559 | Bacteria | 1773 |
| 660 | Ga0495667_0180061 | 3300046559 | Bacteria | 1356 |
| 661 | Ga0495634_0014688 | 3300046642 | Bacteria | 5638 |
| 662 | Ga0495634_0019503 | 3300046642 | Bacteria | 4817 |
| 663 | Ga0495634_0038862 | 3300046642 | Bacteria | 3243 |
| 664 | Ga0495634_0112100 | 3300046642 | Bacteria | 1753 |
| 665 | Ga0495634_0125875 | 3300046642 | Bacteria | 1637 |
| 666 | Ga0495634_0163198 | 3300046642 | Bacteria | 1404 |
| 667 | Ga0495634_0511901 | 3300046642 | Bacteria | 703 |
| 668 | Ga0495635_0000245 | 3300046663 | Bacteria | 34481 |
| 669 | Ga0495635_0005856 | 3300046663 | Bacteria | 8567 |
| 670 | Ga0495635_0032210 | 3300046663 | Bacteria | 3637 |
| 671 | Ga0495635_0041452 | 3300046663 | Bacteria | 3179 |
| 672 | Ga0495635_0049212 | 3300046663 | Bacteria | 2905 |
| 673 | Ga0495635_0073536 | 3300046663 | Bacteria | 2341 |
| 674 | Ga0495635_0085370 | 3300046663 | Bacteria | 2160 |
| 675 | Ga0495635_0214674 | 3300046663 | Bacteria | 1302 |
| 676 | Ga0495635_0424502 | 3300046663 | Bacteria | 881 |
| 677 | Ga0495657_0003887 | 3300046675 | Bacteria | 12028 |
| 678 | Ga0495657_0005749 | 3300046675 | Bacteria | 9766 |
| 679 | Ga0495657_0025591 | 3300046675 | Bacteria | 4189 |
| 680 | Ga0495657_0033951 | 3300046675 | Bacteria | 3547 |
| 681 | Ga0495657_0035011 | 3300046675 | Bacteria | 3484 |
| 682 | Ga0495657_0039933 | 3300046675 | Bacteria | 3222 |
| 683 | Ga0495657_0140858 | 3300046675 | Bacteria | 1503 |
| 684 | Ga0495657_0222891 | 3300046675 | Unclassified | 1142 |
| 685 | Ga0495657_0493848 | 3300046675 | Bacteria | 714 |
| 686 | Ga0495657_0565668 | 3300046675 | Bacteria | 659 |
| 687 | Ga0495599_0000277 | 3300046678 | Bacteria | 31616 |
| 688 | Ga0495599_0012371 | 3300046678 | Bacteria | 5257 |
| 689 | Ga0495599_0014608 | 3300046678 | Bacteria | 4864 |
| 690 | Ga0495599_0029207 | 3300046678 | Bacteria | 3456 |
| 691 | Ga0495599_0038236 | 3300046678 | Bacteria | 3015 |
| 692 | Ga0495599_0064061 | 3300046678 | Bacteria | 2296 |
| 693 | Ga0495599_0075893 | 3300046678 | Bacteria | 2099 |
| 694 | Ga0495599_0127304 | 3300046678 | Bacteria | 1583 |
| 695 | Ga0495599_0262228 | 3300046678 | Bacteria | 1049 |
| 696 | Ga0495599_0756415 | 3300046678 | Bacteria | 557 |
| 697 | Ga0495623_0015284 | 3300046679 | Bacteria | 4960 |
| 698 | Ga0495623_0017592 | 3300046679 | Bacteria | 4615 |
| 699 | Ga0495623_0099933 | 3300046679 | Bacteria | 1769 |
| 700 | Ga0495623_0131225 | 3300046679 | Bacteria | 1500 |
| 701 | Ga0495623_0515714 | 3300046679 | Bacteria | 629 |
| 702 | Ga0495646_0007950 | 3300046680 | Bacteria | 6739 |
| 703 | Ga0495646_0029971 | 3300046680 | Bacteria | 3398 |
| 704 | Ga0495646_0030872 | 3300046680 | Bacteria | 3343 |
| 705 | Ga0495646_0110955 | 3300046680 | Bacteria | 1562 |
| 706 | Ga0495646_0349941 | 3300046680 | Bacteria | 774 |
| 707 | Ga0495658_0121474 | 3300046683 | Bacteria | 1580 |
| 708 | Ga0495658_0680573 | 3300046683 | Bacteria | 659 |
| 709 | Ga0495613_0188756 | 3300046689 | Bacteria | 1457 |
| 710 | Ga0495613_0267778 | 3300046689 | Bacteria | 1189 |
| 711 | Ga0495613_0469472 | 3300046689 | Bacteria | 850 |
| 712 | Ga0495613_0536519 | 3300046689 | Bacteria | 784 |
| 713 | Ga0495613_0556129 | 3300046689 | Bacteria | 767 |
| 714 | Ga0495624_0000293 | 3300046690 | Bacteria | 39469 |
| 715 | Ga0495624_0036399 | 3300046690 | Bacteria | 3173 |
| 716 | Ga0495624_0167212 | 3300046690 | Bacteria | 1342 |
| 717 | Ga0495624_0330829 | 3300046690 | Bacteria | 917 |
| 718 | Ga0495600_0008485 | 3300046809 | Bacteria | 6314 |
| 719 | Ga0495600_0009172 | 3300046809 | Bacteria | 6102 |
| 720 | Ga0495600_0025036 | 3300046809 | Bacteria | 3844 |
| 721 | Ga0495600_0155209 | 3300046809 | Bacteria | 1481 |
| 722 | Ga0495600_0576853 | 3300046809 | Bacteria | 685 |
| 723 | Ga0495600_0611303 | 3300046809 | Bacteria | 661 |
| 724 | Ga0495581_0048017 | 3300047315 | Bacteria | 2466 |
| 725 | Ga0495581_0102793 | 3300047315 | Bacteria | 1660 |
| 726 | Ga0495581_0500185 | 3300047315 | Bacteria | 707 |
| 727 | Ga0495604_0004852 | 3300047317 | Bacteria | 10654 |
| 728 | Ga0495604_0041489 | 3300047317 | Bacteria | 3609 |
| 729 | Ga0495604_0102450 | 3300047317 | Bacteria | 2101 |
| 730 | Ga0495604_0183439 | 3300047317 | Unclassified | 1463 |
| 731 | Ga0495604_0226525 | 3300047317 | Bacteria | 1284 |
| 732 | Ga0495604_0329763 | 3300047317 | Bacteria | 1018 |
| 733 | Ga0495674_0000077 | 3300047319 | Bacteria | 66642 |
| 734 | Ga0495674_0009167 | 3300047319 | Bacteria | 9404 |
| 735 | Ga0495674_0020902 | 3300047319 | Bacteria | 6059 |
| 736 | Ga0495674_0043775 | 3300047319 | Bacteria | 3982 |
| 737 | Ga0495674_0065462 | 3300047319 | Bacteria | 3156 |
| 738 | Ga0495674_0080416 | 3300047319 | Bacteria | 2797 |
| 739 | Ga0495674_0087783 | 3300047319 | Bacteria | 2661 |
| 740 | Ga0495674_0143432 | 3300047319 | Bacteria | 2006 |
| 741 | Ga0495674_0174931 | 3300047319 | Bacteria | 1789 |
| 742 | Ga0495674_0346068 | 3300047319 | Bacteria | 1207 |
| 743 | Ga0495676_0003089 | 3300047321 | Bacteria | 15064 |
| 744 | Ga0495676_0096480 | 3300047321 | Bacteria | 2198 |
| 745 | Ga0495676_0131474 | 3300047321 | Bacteria | 1806 |
| 746 | Ga0495676_0243138 | 3300047321 | Bacteria | 1231 |
| 747 | Ga0495676_0411016 | 3300047321 | Bacteria | 897 |
| 748 | Ga0495676_0890802 | 3300047321 | Bacteria | 570 |
| 749 | Ga0495680_0002138 | 3300047322 | Bacteria | 20519 |
| 750 | Ga0495680_0004141 | 3300047322 | Bacteria | 13942 |
| 751 | Ga0495680_0005088 | 3300047322 | Bacteria | 12406 |
| 752 | Ga0495680_0008741 | 3300047322 | Bacteria | 9174 |
| 753 | Ga0495680_0009458 | 3300047322 | Bacteria | 8764 |
| 754 | Ga0495680_0035807 | 3300047322 | Bacteria | 3992 |
| 755 | Ga0495680_0083378 | 3300047322 | Bacteria | 2411 |
| 756 | Ga0495680_0124595 | 3300047322 | Bacteria | 1899 |
| 757 | Ga0495680_0137994 | 3300047322 | Bacteria | 1786 |
| 758 | Ga0495680_0182197 | 3300047322 | Bacteria | 1515 |
| 759 | Ga0495680_0223413 | 3300047322 | Bacteria | 1343 |
| 760 | Ga0495675_0015406 | 3300047444 | Bacteria | 4836 |
| 761 | Ga0495675_0026826 | 3300047444 | Bacteria | 3672 |
| 762 | Ga0495675_0098383 | 3300047444 | Bacteria | 1833 |
| 763 | Ga0495675_0174338 | 3300047444 | Bacteria | 1319 |
| 764 | Ga0495675_0218049 | 3300047444 | Bacteria | 1156 |
| 765 | Ga0495675_0446087 | 3300047444 | Bacteria | 749 |
| 766 | Ga0495675_0540785 | 3300047444 | Bacteria | 665 |
| 767 | Ga0495675_0746975 | 3300047444 | Bacteria | 545 |
| 768 | Ga0495684_0001743 | 3300047471 | Bacteria | 17491 |
| 769 | Ga0495684_0002148 | 3300047471 | Bacteria | 15802 |
| 770 | Ga0495684_0007535 | 3300047471 | Bacteria | 8422 |
| 771 | Ga0495684_0029831 | 3300047471 | Bacteria | 4186 |
| 772 | Ga0495684_0038090 | 3300047471 | Bacteria | 3687 |
| 773 | Ga0495684_0133621 | 3300047471 | Bacteria | 1862 |
| 774 | Ga0495684_0306051 | 3300047471 | Bacteria | 1140 |
| 775 | Ga0495684_0368086 | 3300047471 | Bacteria | 1016 |
| 776 | Ga0495593_0035201 | 3300047673 | Bacteria | 2720 |
| 777 | Ga0495593_0074195 | 3300047673 | Bacteria | 1764 |
| 778 | Ga0495593_0114883 | 3300047673 | Bacteria | 1373 |
| 779 | Ga0495593_0364295 | 3300047673 | Bacteria | 722 |
| 780 | Ga0495602_0019243 | 3300048088 | Bacteria | 6787 |
| 781 | Ga0495602_0045736 | 3300048088 | Bacteria | 3959 |
| 782 | Ga0495602_0064967 | 3300048088 | Bacteria | 3152 |
| 783 | Ga0495602_0065730 | 3300048088 | Bacteria | 3128 |
| 784 | Ga0495602_0325163 | 3300048088 | Bacteria | 1117 |
| 785 | Ga0495602_0412075 | 3300048088 | Bacteria | 961 |
| 786 | Ga0495602_0514836 | 3300048088 | Bacteria | 834 |
| 787 | Ga0495602_1029741 | 3300048088 | Bacteria | 542 |
| 788 | Ga0496100_0040360 | 3300048903 | Bacteria | 2969 |
| 789 | Ga0496101_0415890 | 3300048904 | Bacteria | 1060 |
| 790 | Ga0496102_0009241 | 3300048905 | Bacteria | 8457 |
| 791 | Ga0496103_0139019 | 3300048906 | Bacteria | 1553 |
| 792 | Ga0496103_0720137 | 3300048906 | Bacteria | 632 |
| 793 | Ga0496104_0041732 | 3300048907 | Bacteria | 4303 |
| 794 | Ga0496104_0526263 | 3300048907 | Bacteria | 1093 |
| 795 | Ga0496104_0969902 | 3300048907 | Unclassified | 754 |
| 796 | Ga0496104_1817385 | 3300048907 | Unclassified | 511 |
| 797 | Ga0496105_0026386 | 3300048908 | Bacteria | 4738 |
| 798 | Ga0496106_0031500 | 3300048909 | Bacteria | 3952 |
| 799 | Ga0496106_1315574 | 3300048909 | Bacteria | 561 |
| 800 | Ga0496108_0048182 | 3300048911 | Bacteria | 3562 |
| 801 | Ga0496108_0071857 | 3300048911 | Bacteria | 2920 |
| 802 | Ga0496108_0165677 | 3300048911 | Bacteria | 1911 |
| 803 | Ga0496109_0143715 | 3300048912 | Bacteria | 2231 |
| 804 | Ga0496109_0164059 | 3300048912 | Bacteria | 2082 |
| 805 | Ga0496109_0673708 | 3300048912 | Bacteria | 972 |
| 806 | Ga0496110_0070917 | 3300048913 | Bacteria | 3088 |
| 807 | Ga0496110_0710798 | 3300048913 | Bacteria | 907 |
| 808 | Ga0496111_0032517 | 3300048914 | Bacteria | 3720 |
| 809 | Ga0496112_0000716 | 3300048915 | Bacteria | 23026 |
| 810 | Ga0496112_0068165 | 3300048915 | Bacteria | 3513 |
| 811 | Ga0496113_0083410 | 3300048916 | Bacteria | 2452 |
| 812 | Ga0496113_0107032 | 3300048916 | Bacteria | 2172 |
| 813 | Ga0496113_1518550 | 3300048916 | Unclassified | 517 |
| 814 | Ga0496114_0406736 | 3300048917 | Bacteria | 1205 |
| 815 | Ga0496114_0599102 | 3300048917 | Bacteria | 972 |
| 816 | Ga0496115_0009924 | 3300048918 | Bacteria | 7093 |
| 817 | Ga0496115_0010462 | 3300048918 | Bacteria | 6933 |
| 818 | Ga0496115_1158805 | 3300048918 | Unclassified | 583 |
| 819 | Ga0496115_1346958 | 3300048918 | Unclassified | 529 |
| 820 | Ga0496126_0000022 | 3300048929 | Bacteria | 464393 |
| 821 | Ga0496126_0018518 | 3300048929 | Bacteria | 6896 |
| 822 | Ga0496126_0474581 | 3300048929 | Bacteria | 1003 |
| 823 | Ga0496126_1068794 | 3300048929 | Bacteria | 601 |
| 824 | nmdc:mga0n895_156388_c1 | 3300050512 | Bacteria | 2310 |
| 825 | nmdc:mga0n895_909180_c1 | 3300050512 | Bacteria | 865 |
| 826 | nmdc:mga0n895_979211_c1 | 3300050512 | Bacteria | 828 |
| 827 | nmdc:mga0rr50_1378686_c1 | 3300050513 | Bacteria | 597 |
| 828 | nmdc:mga0rr50_417566_c1 | 3300050513 | Bacteria | 1134 |
| 829 | nmdc:mga0rr50_793053_c1 | 3300050513 | Bacteria | 808 |
| 830 | nmdc:mga08x19_188435_c1 | 3300050514 | Bacteria | 1410 |
| 831 | Ga0495601_0083606 | 3300053077 | Bacteria | 2050 |
| 832 | Ga0495601_0109228 | 3300053077 | Bacteria | 1790 |
| 833 | Ga0495601_0215748 | 3300053077 | Bacteria | 1253 |
| 834 | Ga0495601_0281564 | 3300053077 | Bacteria | 1084 |
| 835 | Ga0495601_0289971 | 3300053077 | Bacteria | 1067 |
| 836 | Ga0495601_0771187 | 3300053077 | Bacteria | 611 |
| 837 | Ga0495601_1077394 | 3300053077 | Bacteria | 503 |
| 838 | Ga0495612_0336290 | 3300053078 | Bacteria | 680 |
| 839 | Ga0495612_0343023 | 3300053078 | Bacteria | 674 |
| 840 | Ga0495595_0001760 | 3300053084 | Bacteria | 8466 |
| 841 | Ga0495595_0162550 | 3300053084 | Bacteria | 1102 |
| 842 | Ga0495595_0455837 | 3300053084 | Bacteria | 650 |
| 843 | Ga0495595_0727195 | 3300053084 | Bacteria | 509 |
| 844 | Ga0495619_0061284 | 3300053085 | Bacteria | 2503 |
| 845 | Ga0495619_0176751 | 3300053085 | Bacteria | 1477 |
| 846 | Ga0495619_0196066 | 3300053085 | Bacteria | 1398 |
| 847 | Ga0495619_0207049 | 3300053085 | Bacteria | 1358 |
| 848 | Ga0495619_0921118 | 3300053085 | Bacteria | 587 |
| 849 | Ga0070666_10789076 | |||
| 850 | Ga0070683_100033360 | |||
| 851 | Ga0070682_100063307 | |||
| 852 | Ga0070682_100129337 | |||
| 853 | Ga0070682_100480481 | |||
| 854 | Ga0068868_100131874 | |||
| 855 | Ga0068868_100245461 | |||
| 856 | Ga0070660_100400106 | |||
| 857 | Ga0070660_101038396 | |||
| 858 | Ga0070687_100526423 | |||
| 859 | Ga0070661_100003455 | |||
| 860 | Ga0070661_101217977 | |||
| 861 | Ga0070692_10119236 | |||
| 862 | Ga0070675_101741108 | |||
| 863 | Ga0070659_100272528 | |||
| 864 | Ga0070709_10003440 | |||
| 865 | Ga0070709_10031163 | |||
| 866 | Ga0070709_10063590 | |||
| 867 | Ga0070709_10109719 | |||
| 868 | Ga0070709_10935912 | |||
| 869 | Ga0070714_100025916 | |||
| 870 | Ga0070714_100034826 | |||
| 871 | Ga0070714_100038801 | |||
| 872 | Ga0070714_100045593 | |||
| 873 | Ga0070714_100048787 | |||
| 874 | Ga0070714_100109834 | |||
| 875 | Ga0070714_100132173 | |||
| 876 | Ga0070714_100136282 | |||
| 877 | Ga0070714_100235133 | |||
| 878 | Ga0070714_100451173 | |||
| 879 | Ga0070714_101108199 | |||
| 880 | Ga0070714_101196967 | |||
| 881 | Ga0070714_101217329 | |||
| 882 | Ga0070714_101517932 | |||
| 883 | Ga0070714_101847489 | |||
| 884 | Ga0070714_101859840 | |||
| 885 | Ga0070713_100009184 | |||
| 886 | Ga0070713_100037889 | |||
| 887 | Ga0070713_100042753 | |||
| 888 | Ga0070713_100050924 | |||
| 889 | Ga0070713_100107723 | |||
| 890 | Ga0070713_100233861 | |||
| 891 | Ga0070713_100278995 | |||
| 892 | Ga0070713_100292103 | |||
| 893 | Ga0070713_100375463 | |||
| 894 | Ga0070713_100690706 | |||
| 895 | Ga0070713_100900642 | |||
| 896 | Ga0070713_100957689 | |||
| 897 | Ga0070710_10033148 | |||
| 898 | Ga0070710_10048485 | |||
| 899 | Ga0070710_10053165 | |||
| 900 | Ga0070710_10098825 | |||
| 901 | Ga0070710_10273435 | |||
| 902 | Ga0070710_10380989 | |||
| 903 | Ga0070710_10443183 | |||
| 904 | Ga0070710_11223238 | |||
| 905 | Ga0070710_11424781 | |||
| 906 | Ga0070711_100015364 | |||
| 907 | Ga0070711_100040774 | |||
| 908 | Ga0070711_100052013 | |||
| 909 | Ga0070711_100056034 | |||
| 910 | Ga0070711_100142479 | |||
| 911 | Ga0070711_100232692 | |||
| 912 | Ga0070711_100333217 | |||
| 913 | Ga0070711_100530995 | |||
| 914 | Ga0070711_100886973 | |||
| 915 | Ga0070694_101166667 | |||
| 916 | Ga0070708_100520534 | |||
| 917 | Ga0070708_100802365 | |||
| 918 | Ga0070663_100106128 | |||
| 919 | Ga0070663_100347748 | |||
| 920 | Ga0070678_100564278 | |||
| 921 | Ga0070662_100716429 | |||
| 922 | Ga0070681_10040497 | |||
| 923 | Ga0070681_10110473 | |||
| 924 | Ga0070681_10768657 | |||
| 925 | Ga0070681_11043108 | |||
| 926 | Ga0070706_100518393 | |||
| 927 | Ga0070706_100801068 | |||
| 928 | Ga0070706_100832181 | |||
| 929 | Ga0070706_100897173 | |||
| 930 | Ga0070707_100099434 | |||
| 931 | Ga0070707_100116517 | |||
| 932 | Ga0070698_100010599 | |||
| 933 | Ga0070698_100130250 | |||
| 934 | Ga0070698_100219741 | |||
| 935 | Ga0070684_100130036 | |||
| 936 | Ga0070684_100330598 | |||
| 937 | Ga0070684_100420881 | |||
| 938 | Ga0070684_101819838 | |||
| 939 | Ga0070697_100068065 | |||
| 940 | Ga0070697_100756518 | |||
| 941 | Ga0068853_100955656 | |||
| 942 | Ga0068853_101031384 | |||
| 943 | Ga0070695_100406868 | |||
| 944 | Ga0070695_100835184 | |||
| 945 | Ga0070665_100013044 | |||
| 946 | Ga0070665_100035520 | |||
| 947 | Ga0070665_100622861 | |||
| 948 | Ga0070704_100107928 | |||
| 949 | Ga0068855_100063832 | |||
| 950 | Ga0068855_100201909 | |||
| 951 | Ga0068855_100606667 | |||
| 952 | Ga0068855_101434677 | |||
| 953 | Ga0068855_102565656 | |||
| 954 | Ga0070664_102007938 | |||
| 955 | Ga0068857_100059922 | |||
| 956 | Ga0068857_101881379 | |||
| 957 | Ga0068856_100015593 | |||
| 958 | Ga0068856_100031822 | |||
| 959 | Ga0068856_100051473 | |||
| 960 | Ga0068856_100308304 | |||
| 961 | Ga0068856_100811921 | |||
| 962 | Ga0070702_100157582 | |||
| 963 | Ga0068852_100474687 | |||
| 964 | Ga0068852_100738402 | |||
| 965 | Ga0068864_100093479 | |||
| 966 | Ga0068864_100770736 | |||
| 967 | Ga0068863_100029140 | |||
| 968 | Ga0068863_100293955 | |||
| 969 | Ga0068863_101641612 | |||
| 970 | Ga0068858_100110114 | |||
| 971 | Ga0068858_101284392 | |||
| 972 | Ga0068860_100525402 | |||
| 973 | Ga0070717_10013942 | |||
| 974 | Ga0070717_10022806 | |||
| 975 | Ga0070717_10120463 | |||
| 976 | Ga0070717_10226904 | |||
| 977 | Ga0070717_10260109 | |||
| 978 | Ga0070717_10291719 | |||
| 979 | Ga0070717_10303453 | |||
| 980 | Ga0070717_10305678 | |||
| 981 | Ga0070717_10375858 | |||
| 982 | Ga0070717_10460053 | |||
| 983 | Ga0070717_10663607 | |||
| 984 | Ga0070717_11111560 | |||
| 985 | Ga0070717_11259830 | |||
| 986 | Ga0070717_11393951 | |||
| 987 | Ga0070717_11703373 | |||
| 988 | Ga0070715_10267441 | |||
| 989 | Ga0070715_10428711 | |||
| 990 | Ga0070716_100006018 | |||
| 991 | Ga0070716_100054974 | |||
| 992 | Ga0070716_100101112 | |||
| 993 | Ga0070716_100176539 | |||
| 994 | Ga0070716_100754981 | |||
| 995 | Ga0070716_100799431 | |||
| 996 | Ga0070712_100063701 | |||
| 997 | Ga0070712_100075917 | |||
| 998 | Ga0070712_100079819 | |||
| 999 | Ga0070712_100099360 | |||
| 1000 | Ga0070712_100119350 | |||
| 1001 | Ga0070712_100169798 | |||
| 1002 | Ga0070712_100174792 | |||
| 1003 | Ga0070712_100318136 | |||
| 1004 | Ga0070712_100419805 | |||
| 1005 | Ga0097621_100043617 | |||
| 1006 | Ga0068871_100127033 | |||
| 1007 | Ga0068871_100729468 | |||
| 1008 | Ga0075433_10402997 | |||
| 1009 | Ga0075434_100423383 | |||
| 1010 | Ga0075434_100843737 | |||
| 1011 | Ga0075436_100163477 | |||
| 1012 | Ga0075435_100633662 | |||
| 1013 | Ga0105240_10119801 | |||
| 1014 | Ga0105240_11298841 | |||
| 1015 | Ga0105245_10066721 | |||
| 1016 | Ga0105245_10167836 | |||
| 1017 | Ga0105247_10064778 | |||
| 1018 | Ga0105247_11591479 | |||
| 1019 | Ga0105241_10172367 | |||
| 1020 | Ga0105248_10290442 | |||
| 1021 | Ga0105237_10013855 | |||
| 1022 | Ga0105237_10319400 | |||
| 1023 | Ga0105237_10376547 | |||
| 1024 | Ga0105237_11278339 | |||
| 1025 | Ga0105238_10042698 | |||
| 1026 | Ga0105238_10053420 | |||
| 1027 | Ga0105238_10313124 | |||
| 1028 | Ga0105249_10077484 | |||
| 1029 | Ga0105239_10308772 | |||
| 1030 | Ga0105239_10672042 | |||
| 1031 | Ga0105246_10154594 | |||
| 1032 | Ga0105246_10677107 | |||
| 1033 | Ga0157373_11196291 | |||
| 1034 | Ga0157370_10047570 | |||
| 1035 | Ga0157370_10059914 | |||
| 1036 | Ga0157370_10124084 | |||
| 1037 | Ga0157370_10130084 | |||
| 1038 | Ga0157369_10061422 | |||
| 1039 | Ga0157369_10085408 | |||
| 1040 | Ga0157369_10144709 | |||
| 1041 | Ga0157369_10338314 | |||
| 1042 | Ga0157369_11634112 | |||
| 1043 | Ga0157374_10135038 | |||
| 1044 | Ga0157374_10215318 | |||
| 1045 | Ga0157378_10295310 | |||
| 1046 | Ga0163162_10596876 | |||
| 1047 | Ga0163162_11971731 | |||
| 1048 | Ga0157372_10018230 | |||
| 1049 | Ga0157372_10464066 | |||
| 1050 | Ga0157372_10470221 | |||
| 1051 | Ga0157372_10684274 | |||
| 1052 | Ga0157372_10747686 | |||
| 1053 | Ga0157375_10022374 | |||
| 1054 | Ga0157375_10091448 | |||
| 1055 | Ga0163163_10151628 | |||
| 1056 | Ga0163163_10163090 | |||
| 1057 | Ga0157379_10040373 | |||
| 1058 | Ga0157379_10218137 | |||
| 1059 | Ga0157379_11512358 | |||
| 1060 | Ga0157376_10684563 | |||
| 1061 | Ga0206356_10631136 | |||
| 1062 | Ga0206356_11329143 | |||
| 1063 | Ga0206350_10702530 | |||
| 1064 | Ga0206353_10312476 | |||
| 1065 | Ga0224712_10256979 | |||
| 1066 | Ga0224712_10591060 | |||
| 1067 | Ga0207653_10185517 | |||
| 1068 | Ga0207692_10024312 | |||
| 1069 | Ga0207692_10031593 | |||
| 1070 | Ga0207692_10035146 | |||
| 1071 | Ga0207692_10076226 | |||
| 1072 | Ga0207692_10110658 | |||
| 1073 | Ga0207692_10137616 | |||
| 1074 | Ga0207692_10360596 | |||
| 1075 | Ga0207692_10369455 | |||
| 1076 | Ga0207692_10373715 | |||
| 1077 | Ga0207692_10376202 | |||
| 1078 | Ga0207692_10496782 | |||
| 1079 | Ga0207680_10364408 | |||
| 1080 | Ga0207685_10045938 | |||
| 1081 | Ga0207685_10201868 | |||
| 1082 | Ga0207685_10230800 | |||
| 1083 | Ga0207685_10267956 | |||
| 1084 | Ga0207699_10001827 | |||
| 1085 | Ga0207699_10027562 | |||
| 1086 | Ga0207699_10048343 | |||
| 1087 | Ga0207699_10092542 | |||
| 1088 | Ga0207699_10105614 | |||
| 1089 | Ga0207699_10390846 | |||
| 1090 | Ga0207699_10580749 | |||
| 1091 | Ga0207699_10596597 | |||
| 1092 | Ga0207699_10946073 | |||
| 1093 | Ga0207699_10989007 | |||
| 1094 | Ga0207699_11141835 | |||
| 1095 | Ga0207684_10441578 | |||
| 1096 | Ga0207684_10570274 | |||
| 1097 | Ga0207684_11141805 | |||
| 1098 | Ga0207654_10657345 | |||
| 1099 | Ga0207707_10344999 | |||
| 1100 | Ga0207707_10401876 | |||
| 1101 | Ga0207671_10291812 | |||
| 1102 | Ga0207671_10814897 | |||
| 1103 | Ga0207671_11225883 | |||
| 1104 | Ga0207693_10018279 | |||
| 1105 | Ga0207693_10019025 | |||
| 1106 | Ga0207693_10087943 | |||
| 1107 | Ga0207693_10120263 | |||
| 1108 | Ga0207693_10138815 | |||
| 1109 | Ga0207693_10181805 | |||
| 1110 | Ga0207693_10195613 | |||
| 1111 | Ga0207693_10199126 | |||
| 1112 | Ga0207693_10275837 | |||
| 1113 | Ga0207663_10008551 | |||
| 1114 | Ga0207663_10031037 | |||
| 1115 | Ga0207663_10049670 | |||
| 1116 | Ga0207663_10094159 | |||
| 1117 | Ga0207663_10173143 | |||
| 1118 | Ga0207663_10185934 | |||
| 1119 | Ga0207663_10191175 | |||
| 1120 | Ga0207663_10231596 | |||
| 1121 | Ga0207663_11233438 | |||
| 1122 | Ga0207663_11352593 | |||
| 1123 | Ga0207663_11432349 | |||
| 1124 | Ga0207657_10019795 | |||
| 1125 | Ga0207657_10025231 | |||
| 1126 | Ga0207657_11046984 | |||
| 1127 | Ga0207649_11395674 | |||
| 1128 | Ga0207649_11500153 | |||
| 1129 | Ga0207646_10050678 | |||
| 1130 | Ga0207646_10492774 | |||
| 1131 | Ga0207694_10145544 | |||
| 1132 | Ga0207694_10178366 | |||
| 1133 | Ga0207694_10247651 | |||
| 1134 | Ga0207687_10047492 | |||
| 1135 | Ga0207687_10398169 | |||
| 1136 | Ga0207700_10008468 | |||
| 1137 | Ga0207700_10010130 | |||
| 1138 | Ga0207700_10017187 | |||
| 1139 | Ga0207700_10057876 | |||
| 1140 | Ga0207700_10096514 | |||
| 1141 | Ga0207700_10349766 | |||
| 1142 | Ga0207700_10392917 | |||
| 1143 | Ga0207700_10403597 | |||
| 1144 | Ga0207700_10404470 | |||
| 1145 | Ga0207700_10411111 | |||
| 1146 | Ga0207700_10413488 | |||
| 1147 | Ga0207700_10425895 | |||
| 1148 | Ga0207700_10713476 | |||
| 1149 | Ga0207700_10714668 | |||
| 1150 | Ga0207700_10887183 | |||
| 1151 | Ga0207700_10904301 | |||
| 1152 | Ga0207700_11458556 | |||
| 1153 | Ga0207664_10011460 | |||
| 1154 | Ga0207664_10012337 | |||
| 1155 | Ga0207664_10018355 | |||
| 1156 | Ga0207664_10024772 | |||
| 1157 | Ga0207664_10024891 | |||
| 1158 | Ga0207664_10031774 | |||
| 1159 | Ga0207664_10036915 | |||
| 1160 | Ga0207664_10064140 | |||
| 1161 | Ga0207664_10071813 | |||
| 1162 | Ga0207664_10091032 | |||
| 1163 | Ga0207664_10103766 | |||
| 1164 | Ga0207664_10107957 | |||
| 1165 | Ga0207664_10187616 | |||
| 1166 | Ga0207664_10226746 | |||
| 1167 | Ga0207664_10237914 | |||
| 1168 | Ga0207664_10306905 | |||
| 1169 | Ga0207664_10319784 | |||
| 1170 | Ga0207664_10789588 | |||
| 1171 | Ga0207664_10917609 | |||
| 1172 | Ga0207664_11022407 | |||
| 1173 | Ga0207664_11441823 | |||
| 1174 | Ga0207690_10134126 | |||
| 1175 | Ga0207690_11842242 | |||
| 1176 | Ga0207665_10000449 | |||
| 1177 | Ga0207665_10152230 | |||
| 1178 | Ga0207665_10263442 | |||
| 1179 | Ga0207665_10525305 | |||
| 1180 | Ga0207665_10624076 | |||
| 1181 | Ga0207711_10556824 | |||
| 1182 | Ga0207689_10933508 | |||
| 1183 | Ga0207661_11187576 | |||
| 1184 | Ga0207679_10374004 | |||
| 1185 | Ga0207667_10268231 | |||
| 1186 | Ga0207667_10771402 | |||
| 1187 | Ga0207667_10905205 | |||
| 1188 | Ga0207667_11736258 | |||
| 1189 | Ga0207651_10575669 | |||
| 1190 | Ga0207668_10174281 | |||
| 1191 | Ga0207677_10106176 | |||
| 1192 | Ga0207677_10136237 | |||
| 1193 | Ga0207703_10085015 | |||
| 1194 | Ga0207703_10854722 | |||
| 1195 | Ga0207703_11487590 | |||
| 1196 | Ga0207639_11128768 | |||
| 1197 | Ga0207678_10805430 | |||
| 1198 | Ga0207702_10018026 | |||
| 1199 | Ga0207702_10018213 | |||
| 1200 | Ga0207702_10048101 | |||
| 1201 | Ga0207702_10239955 | |||
| 1202 | Ga0207702_10241053 | |||
| 1203 | Ga0207702_10317307 | |||
| 1204 | Ga0207702_10599648 | |||
| 1205 | Ga0207702_10757290 | |||
| 1206 | Ga0207702_11022284 | |||
| 1207 | Ga0207641_10051815 | |||
| 1208 | Ga0207641_10561735 | |||
| 1209 | Ga0207641_10565777 | |||
| 1210 | Ga0207641_10721276 | |||
| 1211 | Ga0207676_10153648 | |||
| 1212 | Ga0207676_11310169 | |||
| 1213 | Ga0207674_10004830 | |||
| 1214 | Ga0207674_10651255 | |||
| 1215 | Ga0207674_11620842 | |||
| 1216 | Ga0207683_11428610 | |||
| 1217 | Ga0207698_10114567 | |||
| 1218 | Ga0207698_11029738 | |||
| 1219 | Ga0268266_10033678 | |||
| 1220 | Ga0268264_10201173 | |||
| 1221 | Ga0265337_1011860 | |||
| 1222 | Ga0265319_1037055 | |||
| 1223 | Ga0265334_10049701 | |||
| 1224 | Ga0265334_10093552 | |||
| 1225 | Ga0265323_10093085 | |||
| 1226 | Ga0265336_10054346 | |||
| 1227 | Ga0265338_10804321 | |||
| 1228 | Ga0265324_10235692 | |||
| 1229 | Ga0265760_10051893 | |||
| 1230 | Ga0265332_10005811 | |||
| 1231 | Ga0265320_10074266 | |||
| 1232 | Ga0265340_10170330 | |||
| 1233 | Ga0265339_10274048 | |||
| 1234 | Ga0265314_10228435 | |||
| 1235 | Ga0265342_10047241 | |||
| 1236 | Ga0373930_0114741 | |||
| 1237 | Ga0373959_0055114 | |||
| 1238 | Ga0373926_0001609 | |||
| 1239 | Ga0373926_0318906 | |||
| 1240 | Ga0373928_0047636 | |||
| 1241 | Ga0373934_0026029 | |||
| 1242 | Ga0373934_0037527 | |||
| 1243 | Ga0373934_0060377 | |||
| 1244 | Ga0373934_0087019 | |||
| 1245 | Ga0373944_0000173 | |||
| 1246 | Ga0373944_0017997 | |||
| 1247 | Ga0373944_0202363 | |||
| 1248 | Ga0373944_0237083 | |||
| 1249 | Ga0373923_0006475 | |||
| 1250 | Ga0373923_0009964 | |||
| 1251 | Ga0373923_0020895 | |||
| 1252 | Ga0373923_0139083 | |||
| 1253 | Ga0373923_0161386 | |||
| 1254 | Ga0373923_0209047 | |||
| 1255 | Ga0373936_0001025 | |||
| 1256 | Ga0373936_0060348 | |||
| 1257 | Ga0373936_0062756 | |||
| 1258 | Ga0373936_0071448 | |||
| 1259 | Ga0373936_0173264 | |||
| 1260 | Ga0373936_0280970 | |||
| 1261 | Ga0373936_0613718 | |||
| 1262 | Ga0373945_0000210 | |||
| 1263 | Ga0373945_0072646 | |||
| 1264 | Ga0373945_0174187 | |||
| 1265 | Ga0373953_0019653 | |||
| 1266 | Ga0373953_0054207 | |||
| 1267 | Ga0373953_0075546 | |||
| 1268 | Ga0373953_0275972 | |||
| 1269 | Ga0373954_0010922 | |||
| 1270 | Ga0373954_0076522 | |||
| 1271 | Ga0373954_0091694 | |||
| 1272 | Ga0373954_0129084 | |||
| 1273 | Ga0373954_0313603 | |||
| 1274 | Ga0373956_0005942 | |||
| 1275 | Ga0373956_0163554 | |||
| 1276 | Ga0373956_0273148 | |||
| 1277 | Ga0373956_0345464 | |||
| 1278 | Ga0373956_0391054 | |||
| 1279 | Ga0373956_0391623 | |||
| 1280 | Ga0373956_0534650 | |||
| 1281 | Ga0373957_0021710 | |||
| 1282 | Ga0373957_0030214 | |||
| 1283 | Ga0373957_0372966 | |||
| 1284 | Ga0373943_0000104 | |||
| 1285 | Ga0373943_0066953 | |||
| 1286 | Ga0373943_0067307 | |||
| 1287 | Ga0373943_0135498 | |||
| 1288 | Ga0373943_0382732 | |||
| 1289 | Ga0373943_0666707 | |||
| 1290 | Ga0373943_0730182 | |||
| 1291 | Ga0373946_0000015 | |||
| 1292 | Ga0373946_0082964 | |||
| 1293 | Ga0373946_0086754 | |||
| 1294 | Ga0373946_0208295 | |||
| 1295 | Ga0373946_0320612 | |||
| 1296 | Ga0373955_0022900 | |||
| 1297 | Ga0373955_0224176 | |||
| 1298 | Ga0373955_0304788 | |||
| 1299 | Ga0373955_0685230 | |||
| 1300 | Ga0373955_0732150 | |||
| 1301 | Ga0373924_0014146 | |||
| 1302 | Ga0373924_0016170 | |||
| 1303 | Ga0373924_0018133 | |||
| 1304 | Ga0373924_0047397 | |||
| 1305 | Ga0373924_0157340 | |||
| 1306 | Ga0373924_0170506 | |||
| 1307 | Ga0373924_0235501 | |||
| 1308 | Ga0373924_0360944 | |||
| 1309 | Ga0373931_0133410 | |||
| 1310 | Ga0373935_0009424 | |||
| 1311 | Ga0373935_0067434 | |||
| 1312 | Ga0373935_0108637 | |||
| 1313 | Ga0373935_0115055 | |||
| 1314 | Ga0373935_0162037 | |||
| 1315 | Ga0373935_0172754 | |||
| 1316 | Ga0373935_0301782 | |||
| 1317 | Ga0373935_0338117 | |||
| 1318 | Ga0373935_0714454 | |||
| 1319 | Ga0373927_0001149 | |||
| 1320 | Ga0373927_0119516 | |||
| 1321 | Ga0373927_0305653 | |||
| 1322 | Ga0373927_0632414 | |||
| 1323 | Ga0373933_0022155 | |||
| 1324 | Ga0373933_0027702 | |||
| 1325 | Ga0373933_0064796 | |||
| 1326 | Ga0373933_0069325 | |||
| 1327 | Ga0373933_0092779 | |||
| 1328 | Ga0373933_0146538 | |||
| 1329 | Ga0373933_0691026 | |||
| 1330 | Ga0373947_0001353 | |||
| 1331 | Ga0373947_0134832 | |||
| 1332 | Ga0373947_0152013 | |||
| 1333 | Ga0373947_0166958 | |||
| 1334 | Ga0373947_0272575 | |||
| 1335 | Ga0373947_0965327 | |||
| 1336 | Ga0373937_0011317 | |||
| 1337 | Ga0373937_0032242 | |||
| 1338 | Ga0373937_0086746 | |||
| 1339 | Ga0373937_0117827 | |||
| 1340 | Ga0373937_0256873 | |||
| 1341 | Ga0373937_0285143 | |||
| 1342 | Ga0373937_0415784 | |||
| 1343 | Ga0373937_0440746 | |||
| 1344 | Ga0373937_0537434 | |||
| 1345 | Ga0373937_1263825 | |||
| 1346 | Ga0373937_1472286 | |||
| 1347 | Ga0373925_0001645 | |||
| 1348 | Ga0373925_0009491 | |||
| 1349 | Ga0373925_0073847 | |||
| 1350 | Ga0373925_0093578 | |||
| 1351 | Ga0373925_0098762 | |||
| 1352 | Ga0373925_0105445 | |||
| 1353 | Ga0373925_0181000 | |||
| 1354 | Ga0373925_0811192 | |||
| 1355 | Ga0373925_0937887 | |||
| 1356 | Ga0395899_0396967 | |||
| 1357 | Ga0395900_0033533 | |||
| 1358 | Ga0395905_0093003 | |||
| 1359 | Ga0436364_1413397 | |||
| 1360 | Ga0395901_0029425 | |||
| 1361 | Ga0439448_0373351 | |||
| 1362 | Ga0466963_0192694 | |||
| 1363 | Ga0466963_1292076 | |||
| 1364 | Ga0466957_0140844 | |||
| 1365 | Ga0466958_0747791 | |||
| 1366 | Ga0466958_0815322 | |||
| 1367 | Ga0466967_0255862 | |||
| 1368 | Ga0466967_0423951 | |||
| 1369 | Ga0466967_0437971 | |||
| 1370 | Ga0466967_1103995 | |||
| 1371 | Ga0466967_1216645 | |||
| 1372 | Ga0495592_0013547 | |||
| 1373 | Ga0495592_0017235 | |||
| 1374 | Ga0495592_0029645 | |||
| 1375 | Ga0495592_0092184 | |||
| 1376 | Ga0495592_0115409 | |||
| 1377 | Ga0495592_0129204 | |||
| 1378 | Ga0495592_0216229 | |||
| 1379 | Ga0495592_0939318 | |||
| 1380 | Ga0495603_0014154 | |||
| 1381 | Ga0495603_0304889 | |||
| 1382 | Ga0495603_0516729 | |||
| 1383 | Ga0495629_0035792 | |||
| 1384 | Ga0495629_0248084 | |||
| 1385 | Ga0495629_0431903 | |||
| 1386 | Ga0495641_0014615 | |||
| 1387 | Ga0495641_0340410 | |||
| 1388 | Ga0495651_0000219 | |||
| 1389 | Ga0495651_0002922 | |||
| 1390 | Ga0495651_0003561 | |||
| 1391 | Ga0495651_0018139 | |||
| 1392 | Ga0495651_0041407 | |||
| 1393 | Ga0495651_0046397 | |||
| 1394 | Ga0495651_0072622 | |||
| 1395 | Ga0495651_0158669 | |||
| 1396 | Ga0495651_0576224 | |||
| 1397 | Ga0495653_0000581 | |||
| 1398 | Ga0495653_0011940 | |||
| 1399 | Ga0495653_0028985 | |||
| 1400 | Ga0495653_0035637 | |||
| 1401 | Ga0495653_0036829 | |||
| 1402 | Ga0495653_0046938 | |||
| 1403 | Ga0495653_0047426 | |||
| 1404 | Ga0495653_0132975 | |||
| 1405 | Ga0495653_0142083 | |||
| 1406 | Ga0495653_0314873 | |||
| 1407 | Ga0495580_0850244 | |||
| 1408 | Ga0495582_0022670 | |||
| 1409 | Ga0495582_0099556 | |||
| 1410 | Ga0495639_0367910 | |||
| 1411 | Ga0495639_0711675 | |||
| 1412 | Ga0495662_0038398 | |||
| 1413 | Ga0495662_0118890 | |||
| 1414 | Ga0495662_0146818 | |||
| 1415 | Ga0495662_0157578 | |||
| 1416 | Ga0495662_0198729 | |||
| 1417 | Ga0495662_0261760 | |||
| 1418 | Ga0495664_0000070 | |||
| 1419 | Ga0495664_0017539 | |||
| 1420 | Ga0495664_0039715 | |||
| 1421 | Ga0495664_0116725 | |||
| 1422 | Ga0495664_0153389 | |||
| 1423 | Ga0495664_0171885 | |||
| 1424 | Ga0495664_0260402 | |||
| 1425 | Ga0495664_0303149 | |||
| 1426 | Ga0495664_0372151 | |||
| 1427 | Ga0495664_0374471 | |||
| 1428 | Ga0495608_0001473 | |||
| 1429 | Ga0495608_0018980 | |||
| 1430 | Ga0495608_0025514 | |||
| 1431 | Ga0495608_0030159 | |||
| 1432 | Ga0495608_0055399 | |||
| 1433 | Ga0495608_0073340 | |||
| 1434 | Ga0495608_0116953 | |||
| 1435 | Ga0495608_0828171 | |||
| 1436 | Ga0495618_0010668 | |||
| 1437 | Ga0495618_0049813 | |||
| 1438 | Ga0495618_0061596 | |||
| 1439 | Ga0495618_0092011 | |||
| 1440 | Ga0495618_0108969 | |||
| 1441 | Ga0495618_0176978 | |||
| 1442 | Ga0495618_0515086 | |||
| 1443 | Ga0495618_0609103 | |||
| 1444 | Ga0495628_0003712 | |||
| 1445 | Ga0495628_0024166 | |||
| 1446 | Ga0495628_0034738 | |||
| 1447 | Ga0495628_0168699 | |||
| 1448 | Ga0495628_0246178 | |||
| 1449 | Ga0495628_0246698 | |||
| 1450 | Ga0495628_0509362 | |||
| 1451 | Ga0495630_0003832 | |||
| 1452 | Ga0495630_0020865 | |||
| 1453 | Ga0495630_0052015 | |||
| 1454 | Ga0495630_0096972 | |||
| 1455 | Ga0495630_0415197 | |||
| 1456 | Ga0495666_0176710 | |||
| 1457 | Ga0495666_0208721 | |||
| 1458 | Ga0495666_0221381 | |||
| 1459 | Ga0495652_0003955 | |||
| 1460 | Ga0495652_0011979 | |||
| 1461 | Ga0495652_0027003 | |||
| 1462 | Ga0495652_0034261 | |||
| 1463 | Ga0495652_0110229 | |||
| 1464 | Ga0495652_0265339 | |||
| 1465 | Ga0495652_0276274 | |||
| 1466 | Ga0495652_0326322 | |||
| 1467 | Ga0495652_0365232 | |||
| 1468 | Ga0495652_0379247 | |||
| 1469 | Ga0495652_0441475 | |||
| 1470 | Ga0495652_0823949 | |||
| 1471 | Ga0495665_0009934 | |||
| 1472 | Ga0495665_0017630 | |||
| 1473 | Ga0495665_0099107 | |||
| 1474 | Ga0495665_0265488 | |||
| 1475 | Ga0495665_0665499 | |||
| 1476 | Ga0495640_0004917 | |||
| 1477 | Ga0495640_0007086 | |||
| 1478 | Ga0495640_0026266 | |||
| 1479 | Ga0495640_0117023 | |||
| 1480 | Ga0495640_0118442 | |||
| 1481 | Ga0495640_0200335 | |||
| 1482 | Ga0495586_0053880 | |||
| 1483 | Ga0495586_0110544 | |||
| 1484 | Ga0495586_0311735 | |||
| 1485 | Ga0495586_0573312 | |||
| 1486 | Ga0495587_0004757 | |||
| 1487 | Ga0495587_0015588 | |||
| 1488 | Ga0495587_0024591 | |||
| 1489 | Ga0495587_0062202 | |||
| 1490 | Ga0495587_0280150 | |||
| 1491 | Ga0495587_0400210 | |||
| 1492 | Ga0495587_0406547 | |||
| 1493 | Ga0495587_0460124 | |||
| 1494 | Ga0495645_0007226 | |||
| 1495 | Ga0495645_0018561 | |||
| 1496 | Ga0495645_0077790 | |||
| 1497 | Ga0495645_0088327 | |||
| 1498 | Ga0495645_0131406 | |||
| 1499 | Ga0495645_0168415 | |||
| 1500 | Ga0495667_0003183 | |||
| 1501 | Ga0495667_0003646 | |||
| 1502 | Ga0495667_0004238 | |||
| 1503 | Ga0495667_0007051 | |||
| 1504 | Ga0495667_0021133 | |||
| 1505 | Ga0495667_0028136 | |||
| 1506 | Ga0495667_0032304 | |||
| 1507 | Ga0495667_0110845 | |||
| 1508 | Ga0495667_0180061 | |||
| 1509 | Ga0495634_0014688 | |||
| 1510 | Ga0495634_0019503 | |||
| 1511 | Ga0495634_0038862 | |||
| 1512 | Ga0495634_0112100 | |||
| 1513 | Ga0495634_0125875 | |||
| 1514 | Ga0495634_0163198 | |||
| 1515 | Ga0495634_0511901 | |||
| 1516 | Ga0495635_0000245 | |||
| 1517 | Ga0495635_0005856 | |||
| 1518 | Ga0495635_0032210 | |||
| 1519 | Ga0495635_0041452 | |||
| 1520 | Ga0495635_0049212 | |||
| 1521 | Ga0495635_0073536 | |||
| 1522 | Ga0495635_0085370 | |||
| 1523 | Ga0495635_0214674 | |||
| 1524 | Ga0495635_0424502 | |||
| 1525 | Ga0495657_0003887 | |||
| 1526 | Ga0495657_0005749 | |||
| 1527 | Ga0495657_0025591 | |||
| 1528 | Ga0495657_0033951 | |||
| 1529 | Ga0495657_0035011 | |||
| 1530 | Ga0495657_0039933 | |||
| 1531 | Ga0495657_0140858 | |||
| 1532 | Ga0495657_0222891 | |||
| 1533 | Ga0495657_0493848 | |||
| 1534 | Ga0495657_0565668 | |||
| 1535 | Ga0495599_0000277 | |||
| 1536 | Ga0495599_0012371 | |||
| 1537 | Ga0495599_0014608 | |||
| 1538 | Ga0495599_0029207 | |||
| 1539 | Ga0495599_0038236 | |||
| 1540 | Ga0495599_0064061 | |||
| 1541 | Ga0495599_0075893 | |||
| 1542 | Ga0495599_0127304 | |||
| 1543 | Ga0495599_0262228 | |||
| 1544 | Ga0495599_0756415 | |||
| 1545 | Ga0495623_0015284 | |||
| 1546 | Ga0495623_0017592 | |||
| 1547 | Ga0495623_0099933 | |||
| 1548 | Ga0495623_0131225 | |||
| 1549 | Ga0495623_0515714 | |||
| 1550 | Ga0495646_0007950 | |||
| 1551 | Ga0495646_0029971 | |||
| 1552 | Ga0495646_0030872 | |||
| 1553 | Ga0495646_0110955 | |||
| 1554 | Ga0495646_0349941 | |||
| 1555 | Ga0495658_0121474 | |||
| 1556 | Ga0495658_0680573 | |||
| 1557 | Ga0495613_0188756 | |||
| 1558 | Ga0495613_0267778 | |||
| 1559 | Ga0495613_0469472 | |||
| 1560 | Ga0495613_0536519 | |||
| 1561 | Ga0495613_0556129 | |||
| 1562 | Ga0495624_0000293 | |||
| 1563 | Ga0495624_0036399 | |||
| 1564 | Ga0495624_0167212 | |||
| 1565 | Ga0495624_0330829 | |||
| 1566 | Ga0495600_0008485 | |||
| 1567 | Ga0495600_0009172 | |||
| 1568 | Ga0495600_0025036 | |||
| 1569 | Ga0495600_0155209 | |||
| 1570 | Ga0495600_0576853 | |||
| 1571 | Ga0495600_0611303 | |||
| 1572 | Ga0495581_0048017 | |||
| 1573 | Ga0495581_0102793 | |||
| 1574 | Ga0495581_0500185 | |||
| 1575 | Ga0495604_0004852 | |||
| 1576 | Ga0495604_0041489 | |||
| 1577 | Ga0495604_0102450 | |||
| 1578 | Ga0495604_0183439 | |||
| 1579 | Ga0495604_0226525 | |||
| 1580 | Ga0495604_0329763 | |||
| 1581 | Ga0495674_0000077 | |||
| 1582 | Ga0495674_0009167 | |||
| 1583 | Ga0495674_0020902 | |||
| 1584 | Ga0495674_0043775 | |||
| 1585 | Ga0495674_0065462 | |||
| 1586 | Ga0495674_0080416 | |||
| 1587 | Ga0495674_0087783 | |||
| 1588 | Ga0495674_0143432 | |||
| 1589 | Ga0495674_0174931 | |||
| 1590 | Ga0495674_0346068 | |||
| 1591 | Ga0495676_0003089 | |||
| 1592 | Ga0495676_0096480 | |||
| 1593 | Ga0495676_0131474 | |||
| 1594 | Ga0495676_0243138 | |||
| 1595 | Ga0495676_0411016 | |||
| 1596 | Ga0495676_0890802 | |||
| 1597 | Ga0495680_0002138 | |||
| 1598 | Ga0495680_0004141 | |||
| 1599 | Ga0495680_0005088 | |||
| 1600 | Ga0495680_0008741 | |||
| 1601 | Ga0495680_0009458 | |||
| 1602 | Ga0495680_0035807 | |||
| 1603 | Ga0495680_0083378 | |||
| 1604 | Ga0495680_0124595 | |||
| 1605 | Ga0495680_0137994 | |||
| 1606 | Ga0495680_0182197 | |||
| 1607 | Ga0495680_0223413 | |||
| 1608 | Ga0495675_0015406 | |||
| 1609 | Ga0495675_0026826 | |||
| 1610 | Ga0495675_0098383 | |||
| 1611 | Ga0495675_0174338 | |||
| 1612 | Ga0495675_0218049 | |||
| 1613 | Ga0495675_0446087 | |||
| 1614 | Ga0495675_0540785 | |||
| 1615 | Ga0495675_0746975 | |||
| 1616 | Ga0495684_0001743 | |||
| 1617 | Ga0495684_0002148 | |||
| 1618 | Ga0495684_0007535 | |||
| 1619 | Ga0495684_0029831 | |||
| 1620 | Ga0495684_0038090 | |||
| 1621 | Ga0495684_0133621 | |||
| 1622 | Ga0495684_0306051 | |||
| 1623 | Ga0495684_0368086 | |||
| 1624 | Ga0495593_0035201 | |||
| 1625 | Ga0495593_0074195 | |||
| 1626 | Ga0495593_0114883 | |||
| 1627 | Ga0495593_0364295 | |||
| 1628 | Ga0495602_0019243 | |||
| 1629 | Ga0495602_0045736 | |||
| 1630 | Ga0495602_0064967 | |||
| 1631 | Ga0495602_0065730 | |||
| 1632 | Ga0495602_0325163 | |||
| 1633 | Ga0495602_0412075 | |||
| 1634 | Ga0495602_0514836 | |||
| 1635 | Ga0495602_1029741 | |||
| 1636 | Ga0496100_0040360 | |||
| 1637 | Ga0496101_0415890 | |||
| 1638 | Ga0496102_0009241 | |||
| 1639 | Ga0496103_0139019 | |||
| 1640 | Ga0496103_0720137 | |||
| 1641 | Ga0496104_0041732 | |||
| 1642 | Ga0496104_0526263 | |||
| 1643 | Ga0496104_0969902 | |||
| 1644 | Ga0496104_1817385 | |||
| 1645 | Ga0496105_0026386 | |||
| 1646 | Ga0496106_0031500 | |||
| 1647 | Ga0496106_1315574 | |||
| 1648 | Ga0496108_0048182 | |||
| 1649 | Ga0496108_0071857 | |||
| 1650 | Ga0496108_0165677 | |||
| 1651 | Ga0496109_0143715 | |||
| 1652 | Ga0496109_0164059 | |||
| 1653 | Ga0496109_0673708 | |||
| 1654 | Ga0496110_0070917 | |||
| 1655 | Ga0496110_0710798 | |||
| 1656 | Ga0496111_0032517 | |||
| 1657 | Ga0496112_0000716 | |||
| 1658 | Ga0496112_0068165 | |||
| 1659 | Ga0496113_0083410 | |||
| 1660 | Ga0496113_0107032 | |||
| 1661 | Ga0496113_1518550 | |||
| 1662 | Ga0496114_0406736 | |||
| 1663 | Ga0496114_0599102 | |||
| 1664 | Ga0496115_0009924 | |||
| 1665 | Ga0496115_0010462 | |||
| 1666 | Ga0496115_1158805 | |||
| 1667 | Ga0496115_1346958 | |||
| 1668 | Ga0496126_0000022 | |||
| 1669 | Ga0496126_0018518 | |||
| 1670 | Ga0496126_0474581 | |||
| 1671 | Ga0496126_1068794 | |||
| 1672 | nmdc:mga0n895_156388_c1 | |||
| 1673 | nmdc:mga0n895_909180_c1 | |||
| 1674 | nmdc:mga0n895_979211_c1 | |||
| 1675 | nmdc:mga0rr50_1378686_c1 | |||
| 1676 | nmdc:mga0rr50_417566_c1 | |||
| 1677 | nmdc:mga0rr50_793053_c1 | |||
| 1678 | nmdc:mga08x19_188435_c1 | |||
| 1679 | Ga0495601_0083606 | |||
| 1680 | Ga0495601_0109228 | |||
| 1681 | Ga0495601_0215748 | |||
| 1682 | Ga0495601_0281564 | |||
| 1683 | Ga0495601_0289971 | |||
| 1684 | Ga0495601_0771187 | |||
| 1685 | Ga0495601_1077394 | |||
| 1686 | Ga0495612_0336290 | |||
| 1687 | Ga0495612_0343023 | |||
| 1688 | Ga0495595_0001760 | |||
| 1689 | Ga0495595_0162550 | |||
| 1690 | Ga0495595_0455837 | |||
| 1691 | Ga0495595_0727195 | |||
| 1692 | Ga0495619_0061284 | |||
| 1693 | Ga0495619_0176751 | |||
| 1694 | Ga0495619_0196066 | |||
| 1695 | Ga0495619_0207049 | |||
| 1696 | Ga0495619_0921118 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.8143 | 2 | 113 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7953 | 2 | 113 |
| 3znj-assembly1.cif.gz_3 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.72 | 1 | 114 |
| 3znu-assembly1.cif.gz_I | crystal structure of clcf in crystal form 2 | 0.7179 | 1 | 114 |
| 4fpi-assembly1.cif.gz_C | crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp | 0.7046 | 1 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.8143 | 2 | 113 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7953 | 2 | 113 | 3.30.70.1060 |
| af_Q59RA0_23_619_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.7762 | 8 | 38 | 1.25.10.10 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7205 | 1 | 114 | 3.30.70.1060 |
| af_P0ACJ5_55_139_3.30.70.920 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain | 0.6855 | 2 | 109 | 3.30.70.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2C507-F1-model_v4 | YciI family protein | 0.9804 | 1 | 114 |
|
| AF-I0HF34-F1-model_v4 | YCII-related domain-containing protein | 0.9304 | 1 | 114 |
|
| AF-I0HF34-F1-model_v4 | YCII-related domain-containing protein | 0.9228 | 1 | 114 |
|
| AF-A0A7W0MWG5-F1-model_v4 | YCII-related domain-containing protein | 0.9131 | 1 | 112 |
|
| AF-A0A2V2SL62-F1-model_v4 | deleted | 0.9116 | 1 | 114 |
|