F483354

General Info

Members Datasets Scaffolds Average Seq Length
848 404 683 293

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100107652|Ga0070670_1001076521
Length 313
Sequence VSVSALGLRVDVDTFRGTREGVPRLLETFAKHGLRATFFFTLGPDNMGRHLFRLLKPRFFMKMLRSRAASLYGWDVLFAGTFWPGRKIGAALGGTLRLADEAGHEVGLHAWDHHRWQVSALKMEPRALHDEIARGVGAFTDALGRRPDCSAAAGWVSNERVLETKERFGFRYNSDCRGRSIFVPVVNGRRLAPQIPVTLPTYDEAVGRDGVTNDNYNDWLLARIEPGEFNVLTVHAEVEGGACAQMFDAFLGACAARGIRPVPLRDLLAAEALPAPDHLALAPIEGREGNVGWQRSALAAAPRPDRSATATPA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231022 Pseudomonas sp. GM79 Isolate Nodule
20 2511231023 Pseudomonas sp. GM80 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
23 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
24 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
25 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
26 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
27 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
28 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
29 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
30 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
31 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
32 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
33 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
34 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
35 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
36 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
37 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
38 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
39 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
40 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
41 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
42 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
43 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
44 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
45 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
46 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
47 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
48 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
49 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
50 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
51 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
52 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
53 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
54 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
55 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
56 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
57 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
58 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
59 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
60 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
61 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
62 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
63 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
64 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
65 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
66 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
67 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
68 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
69 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
70 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
71 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
72 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
73 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
74 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
75 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
76 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
77 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
78 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
79 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
80 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
81 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
82 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
83 2765235841 Pseudomonas putida AA7 Isolate Unclassified
84 2773857670 Pseudomonas sp. 478 Isolate Unclassified
85 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
86 2773857673 Pseudomonas sp. 443 Isolate Unclassified
87 2784132063 Pseudomonas sp. 424 Isolate Unclassified
88 2784132072 Pseudomonas sp. 460 Isolate Unclassified
89 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
90 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
91 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
92 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
93 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
94 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
95 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
96 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
97 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
98 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
99 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
100 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
101 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
102 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
103 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
104 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
105 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
106 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
107 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
108 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
109 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
110 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
111 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
112 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
113 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
114 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
115 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
116 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
117 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
118 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
119 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
120 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
121 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
122 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
123 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
124 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
125 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
126 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
127 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
128 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
129 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
130 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
131 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
132 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
133 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
134 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
135 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
136 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
137 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
138 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
139 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
140 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
141 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
142 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
143 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
144 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
145 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
146 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
147 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
148 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
149 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
150 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
151 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
152 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
153 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
154 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
155 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
156 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
157 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
158 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
159 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
160 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
161 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
162 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
163 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
164 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
165 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
166 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
167 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
168 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
169 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
170 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
171 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
172 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
173 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
174 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
175 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
176 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
177 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
178 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
179 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
180 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
181 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
182 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
183 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
184 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
185 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
186 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
187 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
188 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
189 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
190 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
191 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
192 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
193 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
194 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
195 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
196 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
197 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
198 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
199 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
200 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
201 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
202 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
203 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
204 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
205 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
206 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
207 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
208 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
209 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
210 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
211 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
212 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
213 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
214 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
215 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
216 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
217 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
218 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
219 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
220 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
221 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
222 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
223 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
224 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
230 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
231 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
232 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
234 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
261 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
262 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
264 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
265 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
266 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
267 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
268 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
269 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
270 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
271 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
274 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
275 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
276 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
277 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
278 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
279 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
280 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
281 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
282 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
287 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
288 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
292 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
297 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
298 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
299 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
300 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
305 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
306 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
309 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
310 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
313 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
314 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
321 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
322 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
323 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
324 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
325 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
326 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
327 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
328 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
329 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
330 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
331 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
332 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
333 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
334 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
335 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
336 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
337 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
338 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
346 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
347 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
348 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
349 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
350 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
351 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
352 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
353 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
354 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
355 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
356 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
366 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
369 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
377 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
378 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
385 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
386 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
387 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
388 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
389 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
390 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
391 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
392 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
393 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
394 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
395 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
396 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
397 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
398 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
399 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
400 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
401 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
402 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
403 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
404 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.54
Metatranscriptomes 0
Isolates 19.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 6.72
Nodule 2.36
Rhizoplane 5.54
Rhizosphere 72.52
Stem 0
Stem Tuber 0
Unclassified 12.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_19 2124908027 Bacteria 54562
2 MRS2a_Contig_7067 2124908027 Bacteria 5082
3 JGI25162J39368_1000004 3300002737 Bacteria 441040
4 JGI25162J39368_1000065 3300002737 Bacteria 131083
5 JGI25154J39366_1003271 3300002738 Bacteria 3514
6 JGI25163J39215_1001383 3300002771 Bacteria 4083
7 JGI25163J39215_1001387 3300002771 Bacteria 4074
8 JGI25164J39214_1000031 3300002772 Bacteria 144582
9 JGI25164J39214_1000038 3300002772 Bacteria 131082
10 JGI25165J46597_1000011 3300003214 Bacteria 441040
11 JGI25165J46597_1000126 3300003214 Bacteria 131083
12 Ga0055538_1000007 3300003751 Bacteria 399715
13 Ga0055539_1000011 3300003752 Bacteria 399747
14 Ga0055533_1000014 3300003756 Bacteria 399747
15 Ga0055532_1000009 3300003758 Bacteria 399537
16 Ga0055525_1000016 3300003759 Bacteria 399724
17 Ga0055536_1000025 3300003781 Bacteria 183172
18 Ga0055536_1000053 3300003781 Bacteria 110030
19 Ga0055530_10000007 3300003791 Bacteria 183172
20 Ga0055530_10000011 3300003791 Bacteria 170218
21 Ga0055530_10000219 3300003791 Bacteria 51126
22 Ga0055540_1000006 3300003792 Bacteria 372018
23 Ga0055540_1000034 3300003792 Bacteria 170218
24 Ga0055540_1000125 3300003792 Bacteria 79312
25 Ga0055531_10001653 3300003794 Bacteria 16091
26 Ga0055541_1000008 3300003841 Bacteria 399724
27 Ga0065714_10000048 3300005288 Bacteria 23148
28 Ga0065714_10002770 3300005288 Bacteria 11621
29 Ga0065714_10065674 3300005288 Bacteria 8904
30 Ga0065714_10069849 3300005288 Bacteria 4063
31 Ga0065714_10088799 3300005288 Bacteria 2003
32 Ga0065712_10000124 3300005290 Bacteria 105429
33 Ga0065712_10000445 3300005290 Bacteria 11247
34 Ga0065715_10101172 3300005293 Bacteria 3227
35 Ga0070670_100000079 3300005331 Bacteria 92916
36 Ga0070670_100107652 3300005331 Bacteria 2402
37 Ga0070666_10016235 3300005335 Bacteria 4762
38 Ga0068868_100001680 3300005338 Bacteria 15130
39 Ga0070687_100016880 3300005343 Bacteria 3343
40 Ga0070661_100000024 3300005344 Bacteria 121810
41 Ga0070669_100001022 3300005353 Bacteria 20393
42 Ga0070669_100180512 3300005353 Bacteria 1651
43 Ga0070671_100001324 3300005355 Bacteria 18607
44 Ga0070662_100090587 3300005457 Bacteria 2296
45 Ga0070684_100078344 3300005535 Bacteria 2920
46 Ga0068853_100039228 3300005539 Bacteria 4039
47 Ga0070693_100100157 3300005547 Bacteria 1764
48 Ga0070665_100039437 3300005548 Bacteria 4749
49 Ga0070665_100269699 3300005548 Bacteria 1703
50 Ga0070664_100000024 3300005564 Bacteria 94521
51 Ga0068859_100015482 3300005617 Bacteria 7663
52 Ga0068851_10000552 3300005834 Bacteria 16293
53 Ga0068863_100004929 3300005841 Bacteria 13158
54 Ga0068860_100290580 3300005843 Bacteria 1599
55 Ga0075364_10009199 3300006051 Bacteria 5919
56 Ga0075432_10000898 3300006058 Bacteria 9361
57 Ga0075432_10002446 3300006058 Bacteria 6182
58 Ga0075432_10005364 3300006058 Bacteria 4370
59 Ga0075362_10005910 3300006177 Bacteria 4520
60 Ga0075369_10041465 3300006186 Bacteria 1971
61 Ga0097621_100034439 3300006237 Bacteria 4040
62 Ga0075428_100056910 3300006844 Bacteria 4281
63 Ga0075430_100013614 3300006846 Bacteria 6933
64 Ga0075429_100262130 3300006880 Bacteria 1513
65 Ga0075436_100087080 3300006914 Bacteria 2169
66 Ga0097620_100015481 3300006931 Bacteria 7663
67 Ga0079104_1000143 3300006946 Bacteria 101361
68 Ga0105251_10000001 3300009011 Bacteria 466643
69 Ga0105251_10000571 3300009011 Bacteria 34449
70 Ga0105251_10008065 3300009011 Bacteria 6381
71 Ga0105251_10016806 3300009011 Bacteria 3939
72 Ga0105251_10023304 3300009011 Bacteria 3197
73 Ga0105251_10030919 3300009011 Bacteria 2684
74 Ga0105251_10045232 3300009011 Bacteria 2123
75 Ga0105251_10076209 3300009011 Bacteria 1556
76 Ga0105244_10000277 3300009036 Bacteria 51399
77 Ga0105244_10000325 3300009036 Bacteria 45650
78 Ga0105244_10000907 3300009036 Bacteria 25017
79 Ga0105244_10004021 3300009036 Bacteria 10276
80 Ga0105244_10005358 3300009036 Bacteria 8539
81 Ga0105244_10006752 3300009036 Bacteria 7379
82 Ga0105244_10008600 3300009036 Bacteria 6362
83 Ga0105244_10014311 3300009036 Bacteria 4592
84 Ga0105244_10021452 3300009036 Bacteria 3572
85 Ga0105244_10036305 3300009036 Bacteria 2582
86 Ga0105244_10072259 3300009036 Bacteria 1719
87 Ga0105244_10107362 3300009036 Bacteria 1361
88 Ga0105244_10128256 3300009036 Bacteria 1225
89 Ga0105250_10000015 3300009092 Bacteria 262683
90 Ga0105250_10000679 3300009092 Bacteria 21367
91 Ga0105250_10001563 3300009092 Bacteria 12305
92 Ga0105250_10008485 3300009092 Bacteria 4361
93 Ga0105250_10020438 3300009092 Bacteria 2676
94 Ga0105240_10142203 3300009093 Bacteria 2868
95 Ga0111539_10046032 3300009094 Bacteria 5221
96 Ga0111539_10474394 3300009094 Bacteria 1457
97 Ga0105245_10014982 3300009098 Bacteria 6754
98 Ga0105247_10001526 3300009101 Bacteria 16541
99 Ga0105243_10000020 3300009148 Bacteria 214279
100 Ga0105243_10067859 3300009148 Bacteria 2873
101 Ga0105243_10230220 3300009148 Bacteria 1644
102 Ga0105242_10002506 3300009176 Bacteria 14403
103 Ga0105237_10000042 3300009545 Bacteria 181280
104 Ga0105239_10022541 3300010375 Bacteria 6943
105 Ga0105246_10000010 3300011119 Bacteria 69400
106 Ga0105246_10000641 3300011119 Bacteria 19535
107 Ga0105246_10002448 3300011119 Bacteria 11207
108 Ga0105246_10245719 3300011119 Bacteria 1417
109 Ga0157345_1000060 3300012498 Bacteria 23153
110 Ga0157345_1001954 3300012498 Bacteria 1444
111 Ga0157373_10001425 3300013100 Bacteria 18233
112 Ga0157373_10003868 3300013100 Bacteria 11315
113 Ga0157373_10029199 3300013100 Bacteria 3974
114 Ga0157371_10000635 3300013102 Bacteria 41753
115 Ga0157371_10022147 3300013102 Bacteria 4660
116 Ga0157371_10221470 3300013102 Bacteria 1359
117 Ga0157370_10002554 3300013104 Bacteria 21839
118 Ga0157370_10016221 3300013104 Bacteria 7550
119 Ga0157370_10332993 3300013104 Bacteria 1399
120 Ga0157369_10001667 3300013105 Bacteria 27075
121 Ga0157369_10004855 3300013105 Bacteria 15777
122 Ga0157369_10019056 3300013105 Bacteria 7683
123 Ga0157374_10031348 3300013296 Bacteria 4832
124 Ga0163162_10000169 3300013306 Bacteria 60285
125 Ga0163162_10015519 3300013306 Bacteria 7445
126 Ga0163162_10149019 3300013306 Bacteria 2456
127 Ga0163162_10160225 3300013306 Bacteria 2372
128 Ga0163162_10477404 3300013306 Bacteria 1378
129 Ga0163162_10590966 3300013306 Bacteria 1237
130 Ga0157372_10004428 3300013307 Bacteria 14984
131 Ga0157375_10001060 3300013308 Bacteria 23747
132 Ga0157375_10083123 3300013308 Bacteria 3246
133 Ga0157375_10226048 3300013308 Bacteria 2030
134 Ga0163163_10003261 3300014325 Bacteria 13761
135 Ga0182008_10001212 3300014497 Bacteria 17765
136 Ga0182008_10002733 3300014497 Bacteria 10938
137 Ga0182008_10003513 3300014497 Bacteria 9444
138 Ga0182008_10014394 3300014497 Bacteria 4142
139 Ga0182008_10016275 3300014497 Bacteria 3866
140 Ga0157379_10020541 3300014968 Bacteria 5841
141 Ga0182006_1000165 3300015261 Bacteria 70092
142 Ga0182006_1000387 3300015261 Bacteria 36363
143 Ga0182006_1007913 3300015261 Bacteria 4837
144 Ga0182006_1025370 3300015261 Bacteria 2435
145 Ga0182007_10000108 3300015262 Bacteria 57807
146 Ga0182007_10009387 3300015262 Bacteria 3948
147 Ga0182005_1000470 3300015265 Bacteria 20931
148 Ga0182005_1003132 3300015265 Bacteria 5689
149 Ga0182005_1005478 3300015265 Bacteria 3961
150 Ga0182005_1013514 3300015265 Bacteria 2295
151 Ga0182005_1038670 3300015265 Bacteria 1298
152 Ga0163161_10001803 3300017792 Bacteria 15639
153 Ga0163161_10003345 3300017792 Bacteria 11243
154 Ga0163161_10003497 3300017792 Bacteria 11000
155 Ga0163161_10009162 3300017792 Bacteria 6841
156 Ga0163161_10023843 3300017792 Bacteria 4318
157 Ga0163161_10029906 3300017792 Bacteria 3873
158 Ga0209435_100687 3300025206 Bacteria 5899
159 Ga0209760_100032 3300025207 Bacteria 138015
160 Ga0209760_100036 3300025207 Bacteria 130845
161 Ga0209784_100023 3300025224 Bacteria 399841
162 Ga0209566_100019 3300025225 Bacteria 414836
163 Ga0209674_100034 3300025226 Bacteria 414903
164 Ga0209147_100027 3300025229 Bacteria 414610
165 Ga0209563_100037 3300025230 Bacteria 414903
166 Ga0209563_100298 3300025230 Bacteria 20216
167 Ga0207427_100003 3300025231 Bacteria 1035004
168 Ga0207427_100004 3300025231 Bacteria 939600
169 Ga0209437_100002 3300025233 Bacteria 1574801
170 Ga0209437_100025 3300025233 Bacteria 561333
171 Ga0209646_1000318 3300025246 Bacteria 37146
172 Ga0209677_100021 3300025253 Bacteria 414954
173 Ga0209233_1000004 3300025261 Bacteria 1574798
174 Ga0209233_1000145 3300025261 Bacteria 188955
175 Ga0209675_1011697 3300025291 Bacteria 2892
176 Ga0209676_1000002 3300025292 Bacteria 1732948
177 Ga0209676_1000003 3300025292 Bacteria 1454178
178 Ga0209676_1002106 3300025292 Bacteria 15320
179 Ga0209676_1011728 3300025292 Bacteria 3506
180 Ga0209050_1000004 3300025298 Bacteria 1600040
181 Ga0209050_1000006 3300025298 Bacteria 1359702
182 Ga0209050_1000013 3300025298 Bacteria 811408
183 Ga0209050_1000763 3300025298 Bacteria 46213
184 Ga0209051_1000001 3300025303 Bacteria 1732974
185 Ga0209051_1000006 3300025303 Bacteria 1015785
186 Ga0209051_1000007 3300025303 Bacteria 811408
187 Ga0209257_1000029 3300025304 Bacteria 695617
188 Ga0209257_1009178 3300025304 Bacteria 5376
189 Ga0207656_10005289 3300025321 Bacteria 4553
190 Ga0207696_1000002 3300025711 Bacteria 1098043
191 Ga0207696_1000017 3300025711 Bacteria 491130
192 Ga0207696_1000460 3300025711 Bacteria 35536
193 Ga0207655_1000006 3300025728 Bacteria 861092
194 Ga0207655_1000074 3300025728 Bacteria 232056
195 Ga0207655_1000098 3300025728 Bacteria 190699
196 Ga0207655_1000410 3300025728 Bacteria 59117
197 Ga0207655_1001712 3300025728 Bacteria 19282
198 Ga0207655_1002318 3300025728 Bacteria 15638
199 Ga0207655_1002796 3300025728 Bacteria 13554
200 Ga0207655_1003616 3300025728 Bacteria 11425
201 Ga0207655_1004728 3300025728 Bacteria 9515
202 Ga0207655_1006032 3300025728 Bacteria 8101
203 Ga0207655_1008809 3300025728 Bacteria 6349
204 Ga0207655_1009171 3300025728 Bacteria 6180
205 Ga0207713_1000061 3300025735 Bacteria 209289
206 Ga0207713_1000284 3300025735 Bacteria 58743
207 Ga0207713_1000518 3300025735 Bacteria 39106
208 Ga0207713_1000929 3300025735 Bacteria 26289
209 Ga0207713_1001602 3300025735 Bacteria 17673
210 Ga0207713_1006155 3300025735 Bacteria 7368
211 Ga0207713_1008243 3300025735 Bacteria 6027
212 Ga0207713_1014599 3300025735 Bacteria 4072
213 Ga0207713_1031048 3300025735 Bacteria 2369
214 Ga0207713_1051401 3300025735 Bacteria 1639
215 Ga0207713_1087496 3300025735 Bacteria 1104
216 Ga0207710_10014435 3300025900 Bacteria 3331
217 Ga0207680_10063301 3300025903 Bacteria 2263
218 Ga0207671_10000474 3300025914 Bacteria 54456
219 Ga0207649_10000010 3300025920 Bacteria 284354
220 Ga0207681_10003542 3300025923 Bacteria 9722
221 Ga0207681_10103883 3300025923 Bacteria 2054
222 Ga0207650_10000690 3300025925 Bacteria 26485
223 Ga0207650_10228408 3300025925 Bacteria 1500
224 Ga0207659_10342895 3300025926 Bacteria 1238
225 Ga0207706_10002181 3300025933 Bacteria 19100
226 Ga0207686_10008489 3300025934 Bacteria 5549
227 Ga0207709_10000004 3300025935 Bacteria 825156
228 Ga0207709_10004919 3300025935 Bacteria 7646
229 Ga0207709_10079342 3300025935 Bacteria 2110
230 Ga0207670_10107537 3300025936 Bacteria 2003
231 Ga0207679_10000022 3300025945 Bacteria 219036
232 Ga0207703_10092538 3300026035 Bacteria 2545
233 Ga0207639_10076491 3300026041 Bacteria 2636
234 Ga0207641_10027117 3300026088 Bacteria 4730
235 Ga0207676_10005759 3300026095 Bacteria 8763
236 Ga0207683_10116531 3300026121 Bacteria 2395
237 Ga0209281_1000063 3300027111 Bacteria 288465
238 Ga0207428_10129918 3300027907 Bacteria 1928
239 Ga0268266_10028275 3300028379 Bacteria 4766
240 Ga0268266_10174792 3300028379 Bacteria 1952
241 Ga0307511_10053051 3300030521 Bacteria 3220
242 Ga0307408_100003398 3300031548 Bacteria 10921
243 Ga0316579_10013422 3300031691 Bacteria 3524
244 Ga0307405_10018233 3300031731 Bacteria 3869
245 Ga0316577_10050573 3300031733 Bacteria 2320
246 Ga0307510_10003671 3300033180 Bacteria 17922
247 Ga0307510_10098723 3300033180 Bacteria 2723
248 Ga0373956_0031941 3300035119 Bacteria 2309
249 Ga0373957_0005501 3300035120 Bacteria 3928
250 Ga0373962_0025273 3300035242 Bacteria 1595
251 Ga0373937_0003245 3300036401 Bacteria 13631
252 Ga0316582_0047164 3300036647 Bacteria 2719
253 Ga0316582_0081291 3300036647 Bacteria 2116
254 Ga0439447_001977 3300041407 Bacteria 7525
255 Ga0439432_000085 3300042006 Bacteria 29181
256 Ga0439463_000996 3300042016 Bacteria 7717
257 Ga0453684_0031837 3300044712 Bacteria 7397
258 Ga0495617_000148 3300046452 Bacteria 44939
259 Ga0495617_001573 3300046452 Bacteria 9860
260 Ga0495617_011304 3300046452 Bacteria 3046
261 Ga0495617_134492 3300046452 Bacteria 791
262 Ga0495627_000031 3300046453 Bacteria 226981
263 Ga0495627_013920 3300046453 Bacteria 2821
264 Ga0495627_014731 3300046453 Bacteria 2720
265 Ga0495627_027534 3300046453 Bacteria 1822
266 Ga0495627_046447 3300046453 Bacteria 1319
267 Ga0495603_0003135 3300046455 Bacteria 9826
268 Ga0495603_0020988 3300046455 Bacteria 3955
269 Ga0495603_0063316 3300046455 Bacteria 2182
270 Ga0495603_0218698 3300046455 Bacteria 1099
271 Ga0495603_0282140 3300046455 Bacteria 955
272 Ga0495590_0000177 3300046457 Bacteria 37380
273 Ga0495590_0001583 3300046457 Bacteria 9745
274 Ga0495591_000053 3300046458 Bacteria 135500
275 Ga0495591_000172 3300046458 Bacteria 67392
276 Ga0495591_000465 3300046458 Bacteria 32374
277 Ga0495591_000873 3300046458 Bacteria 21156
278 Ga0495591_000957 3300046458 Bacteria 19741
279 Ga0495591_005313 3300046458 Bacteria 5995
280 Ga0495591_024863 3300046458 Bacteria 1889
281 Ga0495591_031032 3300046458 Bacteria 1607
282 Ga0495629_0007303 3300046459 Bacteria 8139
283 Ga0495638_0001323 3300046460 Bacteria 22805
284 Ga0495638_0021055 3300046460 Bacteria 4301
285 Ga0495638_0171078 3300046460 Bacteria 1246
286 Ga0495653_0000652 3300046463 Bacteria 26457
287 Ga0495653_0004505 3300046463 Bacteria 11249
288 Ga0495653_0069799 3300046463 Bacteria 2630
289 Ga0495653_0079334 3300046463 Bacteria 2431
290 Ga0495650_0003897 3300046471 Bacteria 10547
291 Ga0495650_0004145 3300046471 Bacteria 10095
292 Ga0495650_0004343 3300046471 Bacteria 9772
293 Ga0495650_0015582 3300046471 Bacteria 3892
294 Ga0495650_0069785 3300046471 Bacteria 1381
295 Ga0495582_0002904 3300046473 Bacteria 9580
296 Ga0495605_0000007 3300046474 Bacteria 358289
297 Ga0495605_0000054 3300046474 Bacteria 157560
298 Ga0495605_0000778 3300046474 Bacteria 22880
299 Ga0495605_0000840 3300046474 Bacteria 21512
300 Ga0495605_0003164 3300046474 Bacteria 9894
301 Ga0495605_0010382 3300046474 Bacteria 5213
302 Ga0495605_0016891 3300046474 Bacteria 3943
303 Ga0495605_0044400 3300046474 Bacteria 2198
304 Ga0495605_0231102 3300046474 Bacteria 796
305 Ga0495639_0000053 3300046475 Bacteria 50537
306 Ga0495662_0093818 3300046476 Bacteria 1465
307 Ga0495584_0000120 3300046491 Bacteria 54113
308 Ga0495584_0000715 3300046491 Bacteria 21886
309 Ga0495584_0002413 3300046491 Bacteria 10621
310 Ga0495584_0002856 3300046491 Bacteria 9648
311 Ga0495584_0008390 3300046491 Bacteria 5351
312 Ga0495584_0029168 3300046491 Bacteria 2796
313 Ga0495584_0150225 3300046491 Bacteria 1183
314 Ga0495584_0193025 3300046491 Bacteria 1035
315 Ga0495585_0001852 3300046492 Bacteria 15999
316 Ga0495585_0010533 3300046492 Bacteria 5500
317 Ga0495585_0010605 3300046492 Bacteria 5477
318 Ga0495585_0026976 3300046492 Bacteria 3279
319 Ga0495585_0027811 3300046492 Bacteria 3227
320 Ga0495594_0002699 3300046499 Bacteria 9218
321 Ga0495594_0008625 3300046499 Bacteria 5252
322 Ga0495594_0020880 3300046499 Bacteria 3492
323 Ga0495594_0170138 3300046499 Bacteria 1239
324 Ga0495596_0014418 3300046500 Bacteria 3331
325 Ga0495596_0022930 3300046500 Bacteria 2536
326 Ga0495607_0000036 3300046501 Bacteria 140259
327 Ga0495607_0000041 3300046501 Bacteria 132443
328 Ga0495607_0003777 3300046501 Bacteria 11448
329 Ga0495607_0004345 3300046501 Bacteria 10459
330 Ga0495607_0006048 3300046501 Bacteria 8568
331 Ga0495607_0006235 3300046501 Bacteria 8408
332 Ga0495607_0007191 3300046501 Bacteria 7732
333 Ga0495607_0015516 3300046501 Bacteria 4935
334 Ga0495607_0019764 3300046501 Bacteria 4272
335 Ga0495607_0040366 3300046501 Bacteria 2779
336 Ga0495607_0107225 3300046501 Bacteria 1486
337 Ga0495607_0111142 3300046501 Bacteria 1452
338 Ga0495583_0000007 3300046506 Bacteria 434661
339 Ga0495583_0000865 3300046506 Bacteria 36805
340 Ga0495583_0001830 3300046506 Bacteria 19857
341 Ga0495583_0005112 3300046506 Bacteria 9038
342 Ga0495606_0000079 3300046507 Bacteria 164788
343 Ga0495606_0000473 3300046507 Bacteria 65980
344 Ga0495606_0001688 3300046507 Bacteria 28502
345 Ga0495606_0016943 3300046507 Bacteria 5530
346 Ga0495606_0026227 3300046507 Bacteria 4155
347 Ga0495606_0076632 3300046507 Bacteria 2089
348 Ga0495606_0148379 3300046507 Bacteria 1378
349 Ga0495610_0000455 3300046512 Bacteria 42440
350 Ga0495610_0005425 3300046512 Bacteria 9065
351 Ga0495610_0007848 3300046512 Bacteria 7020
352 Ga0495610_0023899 3300046512 Bacteria 3310
353 Ga0495610_0027121 3300046512 Bacteria 3050
354 Ga0495610_0036057 3300046512 Bacteria 2531
355 Ga0495610_0062649 3300046512 Bacteria 1763
356 Ga0495610_0063665 3300046512 Bacteria 1745
357 Ga0495616_0000535 3300046513 Bacteria 28683
358 Ga0495616_0000626 3300046513 Bacteria 26459
359 Ga0495616_0000695 3300046513 Bacteria 24905
360 Ga0495616_0001570 3300046513 Bacteria 15739
361 Ga0495616_0008679 3300046513 Bacteria 5997
362 Ga0495616_0011630 3300046513 Bacteria 5033
363 Ga0495616_0019605 3300046513 Bacteria 3688
364 Ga0495616_0063770 3300046513 Bacteria 1800
365 Ga0495620_0000014 3300046515 Bacteria 157890
366 Ga0495620_0000152 3300046515 Bacteria 56303
367 Ga0495620_0001722 3300046515 Bacteria 12919
368 Ga0495620_0004792 3300046515 Bacteria 7602
369 Ga0495620_0011843 3300046515 Bacteria 4534
370 Ga0495620_0058903 3300046515 Bacteria 1606
371 Ga0495630_0009776 3300046517 Bacteria 6903
372 Ga0495630_0016625 3300046517 Bacteria 5380
373 Ga0495630_0019132 3300046517 Bacteria 5033
374 Ga0495631_0000175 3300046518 Bacteria 43711
375 Ga0495631_0000526 3300046518 Bacteria 25725
376 Ga0495631_0005621 3300046518 Bacteria 6546
377 Ga0495631_0009829 3300046518 Bacteria 4761
378 Ga0495632_0000361 3300046519 Bacteria 43155
379 Ga0495632_0003232 3300046519 Bacteria 11690
380 Ga0495632_0005275 3300046519 Bacteria 8585
381 Ga0495632_0008562 3300046519 Bacteria 6258
382 Ga0495632_0010316 3300046519 Bacteria 5542
383 Ga0495632_0074200 3300046519 Bacteria 1630
384 Ga0495632_0108940 3300046519 Bacteria 1301
385 Ga0495637_0000606 3300046520 Bacteria 25539
386 Ga0495637_0000950 3300046520 Bacteria 18520
387 Ga0495637_0001129 3300046520 Bacteria 16349
388 Ga0495637_0001455 3300046520 Bacteria 13939
389 Ga0495637_0011047 3300046520 Bacteria 4349
390 Ga0495637_0023176 3300046520 Bacteria 2825
391 Ga0495637_0048733 3300046520 Bacteria 1783
392 Ga0495643_0061324 3300046522 Bacteria 1995
393 Ga0495644_0002949 3300046523 Bacteria 6761
394 Ga0495648_0000062 3300046524 Bacteria 150125
395 Ga0495648_0002500 3300046524 Bacteria 16867
396 Ga0495648_0002645 3300046524 Bacteria 16251
397 Ga0495648_0013756 3300046524 Bacteria 5964
398 Ga0495648_0017504 3300046524 Bacteria 5118
399 Ga0495648_0025045 3300046524 Bacteria 4048
400 Ga0495648_0030439 3300046524 Bacteria 3568
401 Ga0495648_0067288 3300046524 Bacteria 2095
402 Ga0495648_0087622 3300046524 Bacteria 1752
403 Ga0495648_0201893 3300046524 Bacteria 994
404 Ga0495666_0000908 3300046526 Bacteria 13883
405 Ga0495666_0001595 3300046526 Bacteria 11162
406 Ga0495642_0000006 3300046528 Bacteria 172412
407 Ga0495642_0000044 3300046528 Bacteria 74850
408 Ga0495642_0001263 3300046528 Bacteria 11491
409 Ga0495654_0000113 3300046530 Bacteria 91858
410 Ga0495654_0000600 3300046530 Bacteria 28665
411 Ga0495654_0000688 3300046530 Bacteria 26476
412 Ga0495654_0001563 3300046530 Bacteria 15520
413 Ga0495654_0011138 3300046530 Bacteria 4882
414 Ga0495654_0013073 3300046530 Bacteria 4446
415 Ga0495654_0039041 3300046530 Bacteria 2371
416 Ga0495654_0045145 3300046530 Bacteria 2175
417 Ga0495654_0113151 3300046530 Bacteria 1236
418 Ga0495640_0073221 3300046533 Bacteria 2294
419 Ga0495587_0003803 3300046536 Bacteria 10014
420 Ga0495609_0000004 3300046538 Bacteria 697346
421 Ga0495609_0000016 3300046538 Bacteria 312882
422 Ga0495609_0001070 3300046538 Bacteria 19166
423 Ga0495609_0001736 3300046538 Bacteria 14068
424 Ga0495609_0001936 3300046538 Bacteria 13176
425 Ga0495609_0002104 3300046538 Bacteria 12506
426 Ga0495609_0024039 3300046538 Bacteria 2797
427 Ga0495609_0085081 3300046538 Bacteria 1379
428 Ga0495609_0100384 3300046538 Bacteria 1254
429 Ga0495597_0000800 3300046542 Bacteria 24862
430 Ga0495597_0004988 3300046542 Bacteria 7125
431 Ga0495597_0016693 3300046542 Bacteria 3465
432 Ga0495622_0000414 3300046557 Bacteria 28333
433 Ga0495622_0003325 3300046557 Bacteria 7594
434 Ga0495622_0012172 3300046557 Bacteria 3979
435 Ga0495622_0017579 3300046557 Bacteria 3330
436 Ga0495622_0019411 3300046557 Bacteria 3165
437 Ga0495622_0066032 3300046557 Bacteria 1672
438 Ga0495633_0000051 3300046558 Bacteria 154944
439 Ga0495633_0003219 3300046558 Bacteria 11022
440 Ga0495633_0026211 3300046558 Bacteria 2862
441 Ga0495656_0000803 3300046615 Bacteria 10182
442 Ga0495668_0002764 3300046616 Bacteria 14024
443 Ga0495668_0007019 3300046616 Bacteria 7270
444 Ga0495668_0013998 3300046616 Bacteria 4716
445 Ga0495668_0073636 3300046616 Bacteria 1875
446 Ga0495634_0000815 3300046642 Bacteria 30341
447 Ga0495611_0000019 3300046648 Bacteria 126076
448 Ga0495611_0000548 3300046648 Bacteria 21987
449 Ga0495611_0001208 3300046648 Bacteria 13357
450 Ga0495625_0000084 3300046660 Bacteria 151895
451 Ga0495625_0003120 3300046660 Bacteria 16928
452 Ga0495625_0004063 3300046660 Bacteria 13985
453 Ga0495625_0029114 3300046660 Bacteria 4134
454 Ga0495625_0075677 3300046660 Bacteria 2355
455 Ga0495635_0000522 3300046663 Bacteria 24345
456 Ga0495635_0001311 3300046663 Bacteria 16580
457 Ga0495635_0005853 3300046663 Bacteria 8567
458 Ga0495659_0000119 3300046664 Bacteria 34751
459 Ga0495659_0009781 3300046664 Bacteria 3068
460 Ga0495659_0069119 3300046664 Bacteria 1320
461 Ga0495661_0000035 3300046665 Bacteria 165551
462 Ga0495661_0000051 3300046665 Bacteria 140353
463 Ga0495661_0000106 3300046665 Bacteria 100351
464 Ga0495661_0000269 3300046665 Bacteria 59794
465 Ga0495661_0005186 3300046665 Bacteria 9285
466 Ga0495661_0025282 3300046665 Bacteria 3836
467 Ga0495661_0092887 3300046665 Bacteria 1713
468 Ga0495588_0025528 3300046674 Bacteria 2944
469 Ga0495588_0099878 3300046674 Bacteria 1524
470 Ga0495657_0021575 3300046675 Bacteria 4621
471 Ga0495623_0009066 3300046679 Bacteria 6453
472 Ga0495623_0016801 3300046679 Bacteria 4728
473 Ga0495646_0003353 3300046680 Bacteria 9960
474 Ga0495646_0003495 3300046680 Bacteria 9782
475 Ga0495646_0036488 3300046680 Bacteria 3044
476 Ga0495658_0001304 3300046683 Bacteria 13062
477 Ga0495658_0223789 3300046683 Bacteria 1179
478 Ga0495669_0001087 3300046684 Bacteria 11253
479 Ga0495669_0070768 3300046684 Bacteria 1589
480 Ga0495613_0018880 3300046689 Bacteria 5137
481 Ga0495613_0020085 3300046689 Bacteria 4977
482 Ga0495613_0133447 3300046689 Bacteria 1777
483 Ga0495624_0000237 3300046690 Bacteria 43145
484 Ga0495670_0000455 3300046691 Bacteria 19525
485 Ga0495670_0000777 3300046691 Bacteria 15304
486 Ga0495670_0012161 3300046691 Bacteria 4233
487 Ga0495670_0022360 3300046691 Bacteria 3123
488 Ga0495670_0140081 3300046691 Bacteria 1264
489 Ga0495671_0000210 3300046692 Bacteria 51181
490 Ga0495671_0001187 3300046692 Bacteria 17825
491 Ga0495671_0001243 3300046692 Bacteria 17423
492 Ga0495671_0003398 3300046692 Bacteria 9791
493 Ga0495671_0006777 3300046692 Bacteria 6586
494 Ga0495671_0179235 3300046692 Bacteria 1029
495 Ga0495649_0000748 3300046694 Bacteria 26199
496 Ga0495649_0002964 3300046694 Bacteria 11692
497 Ga0495649_0005325 3300046694 Bacteria 8208
498 Ga0495649_0009159 3300046694 Bacteria 5903
499 Ga0495649_0012051 3300046694 Bacteria 5046
500 Ga0495649_0030939 3300046694 Bacteria 2953
501 Ga0495649_0033050 3300046694 Bacteria 2847
502 Ga0495649_0045854 3300046694 Bacteria 2382
503 Ga0495589_0000326 3300046794 Bacteria 37321
504 Ga0495589_0000352 3300046794 Bacteria 35927
505 Ga0495589_0001450 3300046794 Bacteria 13691
506 Ga0495589_0012195 3300046794 Bacteria 4457
507 Ga0495589_0014155 3300046794 Bacteria 4111
508 Ga0495589_0179640 3300046794 Bacteria 1004
509 Ga0495600_0006261 3300046809 Bacteria 7227
510 Ga0495600_0030109 3300046809 Bacteria 3515
511 Ga0495660_0005494 3300046810 Bacteria 7592
512 Ga0495660_0022962 3300046810 Bacteria 3559
513 Ga0495660_0071874 3300046810 Bacteria 1833
514 Ga0495660_0075648 3300046810 Bacteria 1775
515 Ga0495660_0120459 3300046810 Bacteria 1328
516 Ga0495660_0153188 3300046810 Bacteria 1136
517 Ga0495581_0016010 3300047315 Bacteria 4358
518 Ga0495581_0025132 3300047315 Bacteria 3453
519 Ga0495581_0038645 3300047315 Bacteria 2762
520 Ga0495604_0004748 3300047317 Bacteria 10762
521 Ga0495604_0014324 3300047317 Bacteria 6323
522 Ga0495636_0005847 3300047318 Bacteria 4824
523 Ga0495636_0139341 3300047318 Bacteria 1082
524 Ga0495674_0009374 3300047319 Bacteria 9306
525 Ga0495672_0000787 3300047320 Bacteria 34376
526 Ga0495672_0000817 3300047320 Bacteria 33454
527 Ga0495672_0001555 3300047320 Bacteria 22465
528 Ga0495672_0001980 3300047320 Bacteria 19337
529 Ga0495672_0003332 3300047320 Bacteria 13842
530 Ga0495672_0016601 3300047320 Bacteria 4954
531 Ga0495676_0000368 3300047321 Bacteria 37132
532 Ga0495676_0002558 3300047321 Bacteria 16193
533 Ga0495680_0000683 3300047322 Bacteria 37946
534 Ga0495680_0002029 3300047322 Bacteria 21206
535 Ga0495680_0007735 3300047322 Bacteria 9815
536 Ga0495680_0027810 3300047322 Bacteria 4640
537 Ga0495683_0000004 3300047323 Bacteria 321136
538 Ga0495683_0000318 3300047323 Bacteria 40455
539 Ga0495683_0000356 3300047323 Bacteria 37720
540 Ga0495683_0010106 3300047323 Bacteria 5001
541 Ga0495683_0014694 3300047323 Bacteria 4078
542 Ga0495683_0057425 3300047323 Bacteria 1934
543 Ga0495683_0097249 3300047323 Bacteria 1419
544 Ga0495683_0150538 3300047323 Bacteria 1083
545 Ga0495687_000977 3300047443 Bacteria 28996
546 Ga0495687_006152 3300047443 Bacteria 7435
547 Ga0495687_007971 3300047443 Bacteria 6145
548 Ga0495675_0009385 3300047444 Bacteria 6086
549 Ga0495675_0230582 3300047444 Bacteria 1117
550 Ga0495677_0000848 3300047445 Bacteria 12364
551 Ga0495679_000137 3300047446 Bacteria 65769
552 Ga0495679_000323 3300047446 Bacteria 38033
553 Ga0495679_008771 3300047446 Bacteria 4088
554 Ga0495679_047765 3300047446 Bacteria 1297
555 Ga0495673_0000118 3300047469 Bacteria 147670
556 Ga0495673_0000465 3300047469 Bacteria 43951
557 Ga0495673_0001449 3300047469 Bacteria 18867
558 Ga0495673_0001451 3300047469 Bacteria 18852
559 Ga0495673_0001736 3300047469 Bacteria 16641
560 Ga0495673_0011327 3300047469 Bacteria 4804
561 Ga0495673_0018699 3300047469 Bacteria 3487
562 Ga0495673_0049386 3300047469 Bacteria 1852
563 Ga0495673_0054125 3300047469 Bacteria 1746
564 Ga0495673_0096219 3300047469 Bacteria 1203
565 Ga0495673_0097333 3300047469 Bacteria 1194
566 Ga0495673_0136166 3300047469 Bacteria 961
567 Ga0495681_0000353 3300047470 Bacteria 35846
568 Ga0495681_0000478 3300047470 Bacteria 30665
569 Ga0495681_0002364 3300047470 Bacteria 13536
570 Ga0495681_0003644 3300047470 Bacteria 10695
571 Ga0495681_0010181 3300047470 Bacteria 5711
572 Ga0495681_0014600 3300047470 Bacteria 4490
573 Ga0495681_0023899 3300047470 Bacteria 3233
574 Ga0495681_0027162 3300047470 Bacteria 2966
575 Ga0495684_0010777 3300047471 Bacteria 7065
576 Ga0495686_0092127 3300047472 Bacteria 1838
577 Ga0495593_0001207 3300047673 Bacteria 15111
578 Ga0495593_0022745 3300047673 Bacteria 3487
579 Ga0495593_0029111 3300047673 Bacteria 3030
580 Ga0495593_0124356 3300047673 Bacteria 1311
581 Ga0495626_0000002 3300048091 Bacteria 436012
582 Ga0495626_0000064 3300048091 Bacteria 142060
583 Ga0495626_0000616 3300048091 Bacteria 34739
584 Ga0495626_0000958 3300048091 Bacteria 25047
585 Ga0495626_0001601 3300048091 Bacteria 17648
586 Ga0495626_0002256 3300048091 Bacteria 13795
587 Ga0495626_0016259 3300048091 Bacteria 3783
588 Ga0495626_0026985 3300048091 Bacteria 2794
589 Ga0495626_0027531 3300048091 Bacteria 2764
590 Ga0495626_0040702 3300048091 Bacteria 2193
591 Ga0496102_0000774 3300048905 Bacteria 31153
592 Ga0496102_0681244 3300048905 Bacteria 951
593 Ga0496103_0020077 3300048906 Bacteria 4012
594 Ga0496106_0269326 3300048909 Bacteria 1363
595 Ga0496106_0276004 3300048909 Bacteria 1346
596 Ga0496108_0269866 3300048911 Bacteria 1481
597 Ga0496109_0052306 3300048912 Bacteria 3722
598 Ga0496110_0099192 3300048913 Bacteria 2611
599 Ga0496110_0177998 3300048913 Bacteria 1931
600 Ga0496110_0527215 3300048913 Bacteria 1074
601 Ga0496112_0336042 3300048915 Bacteria 1454
602 Ga0496113_0187105 3300048916 Bacteria 1643
603 Ga0496113_0275572 3300048916 Bacteria 1345
604 Ga0496116_0000038 3300048919 Bacteria 370217
605 Ga0496116_0000382 3300048919 Bacteria 65862
606 Ga0496116_0001933 3300048919 Bacteria 22333
607 Ga0496116_0002265 3300048919 Bacteria 20408
608 Ga0496116_0025816 3300048919 Bacteria 4309
609 Ga0496117_0007085 3300048920 Bacteria 11081
610 Ga0496117_0030407 3300048920 Bacteria 4145
611 Ga0496117_0037708 3300048920 Bacteria 3596
612 Ga0496117_0050196 3300048920 Bacteria 2960
613 Ga0496117_0101515 3300048920 Bacteria 1818
614 Ga0496118_0027699 3300048921 Bacteria 4788
615 Ga0496118_0028593 3300048921 Bacteria 4691
616 Ga0496118_0031937 3300048921 Bacteria 4349
617 Ga0496118_0034082 3300048921 Bacteria 4163
618 Ga0496118_0044902 3300048921 Bacteria 3455
619 Ga0496118_0129631 3300048921 Bacteria 1623
620 Ga0496118_0133520 3300048921 Bacteria 1588
621 Ga0496119_0166960 3300048922 Bacteria 1165
622 Ga0496120_0025586 3300048923 Bacteria 3661
623 Ga0496121_0000589 3300048924 Bacteria 68077
624 Ga0496121_0001708 3300048924 Bacteria 35986
625 Ga0496121_0001828 3300048924 Bacteria 34313
626 Ga0496121_0004020 3300048924 Bacteria 20222
627 Ga0496121_0036966 3300048924 Bacteria 4343
628 Ga0496121_0249323 3300048924 Bacteria 1232
629 Ga0496122_0000411 3300048925 Bacteria 90936
630 Ga0496122_0011920 3300048925 Bacteria 8730
631 Ga0496122_0025179 3300048925 Bacteria 5178
632 Ga0496122_0032954 3300048925 Bacteria 4270
633 Ga0496122_0062334 3300048925 Bacteria 2730
634 Ga0496122_0187453 3300048925 Bacteria 1225
635 Ga0496123_0000055 3300048926 Bacteria 233626
636 Ga0496123_0003979 3300048926 Bacteria 16005
637 Ga0496123_0008610 3300048926 Bacteria 9338
638 Ga0496123_0025966 3300048926 Bacteria 4401
639 Ga0496123_0062936 3300048926 Bacteria 2373
640 Ga0496124_0000212 3300048927 Bacteria 113713
641 Ga0496124_0001124 3300048927 Bacteria 42065
642 Ga0496124_0004348 3300048927 Bacteria 16595
643 Ga0496124_0045697 3300048927 Bacteria 3753
644 Ga0496124_0081959 3300048927 Bacteria 2649
645 Ga0496124_0092891 3300048927 Bacteria 2457
646 Ga0496124_0128345 3300048927 Bacteria 2018
647 Ga0496124_0146638 3300048927 Bacteria 1856
648 Ga0496124_0204453 3300048927 Bacteria 1499
649 Ga0496125_0003572 3300048928 Bacteria 18713
650 Ga0496125_0004187 3300048928 Bacteria 16817
651 Ga0496125_0039387 3300048928 Bacteria 4071
652 Ga0496125_0328939 3300048928 Bacteria 922
653 Ga0496126_0032027 3300048929 Bacteria 4959
654 Ga0496126_0044557 3300048929 Bacteria 4084
655 Ga0496126_0044914 3300048929 Bacteria 4065
656 Ga0496126_0160606 3300048929 Bacteria 1920
657 Ga0495678_000014 3300049459 Bacteria 313755
658 Ga0495678_000578 3300049459 Bacteria 34746
659 Ga0495678_000628 3300049459 Bacteria 32813
660 Ga0495678_002924 3300049459 Bacteria 10939
661 Ga0495678_003304 3300049459 Bacteria 10062
662 Ga0495678_003870 3300049459 Bacteria 8986
663 Ga0495678_004245 3300049459 Bacteria 8392
664 Ga0495678_013459 3300049459 Bacteria 3839
665 Ga0495678_017896 3300049459 Bacteria 3198
666 Ga0495678_028443 3300049459 Bacteria 2359
667 Ga0495678_077094 3300049459 Bacteria 1206
668 Ga0495682_0000025 3300049460 Bacteria 147931
669 Ga0495682_0000099 3300049460 Bacteria 76287
670 Ga0495682_0001018 3300049460 Bacteria 16623
671 Ga0495682_0006579 3300049460 Bacteria 4697
672 Ga0495682_0006967 3300049460 Bacteria 4531
673 Ga0495682_0007925 3300049460 Bacteria 4203
674 Ga0495682_0030020 3300049460 Bacteria 2012
675 Ga0501034_0281838 3300049571 Bacteria 1601
676 nmdc:mga0qj67_14303_c1 3300050509 Bacteria 5997
677 nmdc:mga08y16_36124_c1 3300050511 Bacteria 5189
678 nmdc:mga08y16_376161_c1 3300050511 Bacteria 1456
679 nmdc:mga08x19_247214_c1 3300050514 Bacteria 1231
680 Ga0495601_0072036 3300053077 Bacteria 2207
681 Ga0495619_0055238 3300053085 Bacteria 2629
682 Ga0500650_0000050 3300053098 Bacteria 39314
683 Ga0500572_000710 3300053111 Bacteria 10800

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046452 Ga0495617_134492 Ga0495617_134492_22_777 251
2 3300046471 Ga0495650_0069785 Ga0495650_0069785_34_789 251
3 3300046474 Ga0495605_0231102 Ga0495605_0231102_22_777 251
4 3300046492 Ga0495585_0010533 Ga0495585_0010533_4720_5475 251
5 3300046524 Ga0495648_0067288 Ga0495648_0067288_11_766 251
6 3300046616 Ga0495668_0073636 Ga0495668_0073636_1097_1852 251
7 3300046648 Ga0495611_0001208 Ga0495611_0001208_23_778 251
8 3300046674 Ga0495588_0099878 Ga0495588_0099878_756_1511 251
9 3300046689 Ga0495613_0133447 Ga0495613_0133447_22_777 251
10 3300047469 Ga0495673_0136166 Ga0495673_0136166_40_843 267
11 3300046557 Ga0495622_0019411 Ga0495622_0019411_2254_3066 270
12 3300048915 Ga0496112_0336042 Ga0496112_0336042_376_1194 272
13 3300035119 Ga0373956_0031941 Ga0373956_0031941_928_1866 273
14 3300035120 Ga0373957_0005501 Ga0373957_0005501_1566_2501 273
15 3300036401 Ga0373937_0003245 Ga0373937_0003245_9582_10520 273
16 3300046691 Ga0495670_0022360 Ga0495670_0022360_33_854 273
17 3300047444 Ga0495675_0230582 Ga0495675_0230582_58_879 273
18 3300048927 Ga0496124_0045697 Ga0496124_0045697_17_838 273
19 3300048928 Ga0496125_0328939 Ga0496125_0328939_86_907 273
20 3300050514 nmdc:mga08x19_247214_c1 nmdc:mga08x19_247214_c1_366_1187 273
21 3300046463 Ga0495653_0069799 Ga0495653_0069799_1651_2481 276
22 3300046538 Ga0495609_0100384 Ga0495609_0100384_10_840 276
23 3300046692 Ga0495671_0179235 Ga0495671_0179235_33_863 276
24 3300047317 Ga0495604_0004748 Ga0495604_0004748_1523_2353 276
25 3300047323 Ga0495683_0057425 Ga0495683_0057425_1087_1917 276
26 3300047469 Ga0495673_0054125 Ga0495673_0054125_894_1724 276
27 3300048905 Ga0496102_0000774 Ga0496102_0000774_20931_21761 276
28 3300048906 Ga0496103_0020077 Ga0496103_0020077_2998_3828 276
29 3300048920 Ga0496117_0037708 Ga0496117_0037708_2627_3457 276
30 3300048921 Ga0496118_0034082 Ga0496118_0034082_466_1296 276
31 3300048929 Ga0496126_0044914 Ga0496126_0044914_40_870 276
32 3300044712 Ga0453684_0031837 Ga0453684_0031837_4102_5010 287
33 3300009036 Ga0105244_10128256 Ga0105244_101282562 289
34 3300009092 Ga0105250_10001563 Ga0105250_100015635 289
35 3300014497 Ga0182008_10016275 Ga0182008_100162752 289
36 3300025711 Ga0207696_1000460 Ga0207696_100046013 289
37 3300046492 Ga0495585_0001852 Ga0495585_0001852_12425_13309 289
38 iso_pu_bacteria 2599185155 2599328692 289
39 iso_pu_bacteria 2738541271 2738688111 289
40 iso_pu_bacteria 2738543016 2739263454 289
41 iso_pu_bacteria 2826581358 2826582065 289
42 iso_pu_bacteria 2842849001 2842852402 289
43 3300046694 Ga0495649_0030939 Ga0495649_0030939_12_884 290
44 iso_pu_bacteria 2511231004 2511255184 290
45 iso_pu_bacteria 2511231006 2511265490 290
46 iso_pu_bacteria 2511231007 2511271812 290
47 iso_pu_bacteria 2511231008 2511277939 290
48 iso_pu_bacteria 2511231010 2511288058 290
49 iso_pu_bacteria 2511231011 2511298692 290
50 iso_pu_bacteria 2511231012 2511301534 290
51 iso_pu_bacteria 2511231014 2511312488 290
52 iso_pu_bacteria 2511231015 2511318146 290
53 iso_pu_bacteria 2511231016 2511329408 290
54 iso_pu_bacteria 2511231017 2511334570 290
55 iso_pu_bacteria 2511231018 2511337066 290
56 iso_pu_bacteria 2511231019 2511343383 290
57 iso_pu_bacteria 2511231020 2511351799 290
58 iso_pu_bacteria 2511231022 2511363437 290
59 iso_pu_bacteria 2511231023 2511371339 290
60 iso_pu_bacteria 2511231031 2511411659 290
61 iso_pu_bacteria 2512047018 2512327218 290
62 iso_pu_bacteria 2554235341 2555670017 290
63 iso_pu_bacteria 2582580891 2583792409 290
64 iso_pu_bacteria 2597489887 2597858097 290
65 iso_pu_bacteria 2597489888 2597863931 290
66 iso_pu_bacteria 2597489889 2597869836 290
67 iso_pu_bacteria 2599185160 2599352947 290
68 iso_pu_bacteria 2599185161 2599359299 290
69 iso_pu_bacteria 2599185162 2599365180 290
70 iso_pu_bacteria 2599185163 2599371993 290
71 iso_pu_bacteria 2599185164 2599378055 290
72 iso_pu_bacteria 2599185165 2599384568 290
73 iso_pu_bacteria 2599185166 2599390851 290
74 iso_pu_bacteria 2599185167 2599398328 290
75 iso_pu_bacteria 2599185168 2599403036 290
76 iso_pu_bacteria 2599185179 2599450350 290
77 iso_pu_bacteria 2599185181 2599459781 290
78 iso_pu_bacteria 2599185182 2599465873 290
79 iso_pu_bacteria 2599185185 2599485123 290
80 iso_pu_bacteria 2599185186 2599488802 290
81 iso_pu_bacteria 2599185189 2599507376 290
82 iso_pu_bacteria 2599185190 2599512832 290
83 iso_pu_bacteria 2599185191 2599522138 290
84 iso_pu_bacteria 2599185257 2599802735 290
85 iso_pu_bacteria 2599185288 2599881332 290
86 iso_pu_bacteria 2599185290 2599891509 290
87 iso_pu_bacteria 2599185303 2599946648 290
88 iso_pu_bacteria 2599185307 2599970024 290
89 iso_pu_bacteria 2599185356 2600212388 290
90 iso_pu_bacteria 2600254931 2600363048 290
91 iso_pu_bacteria 2600255296 2601691872 290
92 iso_pu_bacteria 2600255313 2601772556 290
93 iso_pu_bacteria 2600255318 2601798974 290
94 iso_pu_bacteria 2603880185 2606077869 290
95 iso_pu_bacteria 2603880199 2606129956 290
96 iso_pu_bacteria 2619619299 2621299891 290
97 iso_pu_bacteria 2623620443 2624480905 290
98 iso_pu_bacteria 2623620446 2624492220 290
99 iso_pu_bacteria 2643221571 2643874215 290
100 iso_pu_bacteria 2643221633 2644189895 290
101 iso_pu_bacteria 2643221713 2644620201 290
102 iso_pu_bacteria 2667528171 2671095469 290
103 iso_pu_bacteria 2671180172 2671769644 290
104 iso_pu_bacteria 2675903420 2677896552 290
105 iso_pu_bacteria 2713897149 2715756958 290
106 iso_pu_bacteria 2721755607 2723248719 290
107 iso_pu_bacteria 2738541265 2738669888 290
108 iso_pu_bacteria 2738541282 2738748281 290
109 iso_pu_bacteria 2738541294 2738806849 290
110 iso_pu_bacteria 2738541303 2738857323 290
111 iso_pu_bacteria 2738541309 2738894209 290
112 iso_pu_bacteria 2738543004 2739197519 290
113 iso_pu_bacteria 2738543015 2739258764 290
114 iso_pu_bacteria 2738543025 2739311825 290
115 iso_pu_bacteria 2740892503 2743737585 290
116 iso_pu_bacteria 2765235841 2765584020 290
117 iso_pu_bacteria 2773857670 2774122518 290
118 iso_pu_bacteria 2773857673 2774133717 290
119 iso_pu_bacteria 2784132063 2784264522 290
120 iso_pu_bacteria 2784132072 2784314649 290
121 iso_pu_bacteria 2808606376 2808922455 290
122 iso_pu_bacteria 2808606377 2808929134 290
123 iso_pu_bacteria 2808606378 2808938126 290
124 iso_pu_bacteria 2808606380 2808948484 290
125 iso_pu_bacteria 2808606381 2808951255 290
126 iso_pu_bacteria 2808606382 2808958518 290
127 iso_pu_bacteria 2808606383 2808966378 290
128 iso_pu_bacteria 2808606385 2808979104 290
129 iso_pu_bacteria 2808606388 2808995013 290
130 iso_pu_bacteria 2808606389 2808996865 290
131 iso_pu_bacteria 2816332298 2817491184 290
132 iso_pu_bacteria 2818991456 2819658812 290
133 iso_pu_bacteria 2818991464 2819701054 290
134 iso_pu_bacteria 2834028612 2834034023 290
135 iso_pu_bacteria 2842826826 2842826940 290
136 iso_pu_bacteria 2842837860 2842839289 290
137 iso_pu_bacteria 2844665904 2844670644 290
138 iso_pu_bacteria 2852612431 2852614452 290
139 iso_pu_bacteria 2852657418 2852662060 290
140 iso_pu_bacteria 2852667396 2852667810 290
141 iso_pu_bacteria 2860339153 2860342758 290
142 iso_pu_bacteria 2860867994 2860870615 290
143 iso_pu_bacteria 2878029506 2878032837 290
144 iso_pu_bacteria 2880230671 2880233422 290
145 iso_pu_bacteria 2904518522 2904520216 290
146 iso_pu_bacteria 2904550169 2904552457 290
147 iso_pu_bacteria 2908446538 2908449744 290
148 iso_pu_bacteria 2917070673 2917073840 290
149 iso_pu_bacteria 2919063839 2919064868 290
150 iso_pu_bacteria 2919456309 2919460669 290
151 iso_pu_bacteria 2919697872 2919698406 290
152 iso_pu_bacteria 2929189879 2929192610 290
153 iso_pu_bacteria 2931390751 2931394004 290
154 iso_pu_bacteria 2931396565 2931401703 290
155 iso_pu_bacteria 2935353572 2935357105 290
156 iso_pu_bacteria 2945928738 2945933464 290
157 iso_pu_bacteria 2945961074 2945963428 290
158 iso_pu_bacteria 2946006987 2946009781 290
159 iso_pu_bacteria 2946027586 2946030936 290
160 iso_pu_bacteria 2947233263 2947237749 290
161 iso_pu_bacteria 2969304461 2969307618 290
162 iso_pu_bacteria 2988728565 2988728918 290
163 iso_pu_bacteria 3007395558 3007396009 290
164 iso_pu_bacteria 3007419365 3007422903 290
165 iso_pu_bacteria 3007511990 3007514402 290
166 iso_pu_bacteria 3007614139 3007619002 290
167 iso_pu_bacteria 3007619802 3007620164 290
168 iso_pu_bacteria 3007718800 3007719871 290
169 iso_pu_bacteria 637000220 637320385 290
170 iso_pu_bacteria 8002745576 8002747610 290
171 iso_pu_bacteria 8011350971 8011354767 290
172 iso_pu_bacteria 8019769354 8019773204 290
173 iso_pu_bacteria 8019775933 8019779165 290
174 iso_pu_bacteria 8054285046 8054286658 290
175 iso_pu_bacteria 8054347763 8054352277 290
176 iso_pu_bacteria 8054503363 8054506364 290
177 iso_pu_bacteria 8054929484 8054932687 290
178 iso_pu_bacteria 8055817908 8055821113 290
179 iso_pu_bacteria 8056131705 8056134796 290
180 iso_pu_bacteria 8056148874 8056154771 290
181 iso_pu_bacteria 8056161164 8056166068 290
182 iso_pu_bacteria 8056172158 8056174282 290
183 iso_pu_bacteria 8056569372 8056573859 290
184 iso_pu_bacteria 8057798959 8057800529 290
185 3300053098 Ga0500650_0000050 Ga0500650_0000050_22470_23390 291
186 iso_pu_bacteria 2606217733 2608381082 291
187 iso_pu_bacteria 2919493220 2919495018 291
188 iso_pu_bacteria 2919543075 2919545972 291
189 3300005331 Ga0070670_100107652 Ga0070670_1001076521 292
190 3300005335 Ga0070666_10016235 Ga0070666_100162356 292
191 3300005338 Ga0068868_100001680 Ga0068868_1000016806 292
192 3300005343 Ga0070687_100016880 Ga0070687_1000168802 292
193 3300005355 Ga0070671_100001324 Ga0070671_10000132415 292
194 3300005535 Ga0070684_100078344 Ga0070684_1000783442 292
195 3300005547 Ga0070693_100100157 Ga0070693_1001001572 292
196 3300005617 Ga0068859_100015482 Ga0068859_1000154825 292
197 3300005841 Ga0068863_100004929 Ga0068863_10000492910 292
198 3300005843 Ga0068860_100290580 Ga0068860_1002905802 292
199 3300006237 Ga0097621_100034439 Ga0097621_1000344393 292
200 3300006844 Ga0075428_100056910 Ga0075428_1000569104 292
201 3300006846 Ga0075430_100013614 Ga0075430_1000136142 292
202 3300006880 Ga0075429_100262130 Ga0075429_1002621302 292
203 3300006931 Ga0097620_100015481 Ga0097620_1000154815 292
204 3300009093 Ga0105240_10142203 Ga0105240_101422032 292
205 3300009094 Ga0111539_10046032 Ga0111539_100460322 292
206 3300009094 Ga0111539_10474394 Ga0111539_104743942 292
207 3300009098 Ga0105245_10014982 Ga0105245_100149823 292
208 3300009101 Ga0105247_10001526 Ga0105247_1000152615 292
209 3300010375 Ga0105239_10022541 Ga0105239_100225413 292
210 3300011119 Ga0105246_10245719 Ga0105246_102457192 292
211 3300013296 Ga0157374_10031348 Ga0157374_100313483 292
212 3300013306 Ga0163162_10160225 Ga0163162_101602252 292
213 3300014325 Ga0163163_10003261 Ga0163163_100032615 292
214 3300014968 Ga0157379_10020541 Ga0157379_100205412 292
215 3300025900 Ga0207710_10014435 Ga0207710_100144354 292
216 3300025903 Ga0207680_10063301 Ga0207680_100633012 292
217 3300025925 Ga0207650_10228408 Ga0207650_102284082 292
218 3300025926 Ga0207659_10342895 Ga0207659_103428952 292
219 3300025936 Ga0207670_10107537 Ga0207670_101075372 292
220 3300026035 Ga0207703_10092538 Ga0207703_100925383 292
221 3300026088 Ga0207641_10027117 Ga0207641_100271176 292
222 3300026095 Ga0207676_10005759 Ga0207676_1000575911 292
223 3300026121 Ga0207683_10116531 Ga0207683_101165313 292
224 3300027907 Ga0207428_10129918 Ga0207428_101299182 292
225 3300031691 Ga0316579_10013422 Ga0316579_100134223 292
226 3300031733 Ga0316577_10050573 Ga0316577_100505732 292
227 3300035242 Ga0373962_0025273 Ga0373962_0025273_564_1505 292
228 3300036647 Ga0316582_0081291 Ga0316582_0081291_1159_2076 292
229 3300046459 Ga0495629_0007303 Ga0495629_0007303_443_1339 292
230 3300046476 Ga0495662_0093818 Ga0495662_0093818_414_1310 292
231 3300046499 Ga0495594_0002699 Ga0495594_0002699_2610_3506 292
232 3300046533 Ga0495640_0073221 Ga0495640_0073221_512_1408 292
233 3300046663 Ga0495635_0001311 Ga0495635_0001311_7469_8365 292
234 3300046683 Ga0495658_0001304 Ga0495658_0001304_9754_10650 292
235 3300046683 Ga0495658_0223789 Ga0495658_0223789_118_1059 292
236 3300046689 Ga0495613_0018880 Ga0495613_0018880_984_1880 292
237 3300047315 Ga0495581_0016010 Ga0495581_0016010_3207_4103 292
238 3300047322 Ga0495680_0000683 Ga0495680_0000683_1516_2412 292
239 3300048911 Ga0496108_0269866 Ga0496108_0269866_489_1430 292
240 3300048912 Ga0496109_0052306 Ga0496109_0052306_2532_3473 292
241 3300048916 Ga0496113_0275572 Ga0496113_0275572_291_1232 292
242 3300050509 nmdc:mga0qj67_14303_c1 nmdc:mga0qj67_14303_c1_3522_4418 292
243 3300050511 nmdc:mga08y16_36124_c1 nmdc:mga08y16_36124_c1_1446_2342 292
244 3300050511 nmdc:mga08y16_376161_c1 nmdc:mga08y16_376161_c1_151_1047 292
245 3300053077 Ga0495601_0072036 Ga0495601_0072036_720_1661 292
246 3300053085 Ga0495619_0055238 Ga0495619_0055238_578_1474 292
247 iso_pu_bacteria 2643221589 2643956782 292
248 iso_pu_bacteria 2643221602 2644024705 292
249 iso_pu_bacteria 2923153595 2923156627 292
250 iso_pu_bacteria 2984286254 2984289454 292
251 iso_pu_bacteria 8015687852 8015690814 292
252 iso_pu_bacteria 8055770955 8055773954 292
253 3300005290 Ga0065712_10000124 Ga0065712_1000012454 293
254 3300009036 Ga0105244_10000277 Ga0105244_1000027738 293
255 3300009148 Ga0105243_10230220 Ga0105243_102302202 293
256 3300025728 Ga0207655_1003616 Ga0207655_10036163 293
257 3300036647 Ga0316582_0047164 Ga0316582_0047164_905_1819 293
258 3300046538 Ga0495609_0024039 Ga0495609_0024039_1812_2693 293
259 3300048927 Ga0496124_0000212 Ga0496124_0000212_56895_57776 293
260 3300048927 Ga0496124_0128345 Ga0496124_0128345_1087_1968 293
261 3300049571 Ga0501034_0281838 Ga0501034_0281838_253_1134 293
262 iso_pu_bacteria 2510065053 2510282571 293
263 iso_pu_bacteria 2510065055 2510294555 293
264 iso_pu_bacteria 2510065058 2510311149 293
265 iso_pu_bacteria 2773857672 2774129385 293
266 iso_pu_bacteria 2917832318 2917836668 293
267 iso_pu_bacteria 2919125081 2919126287 293
268 iso_pu_bacteria 2974298342 2974302209 293
269 iso_pu_bacteria 2984499530 2984500220 293
270 iso_pu_bacteria 2984504281 2984506687 293
271 iso_pu_bacteria 8016728285 8016731282 293
272 2124908027 MRS2a_Contig_19 MRS2a_00089420 294
273 2124908027 MRS2a_Contig_7067 MRS2a_00529750 294
274 3300002737 JGI25162J39368_1000004 JGI25162J39368_100000485 294
275 3300002737 JGI25162J39368_1000065 JGI25162J39368_100006555 294
276 3300002738 JGI25154J39366_1003271 JGI25154J39366_10032712 294
277 3300002771 JGI25163J39215_1001383 JGI25163J39215_10013835 294
278 3300002771 JGI25163J39215_1001387 JGI25163J39215_10013875 294
279 3300002772 JGI25164J39214_1000031 JGI25164J39214_100003186 294
280 3300002772 JGI25164J39214_1000038 JGI25164J39214_100003875 294
281 3300003214 JGI25165J46597_1000011 JGI25165J46597_100001185 294
282 3300003214 JGI25165J46597_1000126 JGI25165J46597_100012675 294
283 3300003751 Ga0055538_1000007 Ga0055538_1000007156 294
284 3300003752 Ga0055539_1000011 Ga0055539_1000011156 294
285 3300003756 Ga0055533_1000014 Ga0055533_1000014156 294
286 3300003758 Ga0055532_1000009 Ga0055532_1000009156 294
287 3300003759 Ga0055525_1000016 Ga0055525_1000016156 294
288 3300003781 Ga0055536_1000025 Ga0055536_1000025136 294
289 3300003781 Ga0055536_1000053 Ga0055536_100005382 294
290 3300003791 Ga0055530_10000007 Ga0055530_10000007136 294
291 3300003791 Ga0055530_10000011 Ga0055530_1000001188 294
292 3300003791 Ga0055530_10000219 Ga0055530_1000021928 294
293 3300003792 Ga0055540_1000006 Ga0055540_100000621 294
294 3300003792 Ga0055540_1000034 Ga0055540_100003488 294
295 3300003792 Ga0055540_1000125 Ga0055540_100012523 294
296 3300003794 Ga0055531_10001653 Ga0055531_100016539 294
297 3300003841 Ga0055541_1000008 Ga0055541_1000008156 294
298 3300005288 Ga0065714_10000048 Ga0065714_1000004812 294
299 3300005288 Ga0065714_10002770 Ga0065714_100027702 294
300 3300005288 Ga0065714_10065674 Ga0065714_100656745 294
301 3300005288 Ga0065714_10069849 Ga0065714_100698492 294
302 3300005288 Ga0065714_10088799 Ga0065714_100887991 294
303 3300005290 Ga0065712_10000445 Ga0065712_100004458 294
304 3300005293 Ga0065715_10101172 Ga0065715_101011722 294
305 3300005331 Ga0070670_100000079 Ga0070670_10000007961 294
306 3300005344 Ga0070661_100000024 Ga0070661_10000002463 294
307 3300005353 Ga0070669_100001022 Ga0070669_10000102217 294
308 3300005353 Ga0070669_100180512 Ga0070669_1001805122 294
309 3300005457 Ga0070662_100090587 Ga0070662_1000905872 294
310 3300005539 Ga0068853_100039228 Ga0068853_1000392284 294
311 3300005548 Ga0070665_100039437 Ga0070665_1000394374 294
312 3300005548 Ga0070665_100269699 Ga0070665_1002696992 294
313 3300005564 Ga0070664_100000024 Ga0070664_10000002457 294
314 3300005834 Ga0068851_10000552 Ga0068851_100005529 294
315 3300006051 Ga0075364_10009199 Ga0075364_100091996 294
316 3300006058 Ga0075432_10000898 Ga0075432_100008983 294
317 3300006058 Ga0075432_10002446 Ga0075432_100024462 294
318 3300006058 Ga0075432_10005364 Ga0075432_100053645 294
319 3300006177 Ga0075362_10005910 Ga0075362_100059102 294
320 3300006186 Ga0075369_10041465 Ga0075369_100414652 294
321 3300006914 Ga0075436_100087080 Ga0075436_1000870802 294
322 3300006946 Ga0079104_1000143 Ga0079104_100014313 294
323 3300009011 Ga0105251_10000001 Ga0105251_10000001322 294
324 3300009011 Ga0105251_10000571 Ga0105251_1000057117 294
325 3300009011 Ga0105251_10008065 Ga0105251_100080652 294
326 3300009011 Ga0105251_10016806 Ga0105251_100168062 294
327 3300009011 Ga0105251_10023304 Ga0105251_100233042 294
328 3300009011 Ga0105251_10030919 Ga0105251_100309192 294
329 3300009011 Ga0105251_10045232 Ga0105251_100452321 294
330 3300009011 Ga0105251_10076209 Ga0105251_100762092 294
331 3300009036 Ga0105244_10000325 Ga0105244_1000032530 294
332 3300009036 Ga0105244_10000907 Ga0105244_1000090712 294
333 3300009036 Ga0105244_10004021 Ga0105244_100040213 294
334 3300009036 Ga0105244_10005358 Ga0105244_100053582 294
335 3300009036 Ga0105244_10006752 Ga0105244_100067526 294
336 3300009036 Ga0105244_10008600 Ga0105244_100086002 294
337 3300009036 Ga0105244_10014311 Ga0105244_100143115 294
338 3300009036 Ga0105244_10021452 Ga0105244_100214523 294
339 3300009036 Ga0105244_10036305 Ga0105244_100363052 294
340 3300009036 Ga0105244_10072259 Ga0105244_100722592 294
341 3300009036 Ga0105244_10107362 Ga0105244_101073621 294
342 3300009092 Ga0105250_10000015 Ga0105250_10000015196 294
343 3300009092 Ga0105250_10000679 Ga0105250_100006792 294
344 3300009092 Ga0105250_10008485 Ga0105250_100084855 294
345 3300009092 Ga0105250_10020438 Ga0105250_100204382 294
346 3300009148 Ga0105243_10000020 Ga0105243_10000020141 294
347 3300009148 Ga0105243_10067859 Ga0105243_100678592 294
348 3300009176 Ga0105242_10002506 Ga0105242_100025063 294
349 3300009545 Ga0105237_10000042 Ga0105237_10000042118 294
350 3300011119 Ga0105246_10000010 Ga0105246_1000001013 294
351 3300011119 Ga0105246_10000641 Ga0105246_100006412 294
352 3300011119 Ga0105246_10002448 Ga0105246_100024487 294
353 3300012498 Ga0157345_1000060 Ga0157345_10000602 294
354 3300012498 Ga0157345_1001954 Ga0157345_10019542 294
355 3300013100 Ga0157373_10001425 Ga0157373_100014252 294
356 3300013100 Ga0157373_10003868 Ga0157373_100038686 294
357 3300013100 Ga0157373_10029199 Ga0157373_100291994 294
358 3300013102 Ga0157371_10000635 Ga0157371_100006359 294
359 3300013102 Ga0157371_10022147 Ga0157371_100221472 294
360 3300013102 Ga0157371_10221470 Ga0157371_102214702 294
361 3300013104 Ga0157370_10002554 Ga0157370_1000255415 294
362 3300013104 Ga0157370_10016221 Ga0157370_100162214 294
363 3300013104 Ga0157370_10332993 Ga0157370_103329932 294
364 3300013105 Ga0157369_10001667 Ga0157369_100016672 294
365 3300013105 Ga0157369_10004855 Ga0157369_100048555 294
366 3300013105 Ga0157369_10019056 Ga0157369_100190568 294
367 3300013306 Ga0163162_10000169 Ga0163162_1000016918 294
368 3300013306 Ga0163162_10015519 Ga0163162_100155195 294
369 3300013306 Ga0163162_10149019 Ga0163162_101490192 294
370 3300013306 Ga0163162_10477404 Ga0163162_104774042 294
371 3300013306 Ga0163162_10590966 Ga0163162_105909662 294
372 3300013307 Ga0157372_10004428 Ga0157372_100044284 294
373 3300013308 Ga0157375_10001060 Ga0157375_1000106021 294
374 3300013308 Ga0157375_10083123 Ga0157375_100831232 294
375 3300013308 Ga0157375_10226048 Ga0157375_102260482 294
376 3300014497 Ga0182008_10001212 Ga0182008_100012122 294
377 3300014497 Ga0182008_10002733 Ga0182008_1000273311 294
378 3300014497 Ga0182008_10003513 Ga0182008_100035132 294
379 3300014497 Ga0182008_10014394 Ga0182008_100143945 294
380 3300015261 Ga0182006_1000165 Ga0182006_100016558 294
381 3300015261 Ga0182006_1000387 Ga0182006_100038710 294
382 3300015261 Ga0182006_1007913 Ga0182006_10079135 294
383 3300015261 Ga0182006_1025370 Ga0182006_10253702 294
384 3300015262 Ga0182007_10000108 Ga0182007_1000010839 294
385 3300015262 Ga0182007_10009387 Ga0182007_100093874 294
386 3300015265 Ga0182005_1000470 Ga0182005_100047012 294
387 3300015265 Ga0182005_1003132 Ga0182005_10031324 294
388 3300015265 Ga0182005_1005478 Ga0182005_10054782 294
389 3300015265 Ga0182005_1013514 Ga0182005_10135142 294
390 3300015265 Ga0182005_1038670 Ga0182005_10386702 294
391 3300017792 Ga0163161_10001803 Ga0163161_1000180310 294
392 3300017792 Ga0163161_10003345 Ga0163161_100033454 294
393 3300017792 Ga0163161_10003497 Ga0163161_100034978 294
394 3300017792 Ga0163161_10009162 Ga0163161_100091622 294
395 3300017792 Ga0163161_10023843 Ga0163161_100238432 294
396 3300017792 Ga0163161_10029906 Ga0163161_100299062 294
397 3300025206 Ga0209435_100687 Ga0209435_1006875 294
398 3300025207 Ga0209760_100032 Ga0209760_10003251 294
399 3300025207 Ga0209760_100036 Ga0209760_10003671 294
400 3300025224 Ga0209784_100023 Ga0209784_100023154 294
401 3300025225 Ga0209566_100019 Ga0209566_100019167 294
402 3300025226 Ga0209674_100034 Ga0209674_100034167 294
403 3300025229 Ga0209147_100027 Ga0209147_100027169 294
404 3300025230 Ga0209563_100037 Ga0209563_100037167 294
405 3300025230 Ga0209563_100298 Ga0209563_10029812 294
406 3300025231 Ga0207427_100003 Ga0207427_10000385 294
407 3300025231 Ga0207427_100004 Ga0207427_10000493 294
408 3300025233 Ga0209437_100002 Ga0209437_100002928 294
409 3300025233 Ga0209437_100025 Ga0209437_100025390 294
410 3300025246 Ga0209646_1000318 Ga0209646_100031824 294
411 3300025253 Ga0209677_100021 Ga0209677_100021167 294
412 3300025261 Ga0209233_1000004 Ga0209233_1000004497 294
413 3300025261 Ga0209233_1000145 Ga0209233_100014593 294
414 3300025291 Ga0209675_1011697 Ga0209675_10116972 294
415 3300025292 Ga0209676_1000002 Ga0209676_1000002985 294
416 3300025292 Ga0209676_1000003 Ga0209676_1000003675 294
417 3300025292 Ga0209676_1002106 Ga0209676_10021067 294
418 3300025292 Ga0209676_1011728 Ga0209676_10117282 294
419 3300025298 Ga0209050_1000004 Ga0209050_1000004657 294
420 3300025298 Ga0209050_1000006 Ga0209050_1000006585 294
421 3300025298 Ga0209050_1000013 Ga0209050_1000013304 294
422 3300025298 Ga0209050_1000763 Ga0209050_10007636 294
423 3300025303 Ga0209051_1000001 Ga0209051_1000001985 294
424 3300025303 Ga0209051_1000006 Ga0209051_1000006318 294
425 3300025303 Ga0209051_1000007 Ga0209051_1000007304 294
426 3300025304 Ga0209257_1000029 Ga0209257_1000029585 294
427 3300025304 Ga0209257_1009178 Ga0209257_10091782 294
428 3300025321 Ga0207656_10005289 Ga0207656_100052892 294
429 3300025711 Ga0207696_1000002 Ga0207696_1000002921 294
430 3300025711 Ga0207696_1000017 Ga0207696_1000017157 294
431 3300025728 Ga0207655_1000006 Ga0207655_100000696 294
432 3300025728 Ga0207655_1000074 Ga0207655_100007433 294
433 3300025728 Ga0207655_1000098 Ga0207655_10000989 294
434 3300025728 Ga0207655_1000410 Ga0207655_100041030 294
435 3300025728 Ga0207655_1001712 Ga0207655_10017123 294
436 3300025728 Ga0207655_1002318 Ga0207655_10023186 294
437 3300025728 Ga0207655_1002796 Ga0207655_10027965 294
438 3300025728 Ga0207655_1004728 Ga0207655_10047289 294
439 3300025728 Ga0207655_1006032 Ga0207655_10060326 294
440 3300025728 Ga0207655_1008809 Ga0207655_10088093 294
441 3300025728 Ga0207655_1009171 Ga0207655_10091713 294
442 3300025735 Ga0207713_1000061 Ga0207713_100006113 294
443 3300025735 Ga0207713_1000284 Ga0207713_100028448 294
444 3300025735 Ga0207713_1000518 Ga0207713_10005184 294
445 3300025735 Ga0207713_1000929 Ga0207713_100092922 294
446 3300025735 Ga0207713_1001602 Ga0207713_100160210 294
447 3300025735 Ga0207713_1006155 Ga0207713_10061552 294
448 3300025735 Ga0207713_1008243 Ga0207713_10082432 294
449 3300025735 Ga0207713_1014599 Ga0207713_10145992 294
450 3300025735 Ga0207713_1031048 Ga0207713_10310482 294
451 3300025735 Ga0207713_1051401 Ga0207713_10514012 294
452 3300025735 Ga0207713_1087496 Ga0207713_10874961 294
453 3300025914 Ga0207671_10000474 Ga0207671_1000047438 294
454 3300025920 Ga0207649_10000010 Ga0207649_10000010221 294
455 3300025923 Ga0207681_10003542 Ga0207681_100035427 294
456 3300025923 Ga0207681_10103883 Ga0207681_101038832 294
457 3300025925 Ga0207650_10000690 Ga0207650_100006909 294
458 3300025933 Ga0207706_10002181 Ga0207706_1000218114 294
459 3300025934 Ga0207686_10008489 Ga0207686_100084893 294
460 3300025935 Ga0207709_10000004 Ga0207709_10000004506 294
461 3300025935 Ga0207709_10004919 Ga0207709_100049192 294
462 3300025935 Ga0207709_10079342 Ga0207709_100793422 294
463 3300025945 Ga0207679_10000022 Ga0207679_10000022137 294
464 3300026041 Ga0207639_10076491 Ga0207639_100764912 294
465 3300027111 Ga0209281_1000063 Ga0209281_1000063228 294
466 3300028379 Ga0268266_10028275 Ga0268266_100282753 294
467 3300028379 Ga0268266_10174792 Ga0268266_101747922 294
468 3300030521 Ga0307511_10053051 Ga0307511_100530512 294
469 3300031548 Ga0307408_100003398 Ga0307408_1000033985 294
470 3300031731 Ga0307405_10018233 Ga0307405_100182335 294
471 3300033180 Ga0307510_10003671 Ga0307510_100036712 294
472 3300033180 Ga0307510_10098723 Ga0307510_100987232 294
473 3300041407 Ga0439447_001977 Ga0439447_001977_6107_6991 294
474 3300042006 Ga0439432_000085 Ga0439432_000085_27675_28559 294
475 3300042016 Ga0439463_000996 Ga0439463_000996_2358_3242 294
476 3300046452 Ga0495617_000148 Ga0495617_000148_35179_36063 294
477 3300046452 Ga0495617_001573 Ga0495617_001573_7859_8743 294
478 3300046452 Ga0495617_011304 Ga0495617_011304_825_1709 294
479 3300046453 Ga0495627_000031 Ga0495627_000031_16356_17240 294
480 3300046453 Ga0495627_013920 Ga0495627_013920_1601_2485 294
481 3300046453 Ga0495627_014731 Ga0495627_014731_1510_2394 294
482 3300046453 Ga0495627_027534 Ga0495627_027534_849_1733 294
483 3300046453 Ga0495627_046447 Ga0495627_046447_78_962 294
484 3300046455 Ga0495603_0003135 Ga0495603_0003135_7739_8623 294
485 3300046455 Ga0495603_0020988 Ga0495603_0020988_783_1667 294
486 3300046455 Ga0495603_0063316 Ga0495603_0063316_104_988 294
487 3300046455 Ga0495603_0218698 Ga0495603_0218698_42_926 294
488 3300046455 Ga0495603_0282140 Ga0495603_0282140_29_913 294
489 3300046457 Ga0495590_0000177 Ga0495590_0000177_21303_22187 294
490 3300046457 Ga0495590_0001583 Ga0495590_0001583_3555_4439 294
491 3300046458 Ga0495591_000053 Ga0495591_000053_43060_43944 294
492 3300046458 Ga0495591_000172 Ga0495591_000172_22685_23569 294
493 3300046458 Ga0495591_000465 Ga0495591_000465_3271_4155 294
494 3300046458 Ga0495591_000873 Ga0495591_000873_6282_7166 294
495 3300046458 Ga0495591_000957 Ga0495591_000957_15595_16479 294
496 3300046458 Ga0495591_005313 Ga0495591_005313_2893_3777 294
497 3300046458 Ga0495591_024863 Ga0495591_024863_405_1289 294
498 3300046458 Ga0495591_031032 Ga0495591_031032_185_1069 294
499 3300046460 Ga0495638_0001323 Ga0495638_0001323_12271_13155 294
500 3300046460 Ga0495638_0021055 Ga0495638_0021055_2411_3295 294
501 3300046460 Ga0495638_0171078 Ga0495638_0171078_161_1045 294
502 3300046463 Ga0495653_0000652 Ga0495653_0000652_10726_11610 294
503 3300046463 Ga0495653_0004505 Ga0495653_0004505_9967_10851 294
504 3300046463 Ga0495653_0079334 Ga0495653_0079334_732_1616 294
505 3300046471 Ga0495650_0003897 Ga0495650_0003897_376_1260 294
506 3300046471 Ga0495650_0004145 Ga0495650_0004145_5062_5946 294
507 3300046471 Ga0495650_0004343 Ga0495650_0004343_309_1193 294
508 3300046471 Ga0495650_0015582 Ga0495650_0015582_35_919 294
509 3300046473 Ga0495582_0002904 Ga0495582_0002904_5964_6848 294
510 3300046474 Ga0495605_0000007 Ga0495605_0000007_342719_343603 294
511 3300046474 Ga0495605_0000054 Ga0495605_0000054_96347_97231 294
512 3300046474 Ga0495605_0000778 Ga0495605_0000778_2945_3829 294
513 3300046474 Ga0495605_0000840 Ga0495605_0000840_5259_6143 294
514 3300046474 Ga0495605_0003164 Ga0495605_0003164_1510_2394 294
515 3300046474 Ga0495605_0010382 Ga0495605_0010382_339_1223 294
516 3300046474 Ga0495605_0016891 Ga0495605_0016891_445_1329 294
517 3300046474 Ga0495605_0044400 Ga0495605_0044400_443_1330 294
518 3300046475 Ga0495639_0000053 Ga0495639_0000053_40433_41317 294
519 3300046491 Ga0495584_0000120 Ga0495584_0000120_7224_8108 294
520 3300046491 Ga0495584_0000715 Ga0495584_0000715_15335_16219 294
521 3300046491 Ga0495584_0002413 Ga0495584_0002413_4666_5550 294
522 3300046491 Ga0495584_0002856 Ga0495584_0002856_8723_9607 294
523 3300046491 Ga0495584_0008390 Ga0495584_0008390_165_1049 294
524 3300046491 Ga0495584_0029168 Ga0495584_0029168_1492_2376 294
525 3300046491 Ga0495584_0150225 Ga0495584_0150225_282_1166 294
526 3300046491 Ga0495584_0193025 Ga0495584_0193025_57_941 294
527 3300046492 Ga0495585_0010605 Ga0495585_0010605_559_1443 294
528 3300046492 Ga0495585_0026976 Ga0495585_0026976_1199_2083 294
529 3300046492 Ga0495585_0027811 Ga0495585_0027811_1564_2448 294
530 3300046499 Ga0495594_0008625 Ga0495594_0008625_1921_2805 294
531 3300046499 Ga0495594_0020880 Ga0495594_0020880_188_1072 294
532 3300046499 Ga0495594_0170138 Ga0495594_0170138_28_912 294
533 3300046500 Ga0495596_0014418 Ga0495596_0014418_1229_2113 294
534 3300046500 Ga0495596_0022930 Ga0495596_0022930_1511_2395 294
535 3300046501 Ga0495607_0000036 Ga0495607_0000036_61758_62642 294
536 3300046501 Ga0495607_0000041 Ga0495607_0000041_119538_120422 294
537 3300046501 Ga0495607_0003777 Ga0495607_0003777_8292_9176 294
538 3300046501 Ga0495607_0004345 Ga0495607_0004345_941_1825 294
539 3300046501 Ga0495607_0006048 Ga0495607_0006048_7238_8122 294
540 3300046501 Ga0495607_0006235 Ga0495607_0006235_4134_5018 294
541 3300046501 Ga0495607_0007191 Ga0495607_0007191_242_1126 294
542 3300046501 Ga0495607_0015516 Ga0495607_0015516_2751_3635 294
543 3300046501 Ga0495607_0019764 Ga0495607_0019764_340_1224 294
544 3300046501 Ga0495607_0040366 Ga0495607_0040366_1428_2312 294
545 3300046501 Ga0495607_0107225 Ga0495607_0107225_590_1474 294
546 3300046501 Ga0495607_0111142 Ga0495607_0111142_95_979 294
547 3300046506 Ga0495583_0000007 Ga0495583_0000007_301186_302070 294
548 3300046506 Ga0495583_0000865 Ga0495583_0000865_114_998 294
549 3300046506 Ga0495583_0001830 Ga0495583_0001830_7103_7987 294
550 3300046506 Ga0495583_0005112 Ga0495583_0005112_3097_3981 294
551 3300046507 Ga0495606_0000079 Ga0495606_0000079_85126_86010 294
552 3300046507 Ga0495606_0000473 Ga0495606_0000473_58199_59083 294
553 3300046507 Ga0495606_0001688 Ga0495606_0001688_12591_13475 294
554 3300046507 Ga0495606_0016943 Ga0495606_0016943_4033_4917 294
555 3300046507 Ga0495606_0026227 Ga0495606_0026227_3106_3993 294
556 3300046507 Ga0495606_0076632 Ga0495606_0076632_1153_2037 294
557 3300046507 Ga0495606_0148379 Ga0495606_0148379_349_1233 294
558 3300046512 Ga0495610_0000455 Ga0495610_0000455_28396_29280 294
559 3300046512 Ga0495610_0005425 Ga0495610_0005425_1775_2659 294
560 3300046512 Ga0495610_0007848 Ga0495610_0007848_686_1570 294
561 3300046512 Ga0495610_0023899 Ga0495610_0023899_2216_3100 294
562 3300046512 Ga0495610_0027121 Ga0495610_0027121_1195_2079 294
563 3300046512 Ga0495610_0036057 Ga0495610_0036057_189_1073 294
564 3300046512 Ga0495610_0062649 Ga0495610_0062649_785_1669 294
565 3300046512 Ga0495610_0063665 Ga0495610_0063665_493_1377 294
566 3300046513 Ga0495616_0000535 Ga0495616_0000535_19580_20464 294
567 3300046513 Ga0495616_0000626 Ga0495616_0000626_12015_12899 294
568 3300046513 Ga0495616_0000695 Ga0495616_0000695_19803_20687 294
569 3300046513 Ga0495616_0001570 Ga0495616_0001570_2718_3602 294
570 3300046513 Ga0495616_0008679 Ga0495616_0008679_3683_4567 294
571 3300046513 Ga0495616_0011630 Ga0495616_0011630_867_1751 294
572 3300046513 Ga0495616_0019605 Ga0495616_0019605_694_1578 294
573 3300046513 Ga0495616_0063770 Ga0495616_0063770_417_1301 294
574 3300046515 Ga0495620_0000014 Ga0495620_0000014_135989_136873 294
575 3300046515 Ga0495620_0000152 Ga0495620_0000152_751_1635 294
576 3300046515 Ga0495620_0001722 Ga0495620_0001722_7418_8302 294
577 3300046515 Ga0495620_0004792 Ga0495620_0004792_238_1122 294
578 3300046515 Ga0495620_0011843 Ga0495620_0011843_576_1460 294
579 3300046515 Ga0495620_0058903 Ga0495620_0058903_579_1463 294
580 3300046517 Ga0495630_0009776 Ga0495630_0009776_2965_3849 294
581 3300046517 Ga0495630_0016625 Ga0495630_0016625_3788_4672 294
582 3300046517 Ga0495630_0019132 Ga0495630_0019132_811_1695 294
583 3300046518 Ga0495631_0000175 Ga0495631_0000175_33960_34850 294
584 3300046518 Ga0495631_0000526 Ga0495631_0000526_3563_4447 294
585 3300046518 Ga0495631_0005621 Ga0495631_0005621_2581_3465 294
586 3300046518 Ga0495631_0009829 Ga0495631_0009829_3080_3964 294
587 3300046519 Ga0495632_0000361 Ga0495632_0000361_3040_3924 294
588 3300046519 Ga0495632_0003232 Ga0495632_0003232_3075_3959 294
589 3300046519 Ga0495632_0005275 Ga0495632_0005275_6814_7698 294
590 3300046519 Ga0495632_0008562 Ga0495632_0008562_3646_4530 294
591 3300046519 Ga0495632_0010316 Ga0495632_0010316_4288_5172 294
592 3300046519 Ga0495632_0074200 Ga0495632_0074200_126_1010 294
593 3300046519 Ga0495632_0108940 Ga0495632_0108940_222_1106 294
594 3300046520 Ga0495637_0000606 Ga0495637_0000606_12689_13573 294
595 3300046520 Ga0495637_0000950 Ga0495637_0000950_8326_9210 294
596 3300046520 Ga0495637_0001129 Ga0495637_0001129_6652_7536 294
597 3300046520 Ga0495637_0001455 Ga0495637_0001455_3064_3948 294
598 3300046520 Ga0495637_0011047 Ga0495637_0011047_345_1229 294
599 3300046520 Ga0495637_0023176 Ga0495637_0023176_210_1094 294
600 3300046520 Ga0495637_0048733 Ga0495637_0048733_871_1755 294
601 3300046522 Ga0495643_0061324 Ga0495643_0061324_763_1647 294
602 3300046523 Ga0495644_0002949 Ga0495644_0002949_1211_2095 294
603 3300046524 Ga0495648_0000062 Ga0495648_0000062_41903_42787 294
604 3300046524 Ga0495648_0002500 Ga0495648_0002500_15949_16833 294
605 3300046524 Ga0495648_0002645 Ga0495648_0002645_2140_3024 294
606 3300046524 Ga0495648_0013756 Ga0495648_0013756_5051_5935 294
607 3300046524 Ga0495648_0017504 Ga0495648_0017504_4090_4974 294
608 3300046524 Ga0495648_0025045 Ga0495648_0025045_2321_3205 294
609 3300046524 Ga0495648_0030439 Ga0495648_0030439_1015_1899 294
610 3300046524 Ga0495648_0087622 Ga0495648_0087622_309_1193 294
611 3300046524 Ga0495648_0201893 Ga0495648_0201893_30_914 294
612 3300046526 Ga0495666_0000908 Ga0495666_0000908_1098_1982 294
613 3300046526 Ga0495666_0001595 Ga0495666_0001595_4117_5001 294
614 3300046528 Ga0495642_0000006 Ga0495642_0000006_30060_30944 294
615 3300046528 Ga0495642_0000044 Ga0495642_0000044_65083_65967 294
616 3300046528 Ga0495642_0001263 Ga0495642_0001263_3473_4357 294
617 3300046530 Ga0495654_0000113 Ga0495654_0000113_90876_91760 294
618 3300046530 Ga0495654_0000600 Ga0495654_0000600_20080_20964 294
619 3300046530 Ga0495654_0000688 Ga0495654_0000688_13881_14765 294
620 3300046530 Ga0495654_0001563 Ga0495654_0001563_9789_10673 294
621 3300046530 Ga0495654_0011138 Ga0495654_0011138_802_1686 294
622 3300046530 Ga0495654_0013073 Ga0495654_0013073_407_1291 294
623 3300046530 Ga0495654_0039041 Ga0495654_0039041_742_1626 294
624 3300046530 Ga0495654_0045145 Ga0495654_0045145_1220_2104 294
625 3300046530 Ga0495654_0113151 Ga0495654_0113151_82_966 294
626 3300046536 Ga0495587_0003803 Ga0495587_0003803_2201_3085 294
627 3300046538 Ga0495609_0000004 Ga0495609_0000004_344946_345830 294
628 3300046538 Ga0495609_0000016 Ga0495609_0000016_226286_227170 294
629 3300046538 Ga0495609_0001070 Ga0495609_0001070_3322_4206 294
630 3300046538 Ga0495609_0001736 Ga0495609_0001736_773_1657 294
631 3300046538 Ga0495609_0001936 Ga0495609_0001936_7323_8207 294
632 3300046538 Ga0495609_0002104 Ga0495609_0002104_10892_11776 294
633 3300046538 Ga0495609_0085081 Ga0495609_0085081_302_1186 294
634 3300046542 Ga0495597_0000800 Ga0495597_0000800_673_1557 294
635 3300046542 Ga0495597_0004988 Ga0495597_0004988_216_1106 294
636 3300046542 Ga0495597_0016693 Ga0495597_0016693_2392_3276 294
637 3300046557 Ga0495622_0000414 Ga0495622_0000414_7569_8453 294
638 3300046557 Ga0495622_0003325 Ga0495622_0003325_936_1820 294
639 3300046557 Ga0495622_0012172 Ga0495622_0012172_654_1538 294
640 3300046557 Ga0495622_0017579 Ga0495622_0017579_393_1277 294
641 3300046557 Ga0495622_0066032 Ga0495622_0066032_602_1486 294
642 3300046558 Ga0495633_0000051 Ga0495633_0000051_125451_126335 294
643 3300046558 Ga0495633_0003219 Ga0495633_0003219_795_1679 294
644 3300046558 Ga0495633_0026211 Ga0495633_0026211_769_1653 294
645 3300046615 Ga0495656_0000803 Ga0495656_0000803_3515_4399 294
646 3300046616 Ga0495668_0002764 Ga0495668_0002764_12289_13173 294
647 3300046616 Ga0495668_0007019 Ga0495668_0007019_1075_1959 294
648 3300046616 Ga0495668_0013998 Ga0495668_0013998_3059_3943 294
649 3300046642 Ga0495634_0000815 Ga0495634_0000815_8737_9621 294
650 3300046648 Ga0495611_0000019 Ga0495611_0000019_28035_28919 294
651 3300046648 Ga0495611_0000548 Ga0495611_0000548_1454_2338 294
652 3300046660 Ga0495625_0000084 Ga0495625_0000084_71005_71889 294
653 3300046660 Ga0495625_0003120 Ga0495625_0003120_3304_4188 294
654 3300046660 Ga0495625_0004063 Ga0495625_0004063_10787_11671 294
655 3300046660 Ga0495625_0029114 Ga0495625_0029114_3186_4070 294
656 3300046660 Ga0495625_0075677 Ga0495625_0075677_420_1304 294
657 3300046663 Ga0495635_0000522 Ga0495635_0000522_20411_21295 294
658 3300046663 Ga0495635_0005853 Ga0495635_0005853_3847_4731 294
659 3300046664 Ga0495659_0000119 Ga0495659_0000119_9090_9974 294
660 3300046664 Ga0495659_0009781 Ga0495659_0009781_1159_2043 294
661 3300046664 Ga0495659_0069119 Ga0495659_0069119_209_1093 294
662 3300046665 Ga0495661_0000035 Ga0495661_0000035_96544_97428 294
663 3300046665 Ga0495661_0000051 Ga0495661_0000051_91176_92060 294
664 3300046665 Ga0495661_0000106 Ga0495661_0000106_38984_39868 294
665 3300046665 Ga0495661_0000269 Ga0495661_0000269_564_1448 294
666 3300046665 Ga0495661_0005186 Ga0495661_0005186_74_958 294
667 3300046665 Ga0495661_0025282 Ga0495661_0025282_2914_3798 294
668 3300046665 Ga0495661_0092887 Ga0495661_0092887_522_1412 294
669 3300046674 Ga0495588_0025528 Ga0495588_0025528_319_1203 294
670 3300046675 Ga0495657_0021575 Ga0495657_0021575_2986_3870 294
671 3300046679 Ga0495623_0009066 Ga0495623_0009066_2985_3869 294
672 3300046679 Ga0495623_0016801 Ga0495623_0016801_2871_3755 294
673 3300046680 Ga0495646_0003353 Ga0495646_0003353_6641_7525 294
674 3300046680 Ga0495646_0003495 Ga0495646_0003495_1743_2627 294
675 3300046680 Ga0495646_0036488 Ga0495646_0036488_1458_2342 294
676 3300046684 Ga0495669_0001087 Ga0495669_0001087_1545_2429 294
677 3300046684 Ga0495669_0070768 Ga0495669_0070768_117_1001 294
678 3300046689 Ga0495613_0020085 Ga0495613_0020085_4061_4945 294
679 3300046690 Ga0495624_0000237 Ga0495624_0000237_20877_21761 294
680 3300046691 Ga0495670_0000455 Ga0495670_0000455_15313_16197 294
681 3300046691 Ga0495670_0000777 Ga0495670_0000777_1621_2505 294
682 3300046691 Ga0495670_0012161 Ga0495670_0012161_51_935 294
683 3300046691 Ga0495670_0140081 Ga0495670_0140081_136_1020 294
684 3300046692 Ga0495671_0000210 Ga0495671_0000210_41167_42051 294
685 3300046692 Ga0495671_0001187 Ga0495671_0001187_8855_9739 294
686 3300046692 Ga0495671_0001243 Ga0495671_0001243_2054_2938 294
687 3300046692 Ga0495671_0003398 Ga0495671_0003398_720_1604 294
688 3300046692 Ga0495671_0006777 Ga0495671_0006777_2708_3592 294
689 3300046694 Ga0495649_0000748 Ga0495649_0000748_7474_8358 294
690 3300046694 Ga0495649_0002964 Ga0495649_0002964_8704_9588 294
691 3300046694 Ga0495649_0005325 Ga0495649_0005325_547_1431 294
692 3300046694 Ga0495649_0009159 Ga0495649_0009159_1732_2616 294
693 3300046694 Ga0495649_0012051 Ga0495649_0012051_2960_3844 294
694 3300046694 Ga0495649_0033050 Ga0495649_0033050_1594_2478 294
695 3300046694 Ga0495649_0045854 Ga0495649_0045854_605_1489 294
696 3300046794 Ga0495589_0000326 Ga0495589_0000326_31148_32032 294
697 3300046794 Ga0495589_0000352 Ga0495589_0000352_20680_21564 294
698 3300046794 Ga0495589_0001450 Ga0495589_0001450_7426_8310 294
699 3300046794 Ga0495589_0012195 Ga0495589_0012195_2833_3717 294
700 3300046794 Ga0495589_0014155 Ga0495589_0014155_155_1039 294
701 3300046794 Ga0495589_0179640 Ga0495589_0179640_97_981 294
702 3300046809 Ga0495600_0006261 Ga0495600_0006261_3907_4791 294
703 3300046809 Ga0495600_0030109 Ga0495600_0030109_328_1212 294
704 3300046810 Ga0495660_0005494 Ga0495660_0005494_566_1450 294
705 3300046810 Ga0495660_0022962 Ga0495660_0022962_2219_3103 294
706 3300046810 Ga0495660_0071874 Ga0495660_0071874_44_928 294
707 3300046810 Ga0495660_0075648 Ga0495660_0075648_629_1513 294
708 3300046810 Ga0495660_0120459 Ga0495660_0120459_396_1280 294
709 3300046810 Ga0495660_0153188 Ga0495660_0153188_185_1069 294
710 3300047315 Ga0495581_0025132 Ga0495581_0025132_2309_3193 294
711 3300047315 Ga0495581_0038645 Ga0495581_0038645_1234_2118 294
712 3300047317 Ga0495604_0014324 Ga0495604_0014324_1627_2511 294
713 3300047318 Ga0495636_0005847 Ga0495636_0005847_1708_2592 294
714 3300047318 Ga0495636_0139341 Ga0495636_0139341_31_915 294
715 3300047319 Ga0495674_0009374 Ga0495674_0009374_1109_1993 294
716 3300047320 Ga0495672_0000787 Ga0495672_0000787_20882_21766 294
717 3300047320 Ga0495672_0000817 Ga0495672_0000817_4764_5648 294
718 3300047320 Ga0495672_0001555 Ga0495672_0001555_17251_18135 294
719 3300047320 Ga0495672_0001980 Ga0495672_0001980_1820_2704 294
720 3300047320 Ga0495672_0003332 Ga0495672_0003332_104_988 294
721 3300047320 Ga0495672_0016601 Ga0495672_0016601_3156_4040 294
722 3300047321 Ga0495676_0000368 Ga0495676_0000368_15494_16378 294
723 3300047321 Ga0495676_0002558 Ga0495676_0002558_8746_9630 294
724 3300047322 Ga0495680_0002029 Ga0495680_0002029_9866_10750 294
725 3300047322 Ga0495680_0007735 Ga0495680_0007735_6179_7063 294
726 3300047322 Ga0495680_0027810 Ga0495680_0027810_925_1809 294
727 3300047323 Ga0495683_0000004 Ga0495683_0000004_140713_141597 294
728 3300047323 Ga0495683_0000318 Ga0495683_0000318_31709_32593 294
729 3300047323 Ga0495683_0000356 Ga0495683_0000356_29096_29980 294
730 3300047323 Ga0495683_0010106 Ga0495683_0010106_3903_4787 294
731 3300047323 Ga0495683_0014694 Ga0495683_0014694_344_1228 294
732 3300047323 Ga0495683_0097249 Ga0495683_0097249_276_1160 294
733 3300047323 Ga0495683_0150538 Ga0495683_0150538_157_1041 294
734 3300047443 Ga0495687_000977 Ga0495687_000977_1152_2036 294
735 3300047443 Ga0495687_006152 Ga0495687_006152_3088_3972 294
736 3300047443 Ga0495687_007971 Ga0495687_007971_3094_3978 294
737 3300047444 Ga0495675_0009385 Ga0495675_0009385_4142_5026 294
738 3300047445 Ga0495677_0000848 Ga0495677_0000848_8412_9296 294
739 3300047446 Ga0495679_000137 Ga0495679_000137_36429_37313 294
740 3300047446 Ga0495679_000323 Ga0495679_000323_8604_9488 294
741 3300047446 Ga0495679_008771 Ga0495679_008771_137_1021 294
742 3300047446 Ga0495679_047765 Ga0495679_047765_24_908 294
743 3300047469 Ga0495673_0000118 Ga0495673_0000118_22760_23644 294
744 3300047469 Ga0495673_0000465 Ga0495673_0000465_9377_10261 294
745 3300047469 Ga0495673_0001449 Ga0495673_0001449_3574_4458 294
746 3300047469 Ga0495673_0001451 Ga0495673_0001451_7709_8593 294
747 3300047469 Ga0495673_0001736 Ga0495673_0001736_15557_16441 294
748 3300047469 Ga0495673_0011327 Ga0495673_0011327_821_1705 294
749 3300047469 Ga0495673_0018699 Ga0495673_0018699_438_1322 294
750 3300047469 Ga0495673_0049386 Ga0495673_0049386_16_906 294
751 3300047469 Ga0495673_0096219 Ga0495673_0096219_204_1088 294
752 3300047469 Ga0495673_0097333 Ga0495673_0097333_73_957 294
753 3300047470 Ga0495681_0000353 Ga0495681_0000353_25053_25937 294
754 3300047470 Ga0495681_0000478 Ga0495681_0000478_13722_14606 294
755 3300047470 Ga0495681_0002364 Ga0495681_0002364_657_1541 294
756 3300047470 Ga0495681_0003644 Ga0495681_0003644_9480_10364 294
757 3300047470 Ga0495681_0010181 Ga0495681_0010181_2448_3332 294
758 3300047470 Ga0495681_0014600 Ga0495681_0014600_3143_4027 294
759 3300047470 Ga0495681_0023899 Ga0495681_0023899_1492_2376 294
760 3300047470 Ga0495681_0027162 Ga0495681_0027162_1968_2852 294
761 3300047471 Ga0495684_0010777 Ga0495684_0010777_6098_6982 294
762 3300047472 Ga0495686_0092127 Ga0495686_0092127_783_1667 294
763 3300047673 Ga0495593_0001207 Ga0495593_0001207_13416_14300 294
764 3300047673 Ga0495593_0022745 Ga0495593_0022745_403_1287 294
765 3300047673 Ga0495593_0029111 Ga0495593_0029111_261_1145 294
766 3300047673 Ga0495593_0124356 Ga0495593_0124356_25_909 294
767 3300048091 Ga0495626_0000002 Ga0495626_0000002_79845_80729 294
768 3300048091 Ga0495626_0000064 Ga0495626_0000064_120981_121865 294
769 3300048091 Ga0495626_0000616 Ga0495626_0000616_26134_27018 294
770 3300048091 Ga0495626_0000958 Ga0495626_0000958_18503_19387 294
771 3300048091 Ga0495626_0001601 Ga0495626_0001601_3260_4144 294
772 3300048091 Ga0495626_0002256 Ga0495626_0002256_3662_4546 294
773 3300048091 Ga0495626_0016259 Ga0495626_0016259_2429_3313 294
774 3300048091 Ga0495626_0026985 Ga0495626_0026985_1638_2522 294
775 3300048091 Ga0495626_0027531 Ga0495626_0027531_1610_2494 294
776 3300048091 Ga0495626_0040702 Ga0495626_0040702_981_1865 294
777 3300048905 Ga0496102_0681244 Ga0496102_0681244_18_902 294
778 3300048909 Ga0496106_0269326 Ga0496106_0269326_95_979 294
779 3300048909 Ga0496106_0276004 Ga0496106_0276004_181_1065 294
780 3300048913 Ga0496110_0099192 Ga0496110_0099192_1145_2029 294
781 3300048913 Ga0496110_0177998 Ga0496110_0177998_730_1614 294
782 3300048913 Ga0496110_0527215 Ga0496110_0527215_107_991 294
783 3300048916 Ga0496113_0187105 Ga0496113_0187105_604_1488 294
784 3300048919 Ga0496116_0000038 Ga0496116_0000038_361380_362264 294
785 3300048919 Ga0496116_0000382 Ga0496116_0000382_64228_65112 294
786 3300048919 Ga0496116_0001933 Ga0496116_0001933_649_1533 294
787 3300048919 Ga0496116_0002265 Ga0496116_0002265_519_1403 294
788 3300048919 Ga0496116_0025816 Ga0496116_0025816_462_1346 294
789 3300048920 Ga0496117_0007085 Ga0496117_0007085_9733_10617 294
790 3300048920 Ga0496117_0030407 Ga0496117_0030407_304_1188 294
791 3300048920 Ga0496117_0050196 Ga0496117_0050196_1094_1978 294
792 3300048920 Ga0496117_0101515 Ga0496117_0101515_709_1593 294
793 3300048921 Ga0496118_0027699 Ga0496118_0027699_1959_2843 294
794 3300048921 Ga0496118_0028593 Ga0496118_0028593_751_1635 294
795 3300048921 Ga0496118_0031937 Ga0496118_0031937_497_1381 294
796 3300048921 Ga0496118_0044902 Ga0496118_0044902_1426_2310 294
797 3300048921 Ga0496118_0129631 Ga0496118_0129631_600_1484 294
798 3300048921 Ga0496118_0133520 Ga0496118_0133520_506_1390 294
799 3300048922 Ga0496119_0166960 Ga0496119_0166960_126_1010 294
800 3300048923 Ga0496120_0025586 Ga0496120_0025586_93_977 294
801 3300048924 Ga0496121_0000589 Ga0496121_0000589_2575_3459 294
802 3300048924 Ga0496121_0001708 Ga0496121_0001708_26001_26885 294
803 3300048924 Ga0496121_0001828 Ga0496121_0001828_18453_19337 294
804 3300048924 Ga0496121_0004020 Ga0496121_0004020_15514_16398 294
805 3300048924 Ga0496121_0036966 Ga0496121_0036966_487_1371 294
806 3300048924 Ga0496121_0249323 Ga0496121_0249323_261_1145 294
807 3300048925 Ga0496122_0000411 Ga0496122_0000411_25138_26022 294
808 3300048925 Ga0496122_0011920 Ga0496122_0011920_1975_2859 294
809 3300048925 Ga0496122_0025179 Ga0496122_0025179_3158_4042 294
810 3300048925 Ga0496122_0032954 Ga0496122_0032954_491_1375 294
811 3300048925 Ga0496122_0062334 Ga0496122_0062334_1261_2145 294
812 3300048925 Ga0496122_0187453 Ga0496122_0187453_22_906 294
813 3300048926 Ga0496123_0000055 Ga0496123_0000055_73448_74332 294
814 3300048926 Ga0496123_0003979 Ga0496123_0003979_12307_13191 294
815 3300048926 Ga0496123_0008610 Ga0496123_0008610_7588_8472 294
816 3300048926 Ga0496123_0025966 Ga0496123_0025966_497_1381 294
817 3300048926 Ga0496123_0062936 Ga0496123_0062936_551_1435 294
818 3300048927 Ga0496124_0001124 Ga0496124_0001124_29521_30405 294
819 3300048927 Ga0496124_0004348 Ga0496124_0004348_15382_16266 294
820 3300048927 Ga0496124_0081959 Ga0496124_0081959_83_967 294
821 3300048927 Ga0496124_0092891 Ga0496124_0092891_730_1614 294
822 3300048927 Ga0496124_0146638 Ga0496124_0146638_219_1103 294
823 3300048927 Ga0496124_0204453 Ga0496124_0204453_241_1125 294
824 3300048928 Ga0496125_0003572 Ga0496125_0003572_1499_2383 294
825 3300048928 Ga0496125_0004187 Ga0496125_0004187_15383_16267 294
826 3300048928 Ga0496125_0039387 Ga0496125_0039387_185_1069 294
827 3300048929 Ga0496126_0032027 Ga0496126_0032027_550_1434 294
828 3300048929 Ga0496126_0044557 Ga0496126_0044557_2683_3567 294
829 3300048929 Ga0496126_0160606 Ga0496126_0160606_934_1818 294
830 3300049459 Ga0495678_000014 Ga0495678_000014_172772_173656 294
831 3300049459 Ga0495678_000578 Ga0495678_000578_7740_8624 294
832 3300049459 Ga0495678_000628 Ga0495678_000628_30001_30885 294
833 3300049459 Ga0495678_002924 Ga0495678_002924_208_1092 294
834 3300049459 Ga0495678_003304 Ga0495678_003304_2970_3854 294
835 3300049459 Ga0495678_003870 Ga0495678_003870_1818_2702 294
836 3300049459 Ga0495678_004245 Ga0495678_004245_410_1294 294
837 3300049459 Ga0495678_013459 Ga0495678_013459_454_1338 294
838 3300049459 Ga0495678_017896 Ga0495678_017896_714_1598 294
839 3300049459 Ga0495678_028443 Ga0495678_028443_493_1377 294
840 3300049459 Ga0495678_077094 Ga0495678_077094_208_1092 294
841 3300049460 Ga0495682_0000025 Ga0495682_0000025_65468_66352 294
842 3300049460 Ga0495682_0000099 Ga0495682_0000099_46889_47773 294
843 3300049460 Ga0495682_0001018 Ga0495682_0001018_775_1659 294
844 3300049460 Ga0495682_0006579 Ga0495682_0006579_3162_4046 294
845 3300049460 Ga0495682_0006967 Ga0495682_0006967_551_1435 294
846 3300049460 Ga0495682_0007925 Ga0495682_0007925_2887_3771 294
847 3300049460 Ga0495682_0030020 Ga0495682_0030020_813_1697 294
848 3300053111 Ga0500572_000710 Ga0500572_000710_9316_10200 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

8

173

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t0j-assembly1.cif.gz_A salmonella typhimurium arnd 0.9725 1 294
8t0j-assembly1.cif.gz_A salmonella typhimurium arnd 0.9584 1 294
4m1b-assembly2.cif.gz_B structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis 0.8358 2 264
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.8188 2 264
5o6y-assembly2.cif.gz_B crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{n}-oxidanyl-benzamide 0.8125 2 264
ID Description Score Start End Superfamily
af_P76472_1_267_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8853 1 266 3.30.70.260
af_P76472_1_267_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8788 1 266 3.30.70.260
4m1bB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8358 2 264 3.20.20.370
5lgcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8023 3 264 3.20.20.370
2cc0B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.798 2 271 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A7Y8E0J5-F1-model_v4 deleted 0.9894 100 294
AF-A0A836ZPV7-F1-model_v4 deleted 0.989 144 292
AF-A0A3D9E707-F1-model_v4 NodB homology domain-containing protein 0.9867 145 292 GO:0005975
GO:0016810
AF-A0A7G7ESQ9-F1-model_v4 deleted 0.9814 103 294
AF-A0A485AEY9-F1-model_v4 Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (EC 3.5.1.n3) 0.9811 2 294 GO:0009103
GO:0009245
GO:0016020
GO:0016811
GO:0036108
GO:0046677

Feature Viewer

pLDDT pTM Quality
89.74 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map