F483354
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 848 | 404 | 683 | 293 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100107652|Ga0070670_1001076521 |
| Length | 313 |
| Sequence | VSVSALGLRVDVDTFRGTREGVPRLLETFAKHGLRATFFFTLGPDNMGRHLFRLLKPRFFMKMLRSRAASLYGWDVLFAGTFWPGRKIGAALGGTLRLADEAGHEVGLHAWDHHRWQVSALKMEPRALHDEIARGVGAFTDALGRRPDCSAAAGWVSNERVLETKERFGFRYNSDCRGRSIFVPVVNGRRLAPQIPVTLPTYDEAVGRDGVTNDNYNDWLLARIEPGEFNVLTVHAEVEGGACAQMFDAFLGACAARGIRPVPLRDLLAAEALPAPDHLALAPIEGREGNVGWQRSALAAAPRPDRSATATPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 3 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 4 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 5 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 6 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 7 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 8 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 9 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 10 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 11 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 12 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 13 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 14 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 15 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 16 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 17 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 18 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 19 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 20 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 21 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 22 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 23 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 24 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 25 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 26 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 27 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 28 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 29 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 30 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 31 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 32 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 33 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 34 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 35 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 36 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 37 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 38 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 39 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 40 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 41 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 42 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 43 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 44 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 45 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 46 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 47 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 48 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 49 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 50 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 51 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 52 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 53 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 54 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 55 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 56 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 57 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 58 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 59 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 60 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 61 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 62 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 63 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 64 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 65 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 66 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 67 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 68 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 69 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 70 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 71 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 72 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 73 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 74 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 75 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 76 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 77 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 78 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 79 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 80 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 81 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 82 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 83 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 84 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 85 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 86 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 87 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 88 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 89 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 90 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 91 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 92 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 93 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 94 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 95 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 96 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 97 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 98 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 99 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 100 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 101 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 102 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 103 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 104 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 105 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 106 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 107 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 108 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 109 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 110 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 111 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 112 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 113 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 114 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 115 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 116 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 117 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 118 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 119 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 120 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 121 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 122 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 123 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 124 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 125 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 126 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 127 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 128 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 129 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 130 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 131 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 132 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 133 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 134 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 135 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 136 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 137 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 138 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 139 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 140 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 141 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 142 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 143 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 144 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 145 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 146 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 147 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 148 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 149 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 150 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 151 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 152 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 153 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 154 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 155 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 156 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 157 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 158 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 159 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 160 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 161 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 162 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 163 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 164 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 165 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 166 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 169 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 170 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 175 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 176 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 180 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 181 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 182 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 183 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 184 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 185 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 186 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 187 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 189 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 190 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 191 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 192 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 194 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 207 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 217 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 219 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 220 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 221 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 223 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 232 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 235 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 262 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 264 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 265 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 266 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 268 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 269 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 271 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 274 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 275 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 276 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 277 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 278 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 364 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 365 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 366 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 367 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 368 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 369 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 370 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 374 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 375 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 376 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 385 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 386 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 387 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 388 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 389 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 390 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 391 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 392 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 393 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 394 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 395 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 396 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 397 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 398 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 399 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 400 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 401 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 402 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 403 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 404 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.54 |
| Metatranscriptomes | 0 |
| Isolates | 19.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 6.72 |
| Nodule | 2.36 |
| Rhizoplane | 5.54 |
| Rhizosphere | 72.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_19 | 2124908027 | Bacteria | 54562 |
| 2 | MRS2a_Contig_7067 | 2124908027 | Bacteria | 5082 |
| 3 | JGI25162J39368_1000004 | 3300002737 | Bacteria | 441040 |
| 4 | JGI25162J39368_1000065 | 3300002737 | Bacteria | 131083 |
| 5 | JGI25154J39366_1003271 | 3300002738 | Bacteria | 3514 |
| 6 | JGI25163J39215_1001383 | 3300002771 | Bacteria | 4083 |
| 7 | JGI25163J39215_1001387 | 3300002771 | Bacteria | 4074 |
| 8 | JGI25164J39214_1000031 | 3300002772 | Bacteria | 144582 |
| 9 | JGI25164J39214_1000038 | 3300002772 | Bacteria | 131082 |
| 10 | JGI25165J46597_1000011 | 3300003214 | Bacteria | 441040 |
| 11 | JGI25165J46597_1000126 | 3300003214 | Bacteria | 131083 |
| 12 | Ga0055538_1000007 | 3300003751 | Bacteria | 399715 |
| 13 | Ga0055539_1000011 | 3300003752 | Bacteria | 399747 |
| 14 | Ga0055533_1000014 | 3300003756 | Bacteria | 399747 |
| 15 | Ga0055532_1000009 | 3300003758 | Bacteria | 399537 |
| 16 | Ga0055525_1000016 | 3300003759 | Bacteria | 399724 |
| 17 | Ga0055536_1000025 | 3300003781 | Bacteria | 183172 |
| 18 | Ga0055536_1000053 | 3300003781 | Bacteria | 110030 |
| 19 | Ga0055530_10000007 | 3300003791 | Bacteria | 183172 |
| 20 | Ga0055530_10000011 | 3300003791 | Bacteria | 170218 |
| 21 | Ga0055530_10000219 | 3300003791 | Bacteria | 51126 |
| 22 | Ga0055540_1000006 | 3300003792 | Bacteria | 372018 |
| 23 | Ga0055540_1000034 | 3300003792 | Bacteria | 170218 |
| 24 | Ga0055540_1000125 | 3300003792 | Bacteria | 79312 |
| 25 | Ga0055531_10001653 | 3300003794 | Bacteria | 16091 |
| 26 | Ga0055541_1000008 | 3300003841 | Bacteria | 399724 |
| 27 | Ga0065714_10000048 | 3300005288 | Bacteria | 23148 |
| 28 | Ga0065714_10002770 | 3300005288 | Bacteria | 11621 |
| 29 | Ga0065714_10065674 | 3300005288 | Bacteria | 8904 |
| 30 | Ga0065714_10069849 | 3300005288 | Bacteria | 4063 |
| 31 | Ga0065714_10088799 | 3300005288 | Bacteria | 2003 |
| 32 | Ga0065712_10000124 | 3300005290 | Bacteria | 105429 |
| 33 | Ga0065712_10000445 | 3300005290 | Bacteria | 11247 |
| 34 | Ga0065715_10101172 | 3300005293 | Bacteria | 3227 |
| 35 | Ga0070670_100000079 | 3300005331 | Bacteria | 92916 |
| 36 | Ga0070670_100107652 | 3300005331 | Bacteria | 2402 |
| 37 | Ga0070666_10016235 | 3300005335 | Bacteria | 4762 |
| 38 | Ga0068868_100001680 | 3300005338 | Bacteria | 15130 |
| 39 | Ga0070687_100016880 | 3300005343 | Bacteria | 3343 |
| 40 | Ga0070661_100000024 | 3300005344 | Bacteria | 121810 |
| 41 | Ga0070669_100001022 | 3300005353 | Bacteria | 20393 |
| 42 | Ga0070669_100180512 | 3300005353 | Bacteria | 1651 |
| 43 | Ga0070671_100001324 | 3300005355 | Bacteria | 18607 |
| 44 | Ga0070662_100090587 | 3300005457 | Bacteria | 2296 |
| 45 | Ga0070684_100078344 | 3300005535 | Bacteria | 2920 |
| 46 | Ga0068853_100039228 | 3300005539 | Bacteria | 4039 |
| 47 | Ga0070693_100100157 | 3300005547 | Bacteria | 1764 |
| 48 | Ga0070665_100039437 | 3300005548 | Bacteria | 4749 |
| 49 | Ga0070665_100269699 | 3300005548 | Bacteria | 1703 |
| 50 | Ga0070664_100000024 | 3300005564 | Bacteria | 94521 |
| 51 | Ga0068859_100015482 | 3300005617 | Bacteria | 7663 |
| 52 | Ga0068851_10000552 | 3300005834 | Bacteria | 16293 |
| 53 | Ga0068863_100004929 | 3300005841 | Bacteria | 13158 |
| 54 | Ga0068860_100290580 | 3300005843 | Bacteria | 1599 |
| 55 | Ga0075364_10009199 | 3300006051 | Bacteria | 5919 |
| 56 | Ga0075432_10000898 | 3300006058 | Bacteria | 9361 |
| 57 | Ga0075432_10002446 | 3300006058 | Bacteria | 6182 |
| 58 | Ga0075432_10005364 | 3300006058 | Bacteria | 4370 |
| 59 | Ga0075362_10005910 | 3300006177 | Bacteria | 4520 |
| 60 | Ga0075369_10041465 | 3300006186 | Bacteria | 1971 |
| 61 | Ga0097621_100034439 | 3300006237 | Bacteria | 4040 |
| 62 | Ga0075428_100056910 | 3300006844 | Bacteria | 4281 |
| 63 | Ga0075430_100013614 | 3300006846 | Bacteria | 6933 |
| 64 | Ga0075429_100262130 | 3300006880 | Bacteria | 1513 |
| 65 | Ga0075436_100087080 | 3300006914 | Bacteria | 2169 |
| 66 | Ga0097620_100015481 | 3300006931 | Bacteria | 7663 |
| 67 | Ga0079104_1000143 | 3300006946 | Bacteria | 101361 |
| 68 | Ga0105251_10000001 | 3300009011 | Bacteria | 466643 |
| 69 | Ga0105251_10000571 | 3300009011 | Bacteria | 34449 |
| 70 | Ga0105251_10008065 | 3300009011 | Bacteria | 6381 |
| 71 | Ga0105251_10016806 | 3300009011 | Bacteria | 3939 |
| 72 | Ga0105251_10023304 | 3300009011 | Bacteria | 3197 |
| 73 | Ga0105251_10030919 | 3300009011 | Bacteria | 2684 |
| 74 | Ga0105251_10045232 | 3300009011 | Bacteria | 2123 |
| 75 | Ga0105251_10076209 | 3300009011 | Bacteria | 1556 |
| 76 | Ga0105244_10000277 | 3300009036 | Bacteria | 51399 |
| 77 | Ga0105244_10000325 | 3300009036 | Bacteria | 45650 |
| 78 | Ga0105244_10000907 | 3300009036 | Bacteria | 25017 |
| 79 | Ga0105244_10004021 | 3300009036 | Bacteria | 10276 |
| 80 | Ga0105244_10005358 | 3300009036 | Bacteria | 8539 |
| 81 | Ga0105244_10006752 | 3300009036 | Bacteria | 7379 |
| 82 | Ga0105244_10008600 | 3300009036 | Bacteria | 6362 |
| 83 | Ga0105244_10014311 | 3300009036 | Bacteria | 4592 |
| 84 | Ga0105244_10021452 | 3300009036 | Bacteria | 3572 |
| 85 | Ga0105244_10036305 | 3300009036 | Bacteria | 2582 |
| 86 | Ga0105244_10072259 | 3300009036 | Bacteria | 1719 |
| 87 | Ga0105244_10107362 | 3300009036 | Bacteria | 1361 |
| 88 | Ga0105244_10128256 | 3300009036 | Bacteria | 1225 |
| 89 | Ga0105250_10000015 | 3300009092 | Bacteria | 262683 |
| 90 | Ga0105250_10000679 | 3300009092 | Bacteria | 21367 |
| 91 | Ga0105250_10001563 | 3300009092 | Bacteria | 12305 |
| 92 | Ga0105250_10008485 | 3300009092 | Bacteria | 4361 |
| 93 | Ga0105250_10020438 | 3300009092 | Bacteria | 2676 |
| 94 | Ga0105240_10142203 | 3300009093 | Bacteria | 2868 |
| 95 | Ga0111539_10046032 | 3300009094 | Bacteria | 5221 |
| 96 | Ga0111539_10474394 | 3300009094 | Bacteria | 1457 |
| 97 | Ga0105245_10014982 | 3300009098 | Bacteria | 6754 |
| 98 | Ga0105247_10001526 | 3300009101 | Bacteria | 16541 |
| 99 | Ga0105243_10000020 | 3300009148 | Bacteria | 214279 |
| 100 | Ga0105243_10067859 | 3300009148 | Bacteria | 2873 |
| 101 | Ga0105243_10230220 | 3300009148 | Bacteria | 1644 |
| 102 | Ga0105242_10002506 | 3300009176 | Bacteria | 14403 |
| 103 | Ga0105237_10000042 | 3300009545 | Bacteria | 181280 |
| 104 | Ga0105239_10022541 | 3300010375 | Bacteria | 6943 |
| 105 | Ga0105246_10000010 | 3300011119 | Bacteria | 69400 |
| 106 | Ga0105246_10000641 | 3300011119 | Bacteria | 19535 |
| 107 | Ga0105246_10002448 | 3300011119 | Bacteria | 11207 |
| 108 | Ga0105246_10245719 | 3300011119 | Bacteria | 1417 |
| 109 | Ga0157345_1000060 | 3300012498 | Bacteria | 23153 |
| 110 | Ga0157345_1001954 | 3300012498 | Bacteria | 1444 |
| 111 | Ga0157373_10001425 | 3300013100 | Bacteria | 18233 |
| 112 | Ga0157373_10003868 | 3300013100 | Bacteria | 11315 |
| 113 | Ga0157373_10029199 | 3300013100 | Bacteria | 3974 |
| 114 | Ga0157371_10000635 | 3300013102 | Bacteria | 41753 |
| 115 | Ga0157371_10022147 | 3300013102 | Bacteria | 4660 |
| 116 | Ga0157371_10221470 | 3300013102 | Bacteria | 1359 |
| 117 | Ga0157370_10002554 | 3300013104 | Bacteria | 21839 |
| 118 | Ga0157370_10016221 | 3300013104 | Bacteria | 7550 |
| 119 | Ga0157370_10332993 | 3300013104 | Bacteria | 1399 |
| 120 | Ga0157369_10001667 | 3300013105 | Bacteria | 27075 |
| 121 | Ga0157369_10004855 | 3300013105 | Bacteria | 15777 |
| 122 | Ga0157369_10019056 | 3300013105 | Bacteria | 7683 |
| 123 | Ga0157374_10031348 | 3300013296 | Bacteria | 4832 |
| 124 | Ga0163162_10000169 | 3300013306 | Bacteria | 60285 |
| 125 | Ga0163162_10015519 | 3300013306 | Bacteria | 7445 |
| 126 | Ga0163162_10149019 | 3300013306 | Bacteria | 2456 |
| 127 | Ga0163162_10160225 | 3300013306 | Bacteria | 2372 |
| 128 | Ga0163162_10477404 | 3300013306 | Bacteria | 1378 |
| 129 | Ga0163162_10590966 | 3300013306 | Bacteria | 1237 |
| 130 | Ga0157372_10004428 | 3300013307 | Bacteria | 14984 |
| 131 | Ga0157375_10001060 | 3300013308 | Bacteria | 23747 |
| 132 | Ga0157375_10083123 | 3300013308 | Bacteria | 3246 |
| 133 | Ga0157375_10226048 | 3300013308 | Bacteria | 2030 |
| 134 | Ga0163163_10003261 | 3300014325 | Bacteria | 13761 |
| 135 | Ga0182008_10001212 | 3300014497 | Bacteria | 17765 |
| 136 | Ga0182008_10002733 | 3300014497 | Bacteria | 10938 |
| 137 | Ga0182008_10003513 | 3300014497 | Bacteria | 9444 |
| 138 | Ga0182008_10014394 | 3300014497 | Bacteria | 4142 |
| 139 | Ga0182008_10016275 | 3300014497 | Bacteria | 3866 |
| 140 | Ga0157379_10020541 | 3300014968 | Bacteria | 5841 |
| 141 | Ga0182006_1000165 | 3300015261 | Bacteria | 70092 |
| 142 | Ga0182006_1000387 | 3300015261 | Bacteria | 36363 |
| 143 | Ga0182006_1007913 | 3300015261 | Bacteria | 4837 |
| 144 | Ga0182006_1025370 | 3300015261 | Bacteria | 2435 |
| 145 | Ga0182007_10000108 | 3300015262 | Bacteria | 57807 |
| 146 | Ga0182007_10009387 | 3300015262 | Bacteria | 3948 |
| 147 | Ga0182005_1000470 | 3300015265 | Bacteria | 20931 |
| 148 | Ga0182005_1003132 | 3300015265 | Bacteria | 5689 |
| 149 | Ga0182005_1005478 | 3300015265 | Bacteria | 3961 |
| 150 | Ga0182005_1013514 | 3300015265 | Bacteria | 2295 |
| 151 | Ga0182005_1038670 | 3300015265 | Bacteria | 1298 |
| 152 | Ga0163161_10001803 | 3300017792 | Bacteria | 15639 |
| 153 | Ga0163161_10003345 | 3300017792 | Bacteria | 11243 |
| 154 | Ga0163161_10003497 | 3300017792 | Bacteria | 11000 |
| 155 | Ga0163161_10009162 | 3300017792 | Bacteria | 6841 |
| 156 | Ga0163161_10023843 | 3300017792 | Bacteria | 4318 |
| 157 | Ga0163161_10029906 | 3300017792 | Bacteria | 3873 |
| 158 | Ga0209435_100687 | 3300025206 | Bacteria | 5899 |
| 159 | Ga0209760_100032 | 3300025207 | Bacteria | 138015 |
| 160 | Ga0209760_100036 | 3300025207 | Bacteria | 130845 |
| 161 | Ga0209784_100023 | 3300025224 | Bacteria | 399841 |
| 162 | Ga0209566_100019 | 3300025225 | Bacteria | 414836 |
| 163 | Ga0209674_100034 | 3300025226 | Bacteria | 414903 |
| 164 | Ga0209147_100027 | 3300025229 | Bacteria | 414610 |
| 165 | Ga0209563_100037 | 3300025230 | Bacteria | 414903 |
| 166 | Ga0209563_100298 | 3300025230 | Bacteria | 20216 |
| 167 | Ga0207427_100003 | 3300025231 | Bacteria | 1035004 |
| 168 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 169 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 170 | Ga0209437_100025 | 3300025233 | Bacteria | 561333 |
| 171 | Ga0209646_1000318 | 3300025246 | Bacteria | 37146 |
| 172 | Ga0209677_100021 | 3300025253 | Bacteria | 414954 |
| 173 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 174 | Ga0209233_1000145 | 3300025261 | Bacteria | 188955 |
| 175 | Ga0209675_1011697 | 3300025291 | Bacteria | 2892 |
| 176 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 177 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 178 | Ga0209676_1002106 | 3300025292 | Bacteria | 15320 |
| 179 | Ga0209676_1011728 | 3300025292 | Bacteria | 3506 |
| 180 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 181 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 182 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 183 | Ga0209050_1000763 | 3300025298 | Bacteria | 46213 |
| 184 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 185 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 186 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 187 | Ga0209257_1000029 | 3300025304 | Bacteria | 695617 |
| 188 | Ga0209257_1009178 | 3300025304 | Bacteria | 5376 |
| 189 | Ga0207656_10005289 | 3300025321 | Bacteria | 4553 |
| 190 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 191 | Ga0207696_1000017 | 3300025711 | Bacteria | 491130 |
| 192 | Ga0207696_1000460 | 3300025711 | Bacteria | 35536 |
| 193 | Ga0207655_1000006 | 3300025728 | Bacteria | 861092 |
| 194 | Ga0207655_1000074 | 3300025728 | Bacteria | 232056 |
| 195 | Ga0207655_1000098 | 3300025728 | Bacteria | 190699 |
| 196 | Ga0207655_1000410 | 3300025728 | Bacteria | 59117 |
| 197 | Ga0207655_1001712 | 3300025728 | Bacteria | 19282 |
| 198 | Ga0207655_1002318 | 3300025728 | Bacteria | 15638 |
| 199 | Ga0207655_1002796 | 3300025728 | Bacteria | 13554 |
| 200 | Ga0207655_1003616 | 3300025728 | Bacteria | 11425 |
| 201 | Ga0207655_1004728 | 3300025728 | Bacteria | 9515 |
| 202 | Ga0207655_1006032 | 3300025728 | Bacteria | 8101 |
| 203 | Ga0207655_1008809 | 3300025728 | Bacteria | 6349 |
| 204 | Ga0207655_1009171 | 3300025728 | Bacteria | 6180 |
| 205 | Ga0207713_1000061 | 3300025735 | Bacteria | 209289 |
| 206 | Ga0207713_1000284 | 3300025735 | Bacteria | 58743 |
| 207 | Ga0207713_1000518 | 3300025735 | Bacteria | 39106 |
| 208 | Ga0207713_1000929 | 3300025735 | Bacteria | 26289 |
| 209 | Ga0207713_1001602 | 3300025735 | Bacteria | 17673 |
| 210 | Ga0207713_1006155 | 3300025735 | Bacteria | 7368 |
| 211 | Ga0207713_1008243 | 3300025735 | Bacteria | 6027 |
| 212 | Ga0207713_1014599 | 3300025735 | Bacteria | 4072 |
| 213 | Ga0207713_1031048 | 3300025735 | Bacteria | 2369 |
| 214 | Ga0207713_1051401 | 3300025735 | Bacteria | 1639 |
| 215 | Ga0207713_1087496 | 3300025735 | Bacteria | 1104 |
| 216 | Ga0207710_10014435 | 3300025900 | Bacteria | 3331 |
| 217 | Ga0207680_10063301 | 3300025903 | Bacteria | 2263 |
| 218 | Ga0207671_10000474 | 3300025914 | Bacteria | 54456 |
| 219 | Ga0207649_10000010 | 3300025920 | Bacteria | 284354 |
| 220 | Ga0207681_10003542 | 3300025923 | Bacteria | 9722 |
| 221 | Ga0207681_10103883 | 3300025923 | Bacteria | 2054 |
| 222 | Ga0207650_10000690 | 3300025925 | Bacteria | 26485 |
| 223 | Ga0207650_10228408 | 3300025925 | Bacteria | 1500 |
| 224 | Ga0207659_10342895 | 3300025926 | Bacteria | 1238 |
| 225 | Ga0207706_10002181 | 3300025933 | Bacteria | 19100 |
| 226 | Ga0207686_10008489 | 3300025934 | Bacteria | 5549 |
| 227 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 228 | Ga0207709_10004919 | 3300025935 | Bacteria | 7646 |
| 229 | Ga0207709_10079342 | 3300025935 | Bacteria | 2110 |
| 230 | Ga0207670_10107537 | 3300025936 | Bacteria | 2003 |
| 231 | Ga0207679_10000022 | 3300025945 | Bacteria | 219036 |
| 232 | Ga0207703_10092538 | 3300026035 | Bacteria | 2545 |
| 233 | Ga0207639_10076491 | 3300026041 | Bacteria | 2636 |
| 234 | Ga0207641_10027117 | 3300026088 | Bacteria | 4730 |
| 235 | Ga0207676_10005759 | 3300026095 | Bacteria | 8763 |
| 236 | Ga0207683_10116531 | 3300026121 | Bacteria | 2395 |
| 237 | Ga0209281_1000063 | 3300027111 | Bacteria | 288465 |
| 238 | Ga0207428_10129918 | 3300027907 | Bacteria | 1928 |
| 239 | Ga0268266_10028275 | 3300028379 | Bacteria | 4766 |
| 240 | Ga0268266_10174792 | 3300028379 | Bacteria | 1952 |
| 241 | Ga0307511_10053051 | 3300030521 | Bacteria | 3220 |
| 242 | Ga0307408_100003398 | 3300031548 | Bacteria | 10921 |
| 243 | Ga0316579_10013422 | 3300031691 | Bacteria | 3524 |
| 244 | Ga0307405_10018233 | 3300031731 | Bacteria | 3869 |
| 245 | Ga0316577_10050573 | 3300031733 | Bacteria | 2320 |
| 246 | Ga0307510_10003671 | 3300033180 | Bacteria | 17922 |
| 247 | Ga0307510_10098723 | 3300033180 | Bacteria | 2723 |
| 248 | Ga0373956_0031941 | 3300035119 | Bacteria | 2309 |
| 249 | Ga0373957_0005501 | 3300035120 | Bacteria | 3928 |
| 250 | Ga0373962_0025273 | 3300035242 | Bacteria | 1595 |
| 251 | Ga0373937_0003245 | 3300036401 | Bacteria | 13631 |
| 252 | Ga0316582_0047164 | 3300036647 | Bacteria | 2719 |
| 253 | Ga0316582_0081291 | 3300036647 | Bacteria | 2116 |
| 254 | Ga0439447_001977 | 3300041407 | Bacteria | 7525 |
| 255 | Ga0439432_000085 | 3300042006 | Bacteria | 29181 |
| 256 | Ga0439463_000996 | 3300042016 | Bacteria | 7717 |
| 257 | Ga0453684_0031837 | 3300044712 | Bacteria | 7397 |
| 258 | Ga0495617_000148 | 3300046452 | Bacteria | 44939 |
| 259 | Ga0495617_001573 | 3300046452 | Bacteria | 9860 |
| 260 | Ga0495617_011304 | 3300046452 | Bacteria | 3046 |
| 261 | Ga0495617_134492 | 3300046452 | Bacteria | 791 |
| 262 | Ga0495627_000031 | 3300046453 | Bacteria | 226981 |
| 263 | Ga0495627_013920 | 3300046453 | Bacteria | 2821 |
| 264 | Ga0495627_014731 | 3300046453 | Bacteria | 2720 |
| 265 | Ga0495627_027534 | 3300046453 | Bacteria | 1822 |
| 266 | Ga0495627_046447 | 3300046453 | Bacteria | 1319 |
| 267 | Ga0495603_0003135 | 3300046455 | Bacteria | 9826 |
| 268 | Ga0495603_0020988 | 3300046455 | Bacteria | 3955 |
| 269 | Ga0495603_0063316 | 3300046455 | Bacteria | 2182 |
| 270 | Ga0495603_0218698 | 3300046455 | Bacteria | 1099 |
| 271 | Ga0495603_0282140 | 3300046455 | Bacteria | 955 |
| 272 | Ga0495590_0000177 | 3300046457 | Bacteria | 37380 |
| 273 | Ga0495590_0001583 | 3300046457 | Bacteria | 9745 |
| 274 | Ga0495591_000053 | 3300046458 | Bacteria | 135500 |
| 275 | Ga0495591_000172 | 3300046458 | Bacteria | 67392 |
| 276 | Ga0495591_000465 | 3300046458 | Bacteria | 32374 |
| 277 | Ga0495591_000873 | 3300046458 | Bacteria | 21156 |
| 278 | Ga0495591_000957 | 3300046458 | Bacteria | 19741 |
| 279 | Ga0495591_005313 | 3300046458 | Bacteria | 5995 |
| 280 | Ga0495591_024863 | 3300046458 | Bacteria | 1889 |
| 281 | Ga0495591_031032 | 3300046458 | Bacteria | 1607 |
| 282 | Ga0495629_0007303 | 3300046459 | Bacteria | 8139 |
| 283 | Ga0495638_0001323 | 3300046460 | Bacteria | 22805 |
| 284 | Ga0495638_0021055 | 3300046460 | Bacteria | 4301 |
| 285 | Ga0495638_0171078 | 3300046460 | Bacteria | 1246 |
| 286 | Ga0495653_0000652 | 3300046463 | Bacteria | 26457 |
| 287 | Ga0495653_0004505 | 3300046463 | Bacteria | 11249 |
| 288 | Ga0495653_0069799 | 3300046463 | Bacteria | 2630 |
| 289 | Ga0495653_0079334 | 3300046463 | Bacteria | 2431 |
| 290 | Ga0495650_0003897 | 3300046471 | Bacteria | 10547 |
| 291 | Ga0495650_0004145 | 3300046471 | Bacteria | 10095 |
| 292 | Ga0495650_0004343 | 3300046471 | Bacteria | 9772 |
| 293 | Ga0495650_0015582 | 3300046471 | Bacteria | 3892 |
| 294 | Ga0495650_0069785 | 3300046471 | Bacteria | 1381 |
| 295 | Ga0495582_0002904 | 3300046473 | Bacteria | 9580 |
| 296 | Ga0495605_0000007 | 3300046474 | Bacteria | 358289 |
| 297 | Ga0495605_0000054 | 3300046474 | Bacteria | 157560 |
| 298 | Ga0495605_0000778 | 3300046474 | Bacteria | 22880 |
| 299 | Ga0495605_0000840 | 3300046474 | Bacteria | 21512 |
| 300 | Ga0495605_0003164 | 3300046474 | Bacteria | 9894 |
| 301 | Ga0495605_0010382 | 3300046474 | Bacteria | 5213 |
| 302 | Ga0495605_0016891 | 3300046474 | Bacteria | 3943 |
| 303 | Ga0495605_0044400 | 3300046474 | Bacteria | 2198 |
| 304 | Ga0495605_0231102 | 3300046474 | Bacteria | 796 |
| 305 | Ga0495639_0000053 | 3300046475 | Bacteria | 50537 |
| 306 | Ga0495662_0093818 | 3300046476 | Bacteria | 1465 |
| 307 | Ga0495584_0000120 | 3300046491 | Bacteria | 54113 |
| 308 | Ga0495584_0000715 | 3300046491 | Bacteria | 21886 |
| 309 | Ga0495584_0002413 | 3300046491 | Bacteria | 10621 |
| 310 | Ga0495584_0002856 | 3300046491 | Bacteria | 9648 |
| 311 | Ga0495584_0008390 | 3300046491 | Bacteria | 5351 |
| 312 | Ga0495584_0029168 | 3300046491 | Bacteria | 2796 |
| 313 | Ga0495584_0150225 | 3300046491 | Bacteria | 1183 |
| 314 | Ga0495584_0193025 | 3300046491 | Bacteria | 1035 |
| 315 | Ga0495585_0001852 | 3300046492 | Bacteria | 15999 |
| 316 | Ga0495585_0010533 | 3300046492 | Bacteria | 5500 |
| 317 | Ga0495585_0010605 | 3300046492 | Bacteria | 5477 |
| 318 | Ga0495585_0026976 | 3300046492 | Bacteria | 3279 |
| 319 | Ga0495585_0027811 | 3300046492 | Bacteria | 3227 |
| 320 | Ga0495594_0002699 | 3300046499 | Bacteria | 9218 |
| 321 | Ga0495594_0008625 | 3300046499 | Bacteria | 5252 |
| 322 | Ga0495594_0020880 | 3300046499 | Bacteria | 3492 |
| 323 | Ga0495594_0170138 | 3300046499 | Bacteria | 1239 |
| 324 | Ga0495596_0014418 | 3300046500 | Bacteria | 3331 |
| 325 | Ga0495596_0022930 | 3300046500 | Bacteria | 2536 |
| 326 | Ga0495607_0000036 | 3300046501 | Bacteria | 140259 |
| 327 | Ga0495607_0000041 | 3300046501 | Bacteria | 132443 |
| 328 | Ga0495607_0003777 | 3300046501 | Bacteria | 11448 |
| 329 | Ga0495607_0004345 | 3300046501 | Bacteria | 10459 |
| 330 | Ga0495607_0006048 | 3300046501 | Bacteria | 8568 |
| 331 | Ga0495607_0006235 | 3300046501 | Bacteria | 8408 |
| 332 | Ga0495607_0007191 | 3300046501 | Bacteria | 7732 |
| 333 | Ga0495607_0015516 | 3300046501 | Bacteria | 4935 |
| 334 | Ga0495607_0019764 | 3300046501 | Bacteria | 4272 |
| 335 | Ga0495607_0040366 | 3300046501 | Bacteria | 2779 |
| 336 | Ga0495607_0107225 | 3300046501 | Bacteria | 1486 |
| 337 | Ga0495607_0111142 | 3300046501 | Bacteria | 1452 |
| 338 | Ga0495583_0000007 | 3300046506 | Bacteria | 434661 |
| 339 | Ga0495583_0000865 | 3300046506 | Bacteria | 36805 |
| 340 | Ga0495583_0001830 | 3300046506 | Bacteria | 19857 |
| 341 | Ga0495583_0005112 | 3300046506 | Bacteria | 9038 |
| 342 | Ga0495606_0000079 | 3300046507 | Bacteria | 164788 |
| 343 | Ga0495606_0000473 | 3300046507 | Bacteria | 65980 |
| 344 | Ga0495606_0001688 | 3300046507 | Bacteria | 28502 |
| 345 | Ga0495606_0016943 | 3300046507 | Bacteria | 5530 |
| 346 | Ga0495606_0026227 | 3300046507 | Bacteria | 4155 |
| 347 | Ga0495606_0076632 | 3300046507 | Bacteria | 2089 |
| 348 | Ga0495606_0148379 | 3300046507 | Bacteria | 1378 |
| 349 | Ga0495610_0000455 | 3300046512 | Bacteria | 42440 |
| 350 | Ga0495610_0005425 | 3300046512 | Bacteria | 9065 |
| 351 | Ga0495610_0007848 | 3300046512 | Bacteria | 7020 |
| 352 | Ga0495610_0023899 | 3300046512 | Bacteria | 3310 |
| 353 | Ga0495610_0027121 | 3300046512 | Bacteria | 3050 |
| 354 | Ga0495610_0036057 | 3300046512 | Bacteria | 2531 |
| 355 | Ga0495610_0062649 | 3300046512 | Bacteria | 1763 |
| 356 | Ga0495610_0063665 | 3300046512 | Bacteria | 1745 |
| 357 | Ga0495616_0000535 | 3300046513 | Bacteria | 28683 |
| 358 | Ga0495616_0000626 | 3300046513 | Bacteria | 26459 |
| 359 | Ga0495616_0000695 | 3300046513 | Bacteria | 24905 |
| 360 | Ga0495616_0001570 | 3300046513 | Bacteria | 15739 |
| 361 | Ga0495616_0008679 | 3300046513 | Bacteria | 5997 |
| 362 | Ga0495616_0011630 | 3300046513 | Bacteria | 5033 |
| 363 | Ga0495616_0019605 | 3300046513 | Bacteria | 3688 |
| 364 | Ga0495616_0063770 | 3300046513 | Bacteria | 1800 |
| 365 | Ga0495620_0000014 | 3300046515 | Bacteria | 157890 |
| 366 | Ga0495620_0000152 | 3300046515 | Bacteria | 56303 |
| 367 | Ga0495620_0001722 | 3300046515 | Bacteria | 12919 |
| 368 | Ga0495620_0004792 | 3300046515 | Bacteria | 7602 |
| 369 | Ga0495620_0011843 | 3300046515 | Bacteria | 4534 |
| 370 | Ga0495620_0058903 | 3300046515 | Bacteria | 1606 |
| 371 | Ga0495630_0009776 | 3300046517 | Bacteria | 6903 |
| 372 | Ga0495630_0016625 | 3300046517 | Bacteria | 5380 |
| 373 | Ga0495630_0019132 | 3300046517 | Bacteria | 5033 |
| 374 | Ga0495631_0000175 | 3300046518 | Bacteria | 43711 |
| 375 | Ga0495631_0000526 | 3300046518 | Bacteria | 25725 |
| 376 | Ga0495631_0005621 | 3300046518 | Bacteria | 6546 |
| 377 | Ga0495631_0009829 | 3300046518 | Bacteria | 4761 |
| 378 | Ga0495632_0000361 | 3300046519 | Bacteria | 43155 |
| 379 | Ga0495632_0003232 | 3300046519 | Bacteria | 11690 |
| 380 | Ga0495632_0005275 | 3300046519 | Bacteria | 8585 |
| 381 | Ga0495632_0008562 | 3300046519 | Bacteria | 6258 |
| 382 | Ga0495632_0010316 | 3300046519 | Bacteria | 5542 |
| 383 | Ga0495632_0074200 | 3300046519 | Bacteria | 1630 |
| 384 | Ga0495632_0108940 | 3300046519 | Bacteria | 1301 |
| 385 | Ga0495637_0000606 | 3300046520 | Bacteria | 25539 |
| 386 | Ga0495637_0000950 | 3300046520 | Bacteria | 18520 |
| 387 | Ga0495637_0001129 | 3300046520 | Bacteria | 16349 |
| 388 | Ga0495637_0001455 | 3300046520 | Bacteria | 13939 |
| 389 | Ga0495637_0011047 | 3300046520 | Bacteria | 4349 |
| 390 | Ga0495637_0023176 | 3300046520 | Bacteria | 2825 |
| 391 | Ga0495637_0048733 | 3300046520 | Bacteria | 1783 |
| 392 | Ga0495643_0061324 | 3300046522 | Bacteria | 1995 |
| 393 | Ga0495644_0002949 | 3300046523 | Bacteria | 6761 |
| 394 | Ga0495648_0000062 | 3300046524 | Bacteria | 150125 |
| 395 | Ga0495648_0002500 | 3300046524 | Bacteria | 16867 |
| 396 | Ga0495648_0002645 | 3300046524 | Bacteria | 16251 |
| 397 | Ga0495648_0013756 | 3300046524 | Bacteria | 5964 |
| 398 | Ga0495648_0017504 | 3300046524 | Bacteria | 5118 |
| 399 | Ga0495648_0025045 | 3300046524 | Bacteria | 4048 |
| 400 | Ga0495648_0030439 | 3300046524 | Bacteria | 3568 |
| 401 | Ga0495648_0067288 | 3300046524 | Bacteria | 2095 |
| 402 | Ga0495648_0087622 | 3300046524 | Bacteria | 1752 |
| 403 | Ga0495648_0201893 | 3300046524 | Bacteria | 994 |
| 404 | Ga0495666_0000908 | 3300046526 | Bacteria | 13883 |
| 405 | Ga0495666_0001595 | 3300046526 | Bacteria | 11162 |
| 406 | Ga0495642_0000006 | 3300046528 | Bacteria | 172412 |
| 407 | Ga0495642_0000044 | 3300046528 | Bacteria | 74850 |
| 408 | Ga0495642_0001263 | 3300046528 | Bacteria | 11491 |
| 409 | Ga0495654_0000113 | 3300046530 | Bacteria | 91858 |
| 410 | Ga0495654_0000600 | 3300046530 | Bacteria | 28665 |
| 411 | Ga0495654_0000688 | 3300046530 | Bacteria | 26476 |
| 412 | Ga0495654_0001563 | 3300046530 | Bacteria | 15520 |
| 413 | Ga0495654_0011138 | 3300046530 | Bacteria | 4882 |
| 414 | Ga0495654_0013073 | 3300046530 | Bacteria | 4446 |
| 415 | Ga0495654_0039041 | 3300046530 | Bacteria | 2371 |
| 416 | Ga0495654_0045145 | 3300046530 | Bacteria | 2175 |
| 417 | Ga0495654_0113151 | 3300046530 | Bacteria | 1236 |
| 418 | Ga0495640_0073221 | 3300046533 | Bacteria | 2294 |
| 419 | Ga0495587_0003803 | 3300046536 | Bacteria | 10014 |
| 420 | Ga0495609_0000004 | 3300046538 | Bacteria | 697346 |
| 421 | Ga0495609_0000016 | 3300046538 | Bacteria | 312882 |
| 422 | Ga0495609_0001070 | 3300046538 | Bacteria | 19166 |
| 423 | Ga0495609_0001736 | 3300046538 | Bacteria | 14068 |
| 424 | Ga0495609_0001936 | 3300046538 | Bacteria | 13176 |
| 425 | Ga0495609_0002104 | 3300046538 | Bacteria | 12506 |
| 426 | Ga0495609_0024039 | 3300046538 | Bacteria | 2797 |
| 427 | Ga0495609_0085081 | 3300046538 | Bacteria | 1379 |
| 428 | Ga0495609_0100384 | 3300046538 | Bacteria | 1254 |
| 429 | Ga0495597_0000800 | 3300046542 | Bacteria | 24862 |
| 430 | Ga0495597_0004988 | 3300046542 | Bacteria | 7125 |
| 431 | Ga0495597_0016693 | 3300046542 | Bacteria | 3465 |
| 432 | Ga0495622_0000414 | 3300046557 | Bacteria | 28333 |
| 433 | Ga0495622_0003325 | 3300046557 | Bacteria | 7594 |
| 434 | Ga0495622_0012172 | 3300046557 | Bacteria | 3979 |
| 435 | Ga0495622_0017579 | 3300046557 | Bacteria | 3330 |
| 436 | Ga0495622_0019411 | 3300046557 | Bacteria | 3165 |
| 437 | Ga0495622_0066032 | 3300046557 | Bacteria | 1672 |
| 438 | Ga0495633_0000051 | 3300046558 | Bacteria | 154944 |
| 439 | Ga0495633_0003219 | 3300046558 | Bacteria | 11022 |
| 440 | Ga0495633_0026211 | 3300046558 | Bacteria | 2862 |
| 441 | Ga0495656_0000803 | 3300046615 | Bacteria | 10182 |
| 442 | Ga0495668_0002764 | 3300046616 | Bacteria | 14024 |
| 443 | Ga0495668_0007019 | 3300046616 | Bacteria | 7270 |
| 444 | Ga0495668_0013998 | 3300046616 | Bacteria | 4716 |
| 445 | Ga0495668_0073636 | 3300046616 | Bacteria | 1875 |
| 446 | Ga0495634_0000815 | 3300046642 | Bacteria | 30341 |
| 447 | Ga0495611_0000019 | 3300046648 | Bacteria | 126076 |
| 448 | Ga0495611_0000548 | 3300046648 | Bacteria | 21987 |
| 449 | Ga0495611_0001208 | 3300046648 | Bacteria | 13357 |
| 450 | Ga0495625_0000084 | 3300046660 | Bacteria | 151895 |
| 451 | Ga0495625_0003120 | 3300046660 | Bacteria | 16928 |
| 452 | Ga0495625_0004063 | 3300046660 | Bacteria | 13985 |
| 453 | Ga0495625_0029114 | 3300046660 | Bacteria | 4134 |
| 454 | Ga0495625_0075677 | 3300046660 | Bacteria | 2355 |
| 455 | Ga0495635_0000522 | 3300046663 | Bacteria | 24345 |
| 456 | Ga0495635_0001311 | 3300046663 | Bacteria | 16580 |
| 457 | Ga0495635_0005853 | 3300046663 | Bacteria | 8567 |
| 458 | Ga0495659_0000119 | 3300046664 | Bacteria | 34751 |
| 459 | Ga0495659_0009781 | 3300046664 | Bacteria | 3068 |
| 460 | Ga0495659_0069119 | 3300046664 | Bacteria | 1320 |
| 461 | Ga0495661_0000035 | 3300046665 | Bacteria | 165551 |
| 462 | Ga0495661_0000051 | 3300046665 | Bacteria | 140353 |
| 463 | Ga0495661_0000106 | 3300046665 | Bacteria | 100351 |
| 464 | Ga0495661_0000269 | 3300046665 | Bacteria | 59794 |
| 465 | Ga0495661_0005186 | 3300046665 | Bacteria | 9285 |
| 466 | Ga0495661_0025282 | 3300046665 | Bacteria | 3836 |
| 467 | Ga0495661_0092887 | 3300046665 | Bacteria | 1713 |
| 468 | Ga0495588_0025528 | 3300046674 | Bacteria | 2944 |
| 469 | Ga0495588_0099878 | 3300046674 | Bacteria | 1524 |
| 470 | Ga0495657_0021575 | 3300046675 | Bacteria | 4621 |
| 471 | Ga0495623_0009066 | 3300046679 | Bacteria | 6453 |
| 472 | Ga0495623_0016801 | 3300046679 | Bacteria | 4728 |
| 473 | Ga0495646_0003353 | 3300046680 | Bacteria | 9960 |
| 474 | Ga0495646_0003495 | 3300046680 | Bacteria | 9782 |
| 475 | Ga0495646_0036488 | 3300046680 | Bacteria | 3044 |
| 476 | Ga0495658_0001304 | 3300046683 | Bacteria | 13062 |
| 477 | Ga0495658_0223789 | 3300046683 | Bacteria | 1179 |
| 478 | Ga0495669_0001087 | 3300046684 | Bacteria | 11253 |
| 479 | Ga0495669_0070768 | 3300046684 | Bacteria | 1589 |
| 480 | Ga0495613_0018880 | 3300046689 | Bacteria | 5137 |
| 481 | Ga0495613_0020085 | 3300046689 | Bacteria | 4977 |
| 482 | Ga0495613_0133447 | 3300046689 | Bacteria | 1777 |
| 483 | Ga0495624_0000237 | 3300046690 | Bacteria | 43145 |
| 484 | Ga0495670_0000455 | 3300046691 | Bacteria | 19525 |
| 485 | Ga0495670_0000777 | 3300046691 | Bacteria | 15304 |
| 486 | Ga0495670_0012161 | 3300046691 | Bacteria | 4233 |
| 487 | Ga0495670_0022360 | 3300046691 | Bacteria | 3123 |
| 488 | Ga0495670_0140081 | 3300046691 | Bacteria | 1264 |
| 489 | Ga0495671_0000210 | 3300046692 | Bacteria | 51181 |
| 490 | Ga0495671_0001187 | 3300046692 | Bacteria | 17825 |
| 491 | Ga0495671_0001243 | 3300046692 | Bacteria | 17423 |
| 492 | Ga0495671_0003398 | 3300046692 | Bacteria | 9791 |
| 493 | Ga0495671_0006777 | 3300046692 | Bacteria | 6586 |
| 494 | Ga0495671_0179235 | 3300046692 | Bacteria | 1029 |
| 495 | Ga0495649_0000748 | 3300046694 | Bacteria | 26199 |
| 496 | Ga0495649_0002964 | 3300046694 | Bacteria | 11692 |
| 497 | Ga0495649_0005325 | 3300046694 | Bacteria | 8208 |
| 498 | Ga0495649_0009159 | 3300046694 | Bacteria | 5903 |
| 499 | Ga0495649_0012051 | 3300046694 | Bacteria | 5046 |
| 500 | Ga0495649_0030939 | 3300046694 | Bacteria | 2953 |
| 501 | Ga0495649_0033050 | 3300046694 | Bacteria | 2847 |
| 502 | Ga0495649_0045854 | 3300046694 | Bacteria | 2382 |
| 503 | Ga0495589_0000326 | 3300046794 | Bacteria | 37321 |
| 504 | Ga0495589_0000352 | 3300046794 | Bacteria | 35927 |
| 505 | Ga0495589_0001450 | 3300046794 | Bacteria | 13691 |
| 506 | Ga0495589_0012195 | 3300046794 | Bacteria | 4457 |
| 507 | Ga0495589_0014155 | 3300046794 | Bacteria | 4111 |
| 508 | Ga0495589_0179640 | 3300046794 | Bacteria | 1004 |
| 509 | Ga0495600_0006261 | 3300046809 | Bacteria | 7227 |
| 510 | Ga0495600_0030109 | 3300046809 | Bacteria | 3515 |
| 511 | Ga0495660_0005494 | 3300046810 | Bacteria | 7592 |
| 512 | Ga0495660_0022962 | 3300046810 | Bacteria | 3559 |
| 513 | Ga0495660_0071874 | 3300046810 | Bacteria | 1833 |
| 514 | Ga0495660_0075648 | 3300046810 | Bacteria | 1775 |
| 515 | Ga0495660_0120459 | 3300046810 | Bacteria | 1328 |
| 516 | Ga0495660_0153188 | 3300046810 | Bacteria | 1136 |
| 517 | Ga0495581_0016010 | 3300047315 | Bacteria | 4358 |
| 518 | Ga0495581_0025132 | 3300047315 | Bacteria | 3453 |
| 519 | Ga0495581_0038645 | 3300047315 | Bacteria | 2762 |
| 520 | Ga0495604_0004748 | 3300047317 | Bacteria | 10762 |
| 521 | Ga0495604_0014324 | 3300047317 | Bacteria | 6323 |
| 522 | Ga0495636_0005847 | 3300047318 | Bacteria | 4824 |
| 523 | Ga0495636_0139341 | 3300047318 | Bacteria | 1082 |
| 524 | Ga0495674_0009374 | 3300047319 | Bacteria | 9306 |
| 525 | Ga0495672_0000787 | 3300047320 | Bacteria | 34376 |
| 526 | Ga0495672_0000817 | 3300047320 | Bacteria | 33454 |
| 527 | Ga0495672_0001555 | 3300047320 | Bacteria | 22465 |
| 528 | Ga0495672_0001980 | 3300047320 | Bacteria | 19337 |
| 529 | Ga0495672_0003332 | 3300047320 | Bacteria | 13842 |
| 530 | Ga0495672_0016601 | 3300047320 | Bacteria | 4954 |
| 531 | Ga0495676_0000368 | 3300047321 | Bacteria | 37132 |
| 532 | Ga0495676_0002558 | 3300047321 | Bacteria | 16193 |
| 533 | Ga0495680_0000683 | 3300047322 | Bacteria | 37946 |
| 534 | Ga0495680_0002029 | 3300047322 | Bacteria | 21206 |
| 535 | Ga0495680_0007735 | 3300047322 | Bacteria | 9815 |
| 536 | Ga0495680_0027810 | 3300047322 | Bacteria | 4640 |
| 537 | Ga0495683_0000004 | 3300047323 | Bacteria | 321136 |
| 538 | Ga0495683_0000318 | 3300047323 | Bacteria | 40455 |
| 539 | Ga0495683_0000356 | 3300047323 | Bacteria | 37720 |
| 540 | Ga0495683_0010106 | 3300047323 | Bacteria | 5001 |
| 541 | Ga0495683_0014694 | 3300047323 | Bacteria | 4078 |
| 542 | Ga0495683_0057425 | 3300047323 | Bacteria | 1934 |
| 543 | Ga0495683_0097249 | 3300047323 | Bacteria | 1419 |
| 544 | Ga0495683_0150538 | 3300047323 | Bacteria | 1083 |
| 545 | Ga0495687_000977 | 3300047443 | Bacteria | 28996 |
| 546 | Ga0495687_006152 | 3300047443 | Bacteria | 7435 |
| 547 | Ga0495687_007971 | 3300047443 | Bacteria | 6145 |
| 548 | Ga0495675_0009385 | 3300047444 | Bacteria | 6086 |
| 549 | Ga0495675_0230582 | 3300047444 | Bacteria | 1117 |
| 550 | Ga0495677_0000848 | 3300047445 | Bacteria | 12364 |
| 551 | Ga0495679_000137 | 3300047446 | Bacteria | 65769 |
| 552 | Ga0495679_000323 | 3300047446 | Bacteria | 38033 |
| 553 | Ga0495679_008771 | 3300047446 | Bacteria | 4088 |
| 554 | Ga0495679_047765 | 3300047446 | Bacteria | 1297 |
| 555 | Ga0495673_0000118 | 3300047469 | Bacteria | 147670 |
| 556 | Ga0495673_0000465 | 3300047469 | Bacteria | 43951 |
| 557 | Ga0495673_0001449 | 3300047469 | Bacteria | 18867 |
| 558 | Ga0495673_0001451 | 3300047469 | Bacteria | 18852 |
| 559 | Ga0495673_0001736 | 3300047469 | Bacteria | 16641 |
| 560 | Ga0495673_0011327 | 3300047469 | Bacteria | 4804 |
| 561 | Ga0495673_0018699 | 3300047469 | Bacteria | 3487 |
| 562 | Ga0495673_0049386 | 3300047469 | Bacteria | 1852 |
| 563 | Ga0495673_0054125 | 3300047469 | Bacteria | 1746 |
| 564 | Ga0495673_0096219 | 3300047469 | Bacteria | 1203 |
| 565 | Ga0495673_0097333 | 3300047469 | Bacteria | 1194 |
| 566 | Ga0495673_0136166 | 3300047469 | Bacteria | 961 |
| 567 | Ga0495681_0000353 | 3300047470 | Bacteria | 35846 |
| 568 | Ga0495681_0000478 | 3300047470 | Bacteria | 30665 |
| 569 | Ga0495681_0002364 | 3300047470 | Bacteria | 13536 |
| 570 | Ga0495681_0003644 | 3300047470 | Bacteria | 10695 |
| 571 | Ga0495681_0010181 | 3300047470 | Bacteria | 5711 |
| 572 | Ga0495681_0014600 | 3300047470 | Bacteria | 4490 |
| 573 | Ga0495681_0023899 | 3300047470 | Bacteria | 3233 |
| 574 | Ga0495681_0027162 | 3300047470 | Bacteria | 2966 |
| 575 | Ga0495684_0010777 | 3300047471 | Bacteria | 7065 |
| 576 | Ga0495686_0092127 | 3300047472 | Bacteria | 1838 |
| 577 | Ga0495593_0001207 | 3300047673 | Bacteria | 15111 |
| 578 | Ga0495593_0022745 | 3300047673 | Bacteria | 3487 |
| 579 | Ga0495593_0029111 | 3300047673 | Bacteria | 3030 |
| 580 | Ga0495593_0124356 | 3300047673 | Bacteria | 1311 |
| 581 | Ga0495626_0000002 | 3300048091 | Bacteria | 436012 |
| 582 | Ga0495626_0000064 | 3300048091 | Bacteria | 142060 |
| 583 | Ga0495626_0000616 | 3300048091 | Bacteria | 34739 |
| 584 | Ga0495626_0000958 | 3300048091 | Bacteria | 25047 |
| 585 | Ga0495626_0001601 | 3300048091 | Bacteria | 17648 |
| 586 | Ga0495626_0002256 | 3300048091 | Bacteria | 13795 |
| 587 | Ga0495626_0016259 | 3300048091 | Bacteria | 3783 |
| 588 | Ga0495626_0026985 | 3300048091 | Bacteria | 2794 |
| 589 | Ga0495626_0027531 | 3300048091 | Bacteria | 2764 |
| 590 | Ga0495626_0040702 | 3300048091 | Bacteria | 2193 |
| 591 | Ga0496102_0000774 | 3300048905 | Bacteria | 31153 |
| 592 | Ga0496102_0681244 | 3300048905 | Bacteria | 951 |
| 593 | Ga0496103_0020077 | 3300048906 | Bacteria | 4012 |
| 594 | Ga0496106_0269326 | 3300048909 | Bacteria | 1363 |
| 595 | Ga0496106_0276004 | 3300048909 | Bacteria | 1346 |
| 596 | Ga0496108_0269866 | 3300048911 | Bacteria | 1481 |
| 597 | Ga0496109_0052306 | 3300048912 | Bacteria | 3722 |
| 598 | Ga0496110_0099192 | 3300048913 | Bacteria | 2611 |
| 599 | Ga0496110_0177998 | 3300048913 | Bacteria | 1931 |
| 600 | Ga0496110_0527215 | 3300048913 | Bacteria | 1074 |
| 601 | Ga0496112_0336042 | 3300048915 | Bacteria | 1454 |
| 602 | Ga0496113_0187105 | 3300048916 | Bacteria | 1643 |
| 603 | Ga0496113_0275572 | 3300048916 | Bacteria | 1345 |
| 604 | Ga0496116_0000038 | 3300048919 | Bacteria | 370217 |
| 605 | Ga0496116_0000382 | 3300048919 | Bacteria | 65862 |
| 606 | Ga0496116_0001933 | 3300048919 | Bacteria | 22333 |
| 607 | Ga0496116_0002265 | 3300048919 | Bacteria | 20408 |
| 608 | Ga0496116_0025816 | 3300048919 | Bacteria | 4309 |
| 609 | Ga0496117_0007085 | 3300048920 | Bacteria | 11081 |
| 610 | Ga0496117_0030407 | 3300048920 | Bacteria | 4145 |
| 611 | Ga0496117_0037708 | 3300048920 | Bacteria | 3596 |
| 612 | Ga0496117_0050196 | 3300048920 | Bacteria | 2960 |
| 613 | Ga0496117_0101515 | 3300048920 | Bacteria | 1818 |
| 614 | Ga0496118_0027699 | 3300048921 | Bacteria | 4788 |
| 615 | Ga0496118_0028593 | 3300048921 | Bacteria | 4691 |
| 616 | Ga0496118_0031937 | 3300048921 | Bacteria | 4349 |
| 617 | Ga0496118_0034082 | 3300048921 | Bacteria | 4163 |
| 618 | Ga0496118_0044902 | 3300048921 | Bacteria | 3455 |
| 619 | Ga0496118_0129631 | 3300048921 | Bacteria | 1623 |
| 620 | Ga0496118_0133520 | 3300048921 | Bacteria | 1588 |
| 621 | Ga0496119_0166960 | 3300048922 | Bacteria | 1165 |
| 622 | Ga0496120_0025586 | 3300048923 | Bacteria | 3661 |
| 623 | Ga0496121_0000589 | 3300048924 | Bacteria | 68077 |
| 624 | Ga0496121_0001708 | 3300048924 | Bacteria | 35986 |
| 625 | Ga0496121_0001828 | 3300048924 | Bacteria | 34313 |
| 626 | Ga0496121_0004020 | 3300048924 | Bacteria | 20222 |
| 627 | Ga0496121_0036966 | 3300048924 | Bacteria | 4343 |
| 628 | Ga0496121_0249323 | 3300048924 | Bacteria | 1232 |
| 629 | Ga0496122_0000411 | 3300048925 | Bacteria | 90936 |
| 630 | Ga0496122_0011920 | 3300048925 | Bacteria | 8730 |
| 631 | Ga0496122_0025179 | 3300048925 | Bacteria | 5178 |
| 632 | Ga0496122_0032954 | 3300048925 | Bacteria | 4270 |
| 633 | Ga0496122_0062334 | 3300048925 | Bacteria | 2730 |
| 634 | Ga0496122_0187453 | 3300048925 | Bacteria | 1225 |
| 635 | Ga0496123_0000055 | 3300048926 | Bacteria | 233626 |
| 636 | Ga0496123_0003979 | 3300048926 | Bacteria | 16005 |
| 637 | Ga0496123_0008610 | 3300048926 | Bacteria | 9338 |
| 638 | Ga0496123_0025966 | 3300048926 | Bacteria | 4401 |
| 639 | Ga0496123_0062936 | 3300048926 | Bacteria | 2373 |
| 640 | Ga0496124_0000212 | 3300048927 | Bacteria | 113713 |
| 641 | Ga0496124_0001124 | 3300048927 | Bacteria | 42065 |
| 642 | Ga0496124_0004348 | 3300048927 | Bacteria | 16595 |
| 643 | Ga0496124_0045697 | 3300048927 | Bacteria | 3753 |
| 644 | Ga0496124_0081959 | 3300048927 | Bacteria | 2649 |
| 645 | Ga0496124_0092891 | 3300048927 | Bacteria | 2457 |
| 646 | Ga0496124_0128345 | 3300048927 | Bacteria | 2018 |
| 647 | Ga0496124_0146638 | 3300048927 | Bacteria | 1856 |
| 648 | Ga0496124_0204453 | 3300048927 | Bacteria | 1499 |
| 649 | Ga0496125_0003572 | 3300048928 | Bacteria | 18713 |
| 650 | Ga0496125_0004187 | 3300048928 | Bacteria | 16817 |
| 651 | Ga0496125_0039387 | 3300048928 | Bacteria | 4071 |
| 652 | Ga0496125_0328939 | 3300048928 | Bacteria | 922 |
| 653 | Ga0496126_0032027 | 3300048929 | Bacteria | 4959 |
| 654 | Ga0496126_0044557 | 3300048929 | Bacteria | 4084 |
| 655 | Ga0496126_0044914 | 3300048929 | Bacteria | 4065 |
| 656 | Ga0496126_0160606 | 3300048929 | Bacteria | 1920 |
| 657 | Ga0495678_000014 | 3300049459 | Bacteria | 313755 |
| 658 | Ga0495678_000578 | 3300049459 | Bacteria | 34746 |
| 659 | Ga0495678_000628 | 3300049459 | Bacteria | 32813 |
| 660 | Ga0495678_002924 | 3300049459 | Bacteria | 10939 |
| 661 | Ga0495678_003304 | 3300049459 | Bacteria | 10062 |
| 662 | Ga0495678_003870 | 3300049459 | Bacteria | 8986 |
| 663 | Ga0495678_004245 | 3300049459 | Bacteria | 8392 |
| 664 | Ga0495678_013459 | 3300049459 | Bacteria | 3839 |
| 665 | Ga0495678_017896 | 3300049459 | Bacteria | 3198 |
| 666 | Ga0495678_028443 | 3300049459 | Bacteria | 2359 |
| 667 | Ga0495678_077094 | 3300049459 | Bacteria | 1206 |
| 668 | Ga0495682_0000025 | 3300049460 | Bacteria | 147931 |
| 669 | Ga0495682_0000099 | 3300049460 | Bacteria | 76287 |
| 670 | Ga0495682_0001018 | 3300049460 | Bacteria | 16623 |
| 671 | Ga0495682_0006579 | 3300049460 | Bacteria | 4697 |
| 672 | Ga0495682_0006967 | 3300049460 | Bacteria | 4531 |
| 673 | Ga0495682_0007925 | 3300049460 | Bacteria | 4203 |
| 674 | Ga0495682_0030020 | 3300049460 | Bacteria | 2012 |
| 675 | Ga0501034_0281838 | 3300049571 | Bacteria | 1601 |
| 676 | nmdc:mga0qj67_14303_c1 | 3300050509 | Bacteria | 5997 |
| 677 | nmdc:mga08y16_36124_c1 | 3300050511 | Bacteria | 5189 |
| 678 | nmdc:mga08y16_376161_c1 | 3300050511 | Bacteria | 1456 |
| 679 | nmdc:mga08x19_247214_c1 | 3300050514 | Bacteria | 1231 |
| 680 | Ga0495601_0072036 | 3300053077 | Bacteria | 2207 |
| 681 | Ga0495619_0055238 | 3300053085 | Bacteria | 2629 |
| 682 | Ga0500650_0000050 | 3300053098 | Bacteria | 39314 |
| 683 | Ga0500572_000710 | 3300053111 | Bacteria | 10800 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046452 | Ga0495617_134492 | Ga0495617_134492_22_777 | 251 |
| 2 | 3300046471 | Ga0495650_0069785 | Ga0495650_0069785_34_789 | 251 |
| 3 | 3300046474 | Ga0495605_0231102 | Ga0495605_0231102_22_777 | 251 |
| 4 | 3300046492 | Ga0495585_0010533 | Ga0495585_0010533_4720_5475 | 251 |
| 5 | 3300046524 | Ga0495648_0067288 | Ga0495648_0067288_11_766 | 251 |
| 6 | 3300046616 | Ga0495668_0073636 | Ga0495668_0073636_1097_1852 | 251 |
| 7 | 3300046648 | Ga0495611_0001208 | Ga0495611_0001208_23_778 | 251 |
| 8 | 3300046674 | Ga0495588_0099878 | Ga0495588_0099878_756_1511 | 251 |
| 9 | 3300046689 | Ga0495613_0133447 | Ga0495613_0133447_22_777 | 251 |
| 10 | 3300047469 | Ga0495673_0136166 | Ga0495673_0136166_40_843 | 267 |
| 11 | 3300046557 | Ga0495622_0019411 | Ga0495622_0019411_2254_3066 | 270 |
| 12 | 3300048915 | Ga0496112_0336042 | Ga0496112_0336042_376_1194 | 272 |
| 13 | 3300035119 | Ga0373956_0031941 | Ga0373956_0031941_928_1866 | 273 |
| 14 | 3300035120 | Ga0373957_0005501 | Ga0373957_0005501_1566_2501 | 273 |
| 15 | 3300036401 | Ga0373937_0003245 | Ga0373937_0003245_9582_10520 | 273 |
| 16 | 3300046691 | Ga0495670_0022360 | Ga0495670_0022360_33_854 | 273 |
| 17 | 3300047444 | Ga0495675_0230582 | Ga0495675_0230582_58_879 | 273 |
| 18 | 3300048927 | Ga0496124_0045697 | Ga0496124_0045697_17_838 | 273 |
| 19 | 3300048928 | Ga0496125_0328939 | Ga0496125_0328939_86_907 | 273 |
| 20 | 3300050514 | nmdc:mga08x19_247214_c1 | nmdc:mga08x19_247214_c1_366_1187 | 273 |
| 21 | 3300046463 | Ga0495653_0069799 | Ga0495653_0069799_1651_2481 | 276 |
| 22 | 3300046538 | Ga0495609_0100384 | Ga0495609_0100384_10_840 | 276 |
| 23 | 3300046692 | Ga0495671_0179235 | Ga0495671_0179235_33_863 | 276 |
| 24 | 3300047317 | Ga0495604_0004748 | Ga0495604_0004748_1523_2353 | 276 |
| 25 | 3300047323 | Ga0495683_0057425 | Ga0495683_0057425_1087_1917 | 276 |
| 26 | 3300047469 | Ga0495673_0054125 | Ga0495673_0054125_894_1724 | 276 |
| 27 | 3300048905 | Ga0496102_0000774 | Ga0496102_0000774_20931_21761 | 276 |
| 28 | 3300048906 | Ga0496103_0020077 | Ga0496103_0020077_2998_3828 | 276 |
| 29 | 3300048920 | Ga0496117_0037708 | Ga0496117_0037708_2627_3457 | 276 |
| 30 | 3300048921 | Ga0496118_0034082 | Ga0496118_0034082_466_1296 | 276 |
| 31 | 3300048929 | Ga0496126_0044914 | Ga0496126_0044914_40_870 | 276 |
| 32 | 3300044712 | Ga0453684_0031837 | Ga0453684_0031837_4102_5010 | 287 |
| 33 | 3300009036 | Ga0105244_10128256 | Ga0105244_101282562 | 289 |
| 34 | 3300009092 | Ga0105250_10001563 | Ga0105250_100015635 | 289 |
| 35 | 3300014497 | Ga0182008_10016275 | Ga0182008_100162752 | 289 |
| 36 | 3300025711 | Ga0207696_1000460 | Ga0207696_100046013 | 289 |
| 37 | 3300046492 | Ga0495585_0001852 | Ga0495585_0001852_12425_13309 | 289 |
| 38 | iso_pu_bacteria | 2599185155 | 2599328692 | 289 |
| 39 | iso_pu_bacteria | 2738541271 | 2738688111 | 289 |
| 40 | iso_pu_bacteria | 2738543016 | 2739263454 | 289 |
| 41 | iso_pu_bacteria | 2826581358 | 2826582065 | 289 |
| 42 | iso_pu_bacteria | 2842849001 | 2842852402 | 289 |
| 43 | 3300046694 | Ga0495649_0030939 | Ga0495649_0030939_12_884 | 290 |
| 44 | iso_pu_bacteria | 2511231004 | 2511255184 | 290 |
| 45 | iso_pu_bacteria | 2511231006 | 2511265490 | 290 |
| 46 | iso_pu_bacteria | 2511231007 | 2511271812 | 290 |
| 47 | iso_pu_bacteria | 2511231008 | 2511277939 | 290 |
| 48 | iso_pu_bacteria | 2511231010 | 2511288058 | 290 |
| 49 | iso_pu_bacteria | 2511231011 | 2511298692 | 290 |
| 50 | iso_pu_bacteria | 2511231012 | 2511301534 | 290 |
| 51 | iso_pu_bacteria | 2511231014 | 2511312488 | 290 |
| 52 | iso_pu_bacteria | 2511231015 | 2511318146 | 290 |
| 53 | iso_pu_bacteria | 2511231016 | 2511329408 | 290 |
| 54 | iso_pu_bacteria | 2511231017 | 2511334570 | 290 |
| 55 | iso_pu_bacteria | 2511231018 | 2511337066 | 290 |
| 56 | iso_pu_bacteria | 2511231019 | 2511343383 | 290 |
| 57 | iso_pu_bacteria | 2511231020 | 2511351799 | 290 |
| 58 | iso_pu_bacteria | 2511231022 | 2511363437 | 290 |
| 59 | iso_pu_bacteria | 2511231023 | 2511371339 | 290 |
| 60 | iso_pu_bacteria | 2511231031 | 2511411659 | 290 |
| 61 | iso_pu_bacteria | 2512047018 | 2512327218 | 290 |
| 62 | iso_pu_bacteria | 2554235341 | 2555670017 | 290 |
| 63 | iso_pu_bacteria | 2582580891 | 2583792409 | 290 |
| 64 | iso_pu_bacteria | 2597489887 | 2597858097 | 290 |
| 65 | iso_pu_bacteria | 2597489888 | 2597863931 | 290 |
| 66 | iso_pu_bacteria | 2597489889 | 2597869836 | 290 |
| 67 | iso_pu_bacteria | 2599185160 | 2599352947 | 290 |
| 68 | iso_pu_bacteria | 2599185161 | 2599359299 | 290 |
| 69 | iso_pu_bacteria | 2599185162 | 2599365180 | 290 |
| 70 | iso_pu_bacteria | 2599185163 | 2599371993 | 290 |
| 71 | iso_pu_bacteria | 2599185164 | 2599378055 | 290 |
| 72 | iso_pu_bacteria | 2599185165 | 2599384568 | 290 |
| 73 | iso_pu_bacteria | 2599185166 | 2599390851 | 290 |
| 74 | iso_pu_bacteria | 2599185167 | 2599398328 | 290 |
| 75 | iso_pu_bacteria | 2599185168 | 2599403036 | 290 |
| 76 | iso_pu_bacteria | 2599185179 | 2599450350 | 290 |
| 77 | iso_pu_bacteria | 2599185181 | 2599459781 | 290 |
| 78 | iso_pu_bacteria | 2599185182 | 2599465873 | 290 |
| 79 | iso_pu_bacteria | 2599185185 | 2599485123 | 290 |
| 80 | iso_pu_bacteria | 2599185186 | 2599488802 | 290 |
| 81 | iso_pu_bacteria | 2599185189 | 2599507376 | 290 |
| 82 | iso_pu_bacteria | 2599185190 | 2599512832 | 290 |
| 83 | iso_pu_bacteria | 2599185191 | 2599522138 | 290 |
| 84 | iso_pu_bacteria | 2599185257 | 2599802735 | 290 |
| 85 | iso_pu_bacteria | 2599185288 | 2599881332 | 290 |
| 86 | iso_pu_bacteria | 2599185290 | 2599891509 | 290 |
| 87 | iso_pu_bacteria | 2599185303 | 2599946648 | 290 |
| 88 | iso_pu_bacteria | 2599185307 | 2599970024 | 290 |
| 89 | iso_pu_bacteria | 2599185356 | 2600212388 | 290 |
| 90 | iso_pu_bacteria | 2600254931 | 2600363048 | 290 |
| 91 | iso_pu_bacteria | 2600255296 | 2601691872 | 290 |
| 92 | iso_pu_bacteria | 2600255313 | 2601772556 | 290 |
| 93 | iso_pu_bacteria | 2600255318 | 2601798974 | 290 |
| 94 | iso_pu_bacteria | 2603880185 | 2606077869 | 290 |
| 95 | iso_pu_bacteria | 2603880199 | 2606129956 | 290 |
| 96 | iso_pu_bacteria | 2619619299 | 2621299891 | 290 |
| 97 | iso_pu_bacteria | 2623620443 | 2624480905 | 290 |
| 98 | iso_pu_bacteria | 2623620446 | 2624492220 | 290 |
| 99 | iso_pu_bacteria | 2643221571 | 2643874215 | 290 |
| 100 | iso_pu_bacteria | 2643221633 | 2644189895 | 290 |
| 101 | iso_pu_bacteria | 2643221713 | 2644620201 | 290 |
| 102 | iso_pu_bacteria | 2667528171 | 2671095469 | 290 |
| 103 | iso_pu_bacteria | 2671180172 | 2671769644 | 290 |
| 104 | iso_pu_bacteria | 2675903420 | 2677896552 | 290 |
| 105 | iso_pu_bacteria | 2713897149 | 2715756958 | 290 |
| 106 | iso_pu_bacteria | 2721755607 | 2723248719 | 290 |
| 107 | iso_pu_bacteria | 2738541265 | 2738669888 | 290 |
| 108 | iso_pu_bacteria | 2738541282 | 2738748281 | 290 |
| 109 | iso_pu_bacteria | 2738541294 | 2738806849 | 290 |
| 110 | iso_pu_bacteria | 2738541303 | 2738857323 | 290 |
| 111 | iso_pu_bacteria | 2738541309 | 2738894209 | 290 |
| 112 | iso_pu_bacteria | 2738543004 | 2739197519 | 290 |
| 113 | iso_pu_bacteria | 2738543015 | 2739258764 | 290 |
| 114 | iso_pu_bacteria | 2738543025 | 2739311825 | 290 |
| 115 | iso_pu_bacteria | 2740892503 | 2743737585 | 290 |
| 116 | iso_pu_bacteria | 2765235841 | 2765584020 | 290 |
| 117 | iso_pu_bacteria | 2773857670 | 2774122518 | 290 |
| 118 | iso_pu_bacteria | 2773857673 | 2774133717 | 290 |
| 119 | iso_pu_bacteria | 2784132063 | 2784264522 | 290 |
| 120 | iso_pu_bacteria | 2784132072 | 2784314649 | 290 |
| 121 | iso_pu_bacteria | 2808606376 | 2808922455 | 290 |
| 122 | iso_pu_bacteria | 2808606377 | 2808929134 | 290 |
| 123 | iso_pu_bacteria | 2808606378 | 2808938126 | 290 |
| 124 | iso_pu_bacteria | 2808606380 | 2808948484 | 290 |
| 125 | iso_pu_bacteria | 2808606381 | 2808951255 | 290 |
| 126 | iso_pu_bacteria | 2808606382 | 2808958518 | 290 |
| 127 | iso_pu_bacteria | 2808606383 | 2808966378 | 290 |
| 128 | iso_pu_bacteria | 2808606385 | 2808979104 | 290 |
| 129 | iso_pu_bacteria | 2808606388 | 2808995013 | 290 |
| 130 | iso_pu_bacteria | 2808606389 | 2808996865 | 290 |
| 131 | iso_pu_bacteria | 2816332298 | 2817491184 | 290 |
| 132 | iso_pu_bacteria | 2818991456 | 2819658812 | 290 |
| 133 | iso_pu_bacteria | 2818991464 | 2819701054 | 290 |
| 134 | iso_pu_bacteria | 2834028612 | 2834034023 | 290 |
| 135 | iso_pu_bacteria | 2842826826 | 2842826940 | 290 |
| 136 | iso_pu_bacteria | 2842837860 | 2842839289 | 290 |
| 137 | iso_pu_bacteria | 2844665904 | 2844670644 | 290 |
| 138 | iso_pu_bacteria | 2852612431 | 2852614452 | 290 |
| 139 | iso_pu_bacteria | 2852657418 | 2852662060 | 290 |
| 140 | iso_pu_bacteria | 2852667396 | 2852667810 | 290 |
| 141 | iso_pu_bacteria | 2860339153 | 2860342758 | 290 |
| 142 | iso_pu_bacteria | 2860867994 | 2860870615 | 290 |
| 143 | iso_pu_bacteria | 2878029506 | 2878032837 | 290 |
| 144 | iso_pu_bacteria | 2880230671 | 2880233422 | 290 |
| 145 | iso_pu_bacteria | 2904518522 | 2904520216 | 290 |
| 146 | iso_pu_bacteria | 2904550169 | 2904552457 | 290 |
| 147 | iso_pu_bacteria | 2908446538 | 2908449744 | 290 |
| 148 | iso_pu_bacteria | 2917070673 | 2917073840 | 290 |
| 149 | iso_pu_bacteria | 2919063839 | 2919064868 | 290 |
| 150 | iso_pu_bacteria | 2919456309 | 2919460669 | 290 |
| 151 | iso_pu_bacteria | 2919697872 | 2919698406 | 290 |
| 152 | iso_pu_bacteria | 2929189879 | 2929192610 | 290 |
| 153 | iso_pu_bacteria | 2931390751 | 2931394004 | 290 |
| 154 | iso_pu_bacteria | 2931396565 | 2931401703 | 290 |
| 155 | iso_pu_bacteria | 2935353572 | 2935357105 | 290 |
| 156 | iso_pu_bacteria | 2945928738 | 2945933464 | 290 |
| 157 | iso_pu_bacteria | 2945961074 | 2945963428 | 290 |
| 158 | iso_pu_bacteria | 2946006987 | 2946009781 | 290 |
| 159 | iso_pu_bacteria | 2946027586 | 2946030936 | 290 |
| 160 | iso_pu_bacteria | 2947233263 | 2947237749 | 290 |
| 161 | iso_pu_bacteria | 2969304461 | 2969307618 | 290 |
| 162 | iso_pu_bacteria | 2988728565 | 2988728918 | 290 |
| 163 | iso_pu_bacteria | 3007395558 | 3007396009 | 290 |
| 164 | iso_pu_bacteria | 3007419365 | 3007422903 | 290 |
| 165 | iso_pu_bacteria | 3007511990 | 3007514402 | 290 |
| 166 | iso_pu_bacteria | 3007614139 | 3007619002 | 290 |
| 167 | iso_pu_bacteria | 3007619802 | 3007620164 | 290 |
| 168 | iso_pu_bacteria | 3007718800 | 3007719871 | 290 |
| 169 | iso_pu_bacteria | 637000220 | 637320385 | 290 |
| 170 | iso_pu_bacteria | 8002745576 | 8002747610 | 290 |
| 171 | iso_pu_bacteria | 8011350971 | 8011354767 | 290 |
| 172 | iso_pu_bacteria | 8019769354 | 8019773204 | 290 |
| 173 | iso_pu_bacteria | 8019775933 | 8019779165 | 290 |
| 174 | iso_pu_bacteria | 8054285046 | 8054286658 | 290 |
| 175 | iso_pu_bacteria | 8054347763 | 8054352277 | 290 |
| 176 | iso_pu_bacteria | 8054503363 | 8054506364 | 290 |
| 177 | iso_pu_bacteria | 8054929484 | 8054932687 | 290 |
| 178 | iso_pu_bacteria | 8055817908 | 8055821113 | 290 |
| 179 | iso_pu_bacteria | 8056131705 | 8056134796 | 290 |
| 180 | iso_pu_bacteria | 8056148874 | 8056154771 | 290 |
| 181 | iso_pu_bacteria | 8056161164 | 8056166068 | 290 |
| 182 | iso_pu_bacteria | 8056172158 | 8056174282 | 290 |
| 183 | iso_pu_bacteria | 8056569372 | 8056573859 | 290 |
| 184 | iso_pu_bacteria | 8057798959 | 8057800529 | 290 |
| 185 | 3300053098 | Ga0500650_0000050 | Ga0500650_0000050_22470_23390 | 291 |
| 186 | iso_pu_bacteria | 2606217733 | 2608381082 | 291 |
| 187 | iso_pu_bacteria | 2919493220 | 2919495018 | 291 |
| 188 | iso_pu_bacteria | 2919543075 | 2919545972 | 291 |
| 189 | 3300005331 | Ga0070670_100107652 | Ga0070670_1001076521 | 292 |
| 190 | 3300005335 | Ga0070666_10016235 | Ga0070666_100162356 | 292 |
| 191 | 3300005338 | Ga0068868_100001680 | Ga0068868_1000016806 | 292 |
| 192 | 3300005343 | Ga0070687_100016880 | Ga0070687_1000168802 | 292 |
| 193 | 3300005355 | Ga0070671_100001324 | Ga0070671_10000132415 | 292 |
| 194 | 3300005535 | Ga0070684_100078344 | Ga0070684_1000783442 | 292 |
| 195 | 3300005547 | Ga0070693_100100157 | Ga0070693_1001001572 | 292 |
| 196 | 3300005617 | Ga0068859_100015482 | Ga0068859_1000154825 | 292 |
| 197 | 3300005841 | Ga0068863_100004929 | Ga0068863_10000492910 | 292 |
| 198 | 3300005843 | Ga0068860_100290580 | Ga0068860_1002905802 | 292 |
| 199 | 3300006237 | Ga0097621_100034439 | Ga0097621_1000344393 | 292 |
| 200 | 3300006844 | Ga0075428_100056910 | Ga0075428_1000569104 | 292 |
| 201 | 3300006846 | Ga0075430_100013614 | Ga0075430_1000136142 | 292 |
| 202 | 3300006880 | Ga0075429_100262130 | Ga0075429_1002621302 | 292 |
| 203 | 3300006931 | Ga0097620_100015481 | Ga0097620_1000154815 | 292 |
| 204 | 3300009093 | Ga0105240_10142203 | Ga0105240_101422032 | 292 |
| 205 | 3300009094 | Ga0111539_10046032 | Ga0111539_100460322 | 292 |
| 206 | 3300009094 | Ga0111539_10474394 | Ga0111539_104743942 | 292 |
| 207 | 3300009098 | Ga0105245_10014982 | Ga0105245_100149823 | 292 |
| 208 | 3300009101 | Ga0105247_10001526 | Ga0105247_1000152615 | 292 |
| 209 | 3300010375 | Ga0105239_10022541 | Ga0105239_100225413 | 292 |
| 210 | 3300011119 | Ga0105246_10245719 | Ga0105246_102457192 | 292 |
| 211 | 3300013296 | Ga0157374_10031348 | Ga0157374_100313483 | 292 |
| 212 | 3300013306 | Ga0163162_10160225 | Ga0163162_101602252 | 292 |
| 213 | 3300014325 | Ga0163163_10003261 | Ga0163163_100032615 | 292 |
| 214 | 3300014968 | Ga0157379_10020541 | Ga0157379_100205412 | 292 |
| 215 | 3300025900 | Ga0207710_10014435 | Ga0207710_100144354 | 292 |
| 216 | 3300025903 | Ga0207680_10063301 | Ga0207680_100633012 | 292 |
| 217 | 3300025925 | Ga0207650_10228408 | Ga0207650_102284082 | 292 |
| 218 | 3300025926 | Ga0207659_10342895 | Ga0207659_103428952 | 292 |
| 219 | 3300025936 | Ga0207670_10107537 | Ga0207670_101075372 | 292 |
| 220 | 3300026035 | Ga0207703_10092538 | Ga0207703_100925383 | 292 |
| 221 | 3300026088 | Ga0207641_10027117 | Ga0207641_100271176 | 292 |
| 222 | 3300026095 | Ga0207676_10005759 | Ga0207676_1000575911 | 292 |
| 223 | 3300026121 | Ga0207683_10116531 | Ga0207683_101165313 | 292 |
| 224 | 3300027907 | Ga0207428_10129918 | Ga0207428_101299182 | 292 |
| 225 | 3300031691 | Ga0316579_10013422 | Ga0316579_100134223 | 292 |
| 226 | 3300031733 | Ga0316577_10050573 | Ga0316577_100505732 | 292 |
| 227 | 3300035242 | Ga0373962_0025273 | Ga0373962_0025273_564_1505 | 292 |
| 228 | 3300036647 | Ga0316582_0081291 | Ga0316582_0081291_1159_2076 | 292 |
| 229 | 3300046459 | Ga0495629_0007303 | Ga0495629_0007303_443_1339 | 292 |
| 230 | 3300046476 | Ga0495662_0093818 | Ga0495662_0093818_414_1310 | 292 |
| 231 | 3300046499 | Ga0495594_0002699 | Ga0495594_0002699_2610_3506 | 292 |
| 232 | 3300046533 | Ga0495640_0073221 | Ga0495640_0073221_512_1408 | 292 |
| 233 | 3300046663 | Ga0495635_0001311 | Ga0495635_0001311_7469_8365 | 292 |
| 234 | 3300046683 | Ga0495658_0001304 | Ga0495658_0001304_9754_10650 | 292 |
| 235 | 3300046683 | Ga0495658_0223789 | Ga0495658_0223789_118_1059 | 292 |
| 236 | 3300046689 | Ga0495613_0018880 | Ga0495613_0018880_984_1880 | 292 |
| 237 | 3300047315 | Ga0495581_0016010 | Ga0495581_0016010_3207_4103 | 292 |
| 238 | 3300047322 | Ga0495680_0000683 | Ga0495680_0000683_1516_2412 | 292 |
| 239 | 3300048911 | Ga0496108_0269866 | Ga0496108_0269866_489_1430 | 292 |
| 240 | 3300048912 | Ga0496109_0052306 | Ga0496109_0052306_2532_3473 | 292 |
| 241 | 3300048916 | Ga0496113_0275572 | Ga0496113_0275572_291_1232 | 292 |
| 242 | 3300050509 | nmdc:mga0qj67_14303_c1 | nmdc:mga0qj67_14303_c1_3522_4418 | 292 |
| 243 | 3300050511 | nmdc:mga08y16_36124_c1 | nmdc:mga08y16_36124_c1_1446_2342 | 292 |
| 244 | 3300050511 | nmdc:mga08y16_376161_c1 | nmdc:mga08y16_376161_c1_151_1047 | 292 |
| 245 | 3300053077 | Ga0495601_0072036 | Ga0495601_0072036_720_1661 | 292 |
| 246 | 3300053085 | Ga0495619_0055238 | Ga0495619_0055238_578_1474 | 292 |
| 247 | iso_pu_bacteria | 2643221589 | 2643956782 | 292 |
| 248 | iso_pu_bacteria | 2643221602 | 2644024705 | 292 |
| 249 | iso_pu_bacteria | 2923153595 | 2923156627 | 292 |
| 250 | iso_pu_bacteria | 2984286254 | 2984289454 | 292 |
| 251 | iso_pu_bacteria | 8015687852 | 8015690814 | 292 |
| 252 | iso_pu_bacteria | 8055770955 | 8055773954 | 292 |
| 253 | 3300005290 | Ga0065712_10000124 | Ga0065712_1000012454 | 293 |
| 254 | 3300009036 | Ga0105244_10000277 | Ga0105244_1000027738 | 293 |
| 255 | 3300009148 | Ga0105243_10230220 | Ga0105243_102302202 | 293 |
| 256 | 3300025728 | Ga0207655_1003616 | Ga0207655_10036163 | 293 |
| 257 | 3300036647 | Ga0316582_0047164 | Ga0316582_0047164_905_1819 | 293 |
| 258 | 3300046538 | Ga0495609_0024039 | Ga0495609_0024039_1812_2693 | 293 |
| 259 | 3300048927 | Ga0496124_0000212 | Ga0496124_0000212_56895_57776 | 293 |
| 260 | 3300048927 | Ga0496124_0128345 | Ga0496124_0128345_1087_1968 | 293 |
| 261 | 3300049571 | Ga0501034_0281838 | Ga0501034_0281838_253_1134 | 293 |
| 262 | iso_pu_bacteria | 2510065053 | 2510282571 | 293 |
| 263 | iso_pu_bacteria | 2510065055 | 2510294555 | 293 |
| 264 | iso_pu_bacteria | 2510065058 | 2510311149 | 293 |
| 265 | iso_pu_bacteria | 2773857672 | 2774129385 | 293 |
| 266 | iso_pu_bacteria | 2917832318 | 2917836668 | 293 |
| 267 | iso_pu_bacteria | 2919125081 | 2919126287 | 293 |
| 268 | iso_pu_bacteria | 2974298342 | 2974302209 | 293 |
| 269 | iso_pu_bacteria | 2984499530 | 2984500220 | 293 |
| 270 | iso_pu_bacteria | 2984504281 | 2984506687 | 293 |
| 271 | iso_pu_bacteria | 8016728285 | 8016731282 | 293 |
| 272 | 2124908027 | MRS2a_Contig_19 | MRS2a_00089420 | 294 |
| 273 | 2124908027 | MRS2a_Contig_7067 | MRS2a_00529750 | 294 |
| 274 | 3300002737 | JGI25162J39368_1000004 | JGI25162J39368_100000485 | 294 |
| 275 | 3300002737 | JGI25162J39368_1000065 | JGI25162J39368_100006555 | 294 |
| 276 | 3300002738 | JGI25154J39366_1003271 | JGI25154J39366_10032712 | 294 |
| 277 | 3300002771 | JGI25163J39215_1001383 | JGI25163J39215_10013835 | 294 |
| 278 | 3300002771 | JGI25163J39215_1001387 | JGI25163J39215_10013875 | 294 |
| 279 | 3300002772 | JGI25164J39214_1000031 | JGI25164J39214_100003186 | 294 |
| 280 | 3300002772 | JGI25164J39214_1000038 | JGI25164J39214_100003875 | 294 |
| 281 | 3300003214 | JGI25165J46597_1000011 | JGI25165J46597_100001185 | 294 |
| 282 | 3300003214 | JGI25165J46597_1000126 | JGI25165J46597_100012675 | 294 |
| 283 | 3300003751 | Ga0055538_1000007 | Ga0055538_1000007156 | 294 |
| 284 | 3300003752 | Ga0055539_1000011 | Ga0055539_1000011156 | 294 |
| 285 | 3300003756 | Ga0055533_1000014 | Ga0055533_1000014156 | 294 |
| 286 | 3300003758 | Ga0055532_1000009 | Ga0055532_1000009156 | 294 |
| 287 | 3300003759 | Ga0055525_1000016 | Ga0055525_1000016156 | 294 |
| 288 | 3300003781 | Ga0055536_1000025 | Ga0055536_1000025136 | 294 |
| 289 | 3300003781 | Ga0055536_1000053 | Ga0055536_100005382 | 294 |
| 290 | 3300003791 | Ga0055530_10000007 | Ga0055530_10000007136 | 294 |
| 291 | 3300003791 | Ga0055530_10000011 | Ga0055530_1000001188 | 294 |
| 292 | 3300003791 | Ga0055530_10000219 | Ga0055530_1000021928 | 294 |
| 293 | 3300003792 | Ga0055540_1000006 | Ga0055540_100000621 | 294 |
| 294 | 3300003792 | Ga0055540_1000034 | Ga0055540_100003488 | 294 |
| 295 | 3300003792 | Ga0055540_1000125 | Ga0055540_100012523 | 294 |
| 296 | 3300003794 | Ga0055531_10001653 | Ga0055531_100016539 | 294 |
| 297 | 3300003841 | Ga0055541_1000008 | Ga0055541_1000008156 | 294 |
| 298 | 3300005288 | Ga0065714_10000048 | Ga0065714_1000004812 | 294 |
| 299 | 3300005288 | Ga0065714_10002770 | Ga0065714_100027702 | 294 |
| 300 | 3300005288 | Ga0065714_10065674 | Ga0065714_100656745 | 294 |
| 301 | 3300005288 | Ga0065714_10069849 | Ga0065714_100698492 | 294 |
| 302 | 3300005288 | Ga0065714_10088799 | Ga0065714_100887991 | 294 |
| 303 | 3300005290 | Ga0065712_10000445 | Ga0065712_100004458 | 294 |
| 304 | 3300005293 | Ga0065715_10101172 | Ga0065715_101011722 | 294 |
| 305 | 3300005331 | Ga0070670_100000079 | Ga0070670_10000007961 | 294 |
| 306 | 3300005344 | Ga0070661_100000024 | Ga0070661_10000002463 | 294 |
| 307 | 3300005353 | Ga0070669_100001022 | Ga0070669_10000102217 | 294 |
| 308 | 3300005353 | Ga0070669_100180512 | Ga0070669_1001805122 | 294 |
| 309 | 3300005457 | Ga0070662_100090587 | Ga0070662_1000905872 | 294 |
| 310 | 3300005539 | Ga0068853_100039228 | Ga0068853_1000392284 | 294 |
| 311 | 3300005548 | Ga0070665_100039437 | Ga0070665_1000394374 | 294 |
| 312 | 3300005548 | Ga0070665_100269699 | Ga0070665_1002696992 | 294 |
| 313 | 3300005564 | Ga0070664_100000024 | Ga0070664_10000002457 | 294 |
| 314 | 3300005834 | Ga0068851_10000552 | Ga0068851_100005529 | 294 |
| 315 | 3300006051 | Ga0075364_10009199 | Ga0075364_100091996 | 294 |
| 316 | 3300006058 | Ga0075432_10000898 | Ga0075432_100008983 | 294 |
| 317 | 3300006058 | Ga0075432_10002446 | Ga0075432_100024462 | 294 |
| 318 | 3300006058 | Ga0075432_10005364 | Ga0075432_100053645 | 294 |
| 319 | 3300006177 | Ga0075362_10005910 | Ga0075362_100059102 | 294 |
| 320 | 3300006186 | Ga0075369_10041465 | Ga0075369_100414652 | 294 |
| 321 | 3300006914 | Ga0075436_100087080 | Ga0075436_1000870802 | 294 |
| 322 | 3300006946 | Ga0079104_1000143 | Ga0079104_100014313 | 294 |
| 323 | 3300009011 | Ga0105251_10000001 | Ga0105251_10000001322 | 294 |
| 324 | 3300009011 | Ga0105251_10000571 | Ga0105251_1000057117 | 294 |
| 325 | 3300009011 | Ga0105251_10008065 | Ga0105251_100080652 | 294 |
| 326 | 3300009011 | Ga0105251_10016806 | Ga0105251_100168062 | 294 |
| 327 | 3300009011 | Ga0105251_10023304 | Ga0105251_100233042 | 294 |
| 328 | 3300009011 | Ga0105251_10030919 | Ga0105251_100309192 | 294 |
| 329 | 3300009011 | Ga0105251_10045232 | Ga0105251_100452321 | 294 |
| 330 | 3300009011 | Ga0105251_10076209 | Ga0105251_100762092 | 294 |
| 331 | 3300009036 | Ga0105244_10000325 | Ga0105244_1000032530 | 294 |
| 332 | 3300009036 | Ga0105244_10000907 | Ga0105244_1000090712 | 294 |
| 333 | 3300009036 | Ga0105244_10004021 | Ga0105244_100040213 | 294 |
| 334 | 3300009036 | Ga0105244_10005358 | Ga0105244_100053582 | 294 |
| 335 | 3300009036 | Ga0105244_10006752 | Ga0105244_100067526 | 294 |
| 336 | 3300009036 | Ga0105244_10008600 | Ga0105244_100086002 | 294 |
| 337 | 3300009036 | Ga0105244_10014311 | Ga0105244_100143115 | 294 |
| 338 | 3300009036 | Ga0105244_10021452 | Ga0105244_100214523 | 294 |
| 339 | 3300009036 | Ga0105244_10036305 | Ga0105244_100363052 | 294 |
| 340 | 3300009036 | Ga0105244_10072259 | Ga0105244_100722592 | 294 |
| 341 | 3300009036 | Ga0105244_10107362 | Ga0105244_101073621 | 294 |
| 342 | 3300009092 | Ga0105250_10000015 | Ga0105250_10000015196 | 294 |
| 343 | 3300009092 | Ga0105250_10000679 | Ga0105250_100006792 | 294 |
| 344 | 3300009092 | Ga0105250_10008485 | Ga0105250_100084855 | 294 |
| 345 | 3300009092 | Ga0105250_10020438 | Ga0105250_100204382 | 294 |
| 346 | 3300009148 | Ga0105243_10000020 | Ga0105243_10000020141 | 294 |
| 347 | 3300009148 | Ga0105243_10067859 | Ga0105243_100678592 | 294 |
| 348 | 3300009176 | Ga0105242_10002506 | Ga0105242_100025063 | 294 |
| 349 | 3300009545 | Ga0105237_10000042 | Ga0105237_10000042118 | 294 |
| 350 | 3300011119 | Ga0105246_10000010 | Ga0105246_1000001013 | 294 |
| 351 | 3300011119 | Ga0105246_10000641 | Ga0105246_100006412 | 294 |
| 352 | 3300011119 | Ga0105246_10002448 | Ga0105246_100024487 | 294 |
| 353 | 3300012498 | Ga0157345_1000060 | Ga0157345_10000602 | 294 |
| 354 | 3300012498 | Ga0157345_1001954 | Ga0157345_10019542 | 294 |
| 355 | 3300013100 | Ga0157373_10001425 | Ga0157373_100014252 | 294 |
| 356 | 3300013100 | Ga0157373_10003868 | Ga0157373_100038686 | 294 |
| 357 | 3300013100 | Ga0157373_10029199 | Ga0157373_100291994 | 294 |
| 358 | 3300013102 | Ga0157371_10000635 | Ga0157371_100006359 | 294 |
| 359 | 3300013102 | Ga0157371_10022147 | Ga0157371_100221472 | 294 |
| 360 | 3300013102 | Ga0157371_10221470 | Ga0157371_102214702 | 294 |
| 361 | 3300013104 | Ga0157370_10002554 | Ga0157370_1000255415 | 294 |
| 362 | 3300013104 | Ga0157370_10016221 | Ga0157370_100162214 | 294 |
| 363 | 3300013104 | Ga0157370_10332993 | Ga0157370_103329932 | 294 |
| 364 | 3300013105 | Ga0157369_10001667 | Ga0157369_100016672 | 294 |
| 365 | 3300013105 | Ga0157369_10004855 | Ga0157369_100048555 | 294 |
| 366 | 3300013105 | Ga0157369_10019056 | Ga0157369_100190568 | 294 |
| 367 | 3300013306 | Ga0163162_10000169 | Ga0163162_1000016918 | 294 |
| 368 | 3300013306 | Ga0163162_10015519 | Ga0163162_100155195 | 294 |
| 369 | 3300013306 | Ga0163162_10149019 | Ga0163162_101490192 | 294 |
| 370 | 3300013306 | Ga0163162_10477404 | Ga0163162_104774042 | 294 |
| 371 | 3300013306 | Ga0163162_10590966 | Ga0163162_105909662 | 294 |
| 372 | 3300013307 | Ga0157372_10004428 | Ga0157372_100044284 | 294 |
| 373 | 3300013308 | Ga0157375_10001060 | Ga0157375_1000106021 | 294 |
| 374 | 3300013308 | Ga0157375_10083123 | Ga0157375_100831232 | 294 |
| 375 | 3300013308 | Ga0157375_10226048 | Ga0157375_102260482 | 294 |
| 376 | 3300014497 | Ga0182008_10001212 | Ga0182008_100012122 | 294 |
| 377 | 3300014497 | Ga0182008_10002733 | Ga0182008_1000273311 | 294 |
| 378 | 3300014497 | Ga0182008_10003513 | Ga0182008_100035132 | 294 |
| 379 | 3300014497 | Ga0182008_10014394 | Ga0182008_100143945 | 294 |
| 380 | 3300015261 | Ga0182006_1000165 | Ga0182006_100016558 | 294 |
| 381 | 3300015261 | Ga0182006_1000387 | Ga0182006_100038710 | 294 |
| 382 | 3300015261 | Ga0182006_1007913 | Ga0182006_10079135 | 294 |
| 383 | 3300015261 | Ga0182006_1025370 | Ga0182006_10253702 | 294 |
| 384 | 3300015262 | Ga0182007_10000108 | Ga0182007_1000010839 | 294 |
| 385 | 3300015262 | Ga0182007_10009387 | Ga0182007_100093874 | 294 |
| 386 | 3300015265 | Ga0182005_1000470 | Ga0182005_100047012 | 294 |
| 387 | 3300015265 | Ga0182005_1003132 | Ga0182005_10031324 | 294 |
| 388 | 3300015265 | Ga0182005_1005478 | Ga0182005_10054782 | 294 |
| 389 | 3300015265 | Ga0182005_1013514 | Ga0182005_10135142 | 294 |
| 390 | 3300015265 | Ga0182005_1038670 | Ga0182005_10386702 | 294 |
| 391 | 3300017792 | Ga0163161_10001803 | Ga0163161_1000180310 | 294 |
| 392 | 3300017792 | Ga0163161_10003345 | Ga0163161_100033454 | 294 |
| 393 | 3300017792 | Ga0163161_10003497 | Ga0163161_100034978 | 294 |
| 394 | 3300017792 | Ga0163161_10009162 | Ga0163161_100091622 | 294 |
| 395 | 3300017792 | Ga0163161_10023843 | Ga0163161_100238432 | 294 |
| 396 | 3300017792 | Ga0163161_10029906 | Ga0163161_100299062 | 294 |
| 397 | 3300025206 | Ga0209435_100687 | Ga0209435_1006875 | 294 |
| 398 | 3300025207 | Ga0209760_100032 | Ga0209760_10003251 | 294 |
| 399 | 3300025207 | Ga0209760_100036 | Ga0209760_10003671 | 294 |
| 400 | 3300025224 | Ga0209784_100023 | Ga0209784_100023154 | 294 |
| 401 | 3300025225 | Ga0209566_100019 | Ga0209566_100019167 | 294 |
| 402 | 3300025226 | Ga0209674_100034 | Ga0209674_100034167 | 294 |
| 403 | 3300025229 | Ga0209147_100027 | Ga0209147_100027169 | 294 |
| 404 | 3300025230 | Ga0209563_100037 | Ga0209563_100037167 | 294 |
| 405 | 3300025230 | Ga0209563_100298 | Ga0209563_10029812 | 294 |
| 406 | 3300025231 | Ga0207427_100003 | Ga0207427_10000385 | 294 |
| 407 | 3300025231 | Ga0207427_100004 | Ga0207427_10000493 | 294 |
| 408 | 3300025233 | Ga0209437_100002 | Ga0209437_100002928 | 294 |
| 409 | 3300025233 | Ga0209437_100025 | Ga0209437_100025390 | 294 |
| 410 | 3300025246 | Ga0209646_1000318 | Ga0209646_100031824 | 294 |
| 411 | 3300025253 | Ga0209677_100021 | Ga0209677_100021167 | 294 |
| 412 | 3300025261 | Ga0209233_1000004 | Ga0209233_1000004497 | 294 |
| 413 | 3300025261 | Ga0209233_1000145 | Ga0209233_100014593 | 294 |
| 414 | 3300025291 | Ga0209675_1011697 | Ga0209675_10116972 | 294 |
| 415 | 3300025292 | Ga0209676_1000002 | Ga0209676_1000002985 | 294 |
| 416 | 3300025292 | Ga0209676_1000003 | Ga0209676_1000003675 | 294 |
| 417 | 3300025292 | Ga0209676_1002106 | Ga0209676_10021067 | 294 |
| 418 | 3300025292 | Ga0209676_1011728 | Ga0209676_10117282 | 294 |
| 419 | 3300025298 | Ga0209050_1000004 | Ga0209050_1000004657 | 294 |
| 420 | 3300025298 | Ga0209050_1000006 | Ga0209050_1000006585 | 294 |
| 421 | 3300025298 | Ga0209050_1000013 | Ga0209050_1000013304 | 294 |
| 422 | 3300025298 | Ga0209050_1000763 | Ga0209050_10007636 | 294 |
| 423 | 3300025303 | Ga0209051_1000001 | Ga0209051_1000001985 | 294 |
| 424 | 3300025303 | Ga0209051_1000006 | Ga0209051_1000006318 | 294 |
| 425 | 3300025303 | Ga0209051_1000007 | Ga0209051_1000007304 | 294 |
| 426 | 3300025304 | Ga0209257_1000029 | Ga0209257_1000029585 | 294 |
| 427 | 3300025304 | Ga0209257_1009178 | Ga0209257_10091782 | 294 |
| 428 | 3300025321 | Ga0207656_10005289 | Ga0207656_100052892 | 294 |
| 429 | 3300025711 | Ga0207696_1000002 | Ga0207696_1000002921 | 294 |
| 430 | 3300025711 | Ga0207696_1000017 | Ga0207696_1000017157 | 294 |
| 431 | 3300025728 | Ga0207655_1000006 | Ga0207655_100000696 | 294 |
| 432 | 3300025728 | Ga0207655_1000074 | Ga0207655_100007433 | 294 |
| 433 | 3300025728 | Ga0207655_1000098 | Ga0207655_10000989 | 294 |
| 434 | 3300025728 | Ga0207655_1000410 | Ga0207655_100041030 | 294 |
| 435 | 3300025728 | Ga0207655_1001712 | Ga0207655_10017123 | 294 |
| 436 | 3300025728 | Ga0207655_1002318 | Ga0207655_10023186 | 294 |
| 437 | 3300025728 | Ga0207655_1002796 | Ga0207655_10027965 | 294 |
| 438 | 3300025728 | Ga0207655_1004728 | Ga0207655_10047289 | 294 |
| 439 | 3300025728 | Ga0207655_1006032 | Ga0207655_10060326 | 294 |
| 440 | 3300025728 | Ga0207655_1008809 | Ga0207655_10088093 | 294 |
| 441 | 3300025728 | Ga0207655_1009171 | Ga0207655_10091713 | 294 |
| 442 | 3300025735 | Ga0207713_1000061 | Ga0207713_100006113 | 294 |
| 443 | 3300025735 | Ga0207713_1000284 | Ga0207713_100028448 | 294 |
| 444 | 3300025735 | Ga0207713_1000518 | Ga0207713_10005184 | 294 |
| 445 | 3300025735 | Ga0207713_1000929 | Ga0207713_100092922 | 294 |
| 446 | 3300025735 | Ga0207713_1001602 | Ga0207713_100160210 | 294 |
| 447 | 3300025735 | Ga0207713_1006155 | Ga0207713_10061552 | 294 |
| 448 | 3300025735 | Ga0207713_1008243 | Ga0207713_10082432 | 294 |
| 449 | 3300025735 | Ga0207713_1014599 | Ga0207713_10145992 | 294 |
| 450 | 3300025735 | Ga0207713_1031048 | Ga0207713_10310482 | 294 |
| 451 | 3300025735 | Ga0207713_1051401 | Ga0207713_10514012 | 294 |
| 452 | 3300025735 | Ga0207713_1087496 | Ga0207713_10874961 | 294 |
| 453 | 3300025914 | Ga0207671_10000474 | Ga0207671_1000047438 | 294 |
| 454 | 3300025920 | Ga0207649_10000010 | Ga0207649_10000010221 | 294 |
| 455 | 3300025923 | Ga0207681_10003542 | Ga0207681_100035427 | 294 |
| 456 | 3300025923 | Ga0207681_10103883 | Ga0207681_101038832 | 294 |
| 457 | 3300025925 | Ga0207650_10000690 | Ga0207650_100006909 | 294 |
| 458 | 3300025933 | Ga0207706_10002181 | Ga0207706_1000218114 | 294 |
| 459 | 3300025934 | Ga0207686_10008489 | Ga0207686_100084893 | 294 |
| 460 | 3300025935 | Ga0207709_10000004 | Ga0207709_10000004506 | 294 |
| 461 | 3300025935 | Ga0207709_10004919 | Ga0207709_100049192 | 294 |
| 462 | 3300025935 | Ga0207709_10079342 | Ga0207709_100793422 | 294 |
| 463 | 3300025945 | Ga0207679_10000022 | Ga0207679_10000022137 | 294 |
| 464 | 3300026041 | Ga0207639_10076491 | Ga0207639_100764912 | 294 |
| 465 | 3300027111 | Ga0209281_1000063 | Ga0209281_1000063228 | 294 |
| 466 | 3300028379 | Ga0268266_10028275 | Ga0268266_100282753 | 294 |
| 467 | 3300028379 | Ga0268266_10174792 | Ga0268266_101747922 | 294 |
| 468 | 3300030521 | Ga0307511_10053051 | Ga0307511_100530512 | 294 |
| 469 | 3300031548 | Ga0307408_100003398 | Ga0307408_1000033985 | 294 |
| 470 | 3300031731 | Ga0307405_10018233 | Ga0307405_100182335 | 294 |
| 471 | 3300033180 | Ga0307510_10003671 | Ga0307510_100036712 | 294 |
| 472 | 3300033180 | Ga0307510_10098723 | Ga0307510_100987232 | 294 |
| 473 | 3300041407 | Ga0439447_001977 | Ga0439447_001977_6107_6991 | 294 |
| 474 | 3300042006 | Ga0439432_000085 | Ga0439432_000085_27675_28559 | 294 |
| 475 | 3300042016 | Ga0439463_000996 | Ga0439463_000996_2358_3242 | 294 |
| 476 | 3300046452 | Ga0495617_000148 | Ga0495617_000148_35179_36063 | 294 |
| 477 | 3300046452 | Ga0495617_001573 | Ga0495617_001573_7859_8743 | 294 |
| 478 | 3300046452 | Ga0495617_011304 | Ga0495617_011304_825_1709 | 294 |
| 479 | 3300046453 | Ga0495627_000031 | Ga0495627_000031_16356_17240 | 294 |
| 480 | 3300046453 | Ga0495627_013920 | Ga0495627_013920_1601_2485 | 294 |
| 481 | 3300046453 | Ga0495627_014731 | Ga0495627_014731_1510_2394 | 294 |
| 482 | 3300046453 | Ga0495627_027534 | Ga0495627_027534_849_1733 | 294 |
| 483 | 3300046453 | Ga0495627_046447 | Ga0495627_046447_78_962 | 294 |
| 484 | 3300046455 | Ga0495603_0003135 | Ga0495603_0003135_7739_8623 | 294 |
| 485 | 3300046455 | Ga0495603_0020988 | Ga0495603_0020988_783_1667 | 294 |
| 486 | 3300046455 | Ga0495603_0063316 | Ga0495603_0063316_104_988 | 294 |
| 487 | 3300046455 | Ga0495603_0218698 | Ga0495603_0218698_42_926 | 294 |
| 488 | 3300046455 | Ga0495603_0282140 | Ga0495603_0282140_29_913 | 294 |
| 489 | 3300046457 | Ga0495590_0000177 | Ga0495590_0000177_21303_22187 | 294 |
| 490 | 3300046457 | Ga0495590_0001583 | Ga0495590_0001583_3555_4439 | 294 |
| 491 | 3300046458 | Ga0495591_000053 | Ga0495591_000053_43060_43944 | 294 |
| 492 | 3300046458 | Ga0495591_000172 | Ga0495591_000172_22685_23569 | 294 |
| 493 | 3300046458 | Ga0495591_000465 | Ga0495591_000465_3271_4155 | 294 |
| 494 | 3300046458 | Ga0495591_000873 | Ga0495591_000873_6282_7166 | 294 |
| 495 | 3300046458 | Ga0495591_000957 | Ga0495591_000957_15595_16479 | 294 |
| 496 | 3300046458 | Ga0495591_005313 | Ga0495591_005313_2893_3777 | 294 |
| 497 | 3300046458 | Ga0495591_024863 | Ga0495591_024863_405_1289 | 294 |
| 498 | 3300046458 | Ga0495591_031032 | Ga0495591_031032_185_1069 | 294 |
| 499 | 3300046460 | Ga0495638_0001323 | Ga0495638_0001323_12271_13155 | 294 |
| 500 | 3300046460 | Ga0495638_0021055 | Ga0495638_0021055_2411_3295 | 294 |
| 501 | 3300046460 | Ga0495638_0171078 | Ga0495638_0171078_161_1045 | 294 |
| 502 | 3300046463 | Ga0495653_0000652 | Ga0495653_0000652_10726_11610 | 294 |
| 503 | 3300046463 | Ga0495653_0004505 | Ga0495653_0004505_9967_10851 | 294 |
| 504 | 3300046463 | Ga0495653_0079334 | Ga0495653_0079334_732_1616 | 294 |
| 505 | 3300046471 | Ga0495650_0003897 | Ga0495650_0003897_376_1260 | 294 |
| 506 | 3300046471 | Ga0495650_0004145 | Ga0495650_0004145_5062_5946 | 294 |
| 507 | 3300046471 | Ga0495650_0004343 | Ga0495650_0004343_309_1193 | 294 |
| 508 | 3300046471 | Ga0495650_0015582 | Ga0495650_0015582_35_919 | 294 |
| 509 | 3300046473 | Ga0495582_0002904 | Ga0495582_0002904_5964_6848 | 294 |
| 510 | 3300046474 | Ga0495605_0000007 | Ga0495605_0000007_342719_343603 | 294 |
| 511 | 3300046474 | Ga0495605_0000054 | Ga0495605_0000054_96347_97231 | 294 |
| 512 | 3300046474 | Ga0495605_0000778 | Ga0495605_0000778_2945_3829 | 294 |
| 513 | 3300046474 | Ga0495605_0000840 | Ga0495605_0000840_5259_6143 | 294 |
| 514 | 3300046474 | Ga0495605_0003164 | Ga0495605_0003164_1510_2394 | 294 |
| 515 | 3300046474 | Ga0495605_0010382 | Ga0495605_0010382_339_1223 | 294 |
| 516 | 3300046474 | Ga0495605_0016891 | Ga0495605_0016891_445_1329 | 294 |
| 517 | 3300046474 | Ga0495605_0044400 | Ga0495605_0044400_443_1330 | 294 |
| 518 | 3300046475 | Ga0495639_0000053 | Ga0495639_0000053_40433_41317 | 294 |
| 519 | 3300046491 | Ga0495584_0000120 | Ga0495584_0000120_7224_8108 | 294 |
| 520 | 3300046491 | Ga0495584_0000715 | Ga0495584_0000715_15335_16219 | 294 |
| 521 | 3300046491 | Ga0495584_0002413 | Ga0495584_0002413_4666_5550 | 294 |
| 522 | 3300046491 | Ga0495584_0002856 | Ga0495584_0002856_8723_9607 | 294 |
| 523 | 3300046491 | Ga0495584_0008390 | Ga0495584_0008390_165_1049 | 294 |
| 524 | 3300046491 | Ga0495584_0029168 | Ga0495584_0029168_1492_2376 | 294 |
| 525 | 3300046491 | Ga0495584_0150225 | Ga0495584_0150225_282_1166 | 294 |
| 526 | 3300046491 | Ga0495584_0193025 | Ga0495584_0193025_57_941 | 294 |
| 527 | 3300046492 | Ga0495585_0010605 | Ga0495585_0010605_559_1443 | 294 |
| 528 | 3300046492 | Ga0495585_0026976 | Ga0495585_0026976_1199_2083 | 294 |
| 529 | 3300046492 | Ga0495585_0027811 | Ga0495585_0027811_1564_2448 | 294 |
| 530 | 3300046499 | Ga0495594_0008625 | Ga0495594_0008625_1921_2805 | 294 |
| 531 | 3300046499 | Ga0495594_0020880 | Ga0495594_0020880_188_1072 | 294 |
| 532 | 3300046499 | Ga0495594_0170138 | Ga0495594_0170138_28_912 | 294 |
| 533 | 3300046500 | Ga0495596_0014418 | Ga0495596_0014418_1229_2113 | 294 |
| 534 | 3300046500 | Ga0495596_0022930 | Ga0495596_0022930_1511_2395 | 294 |
| 535 | 3300046501 | Ga0495607_0000036 | Ga0495607_0000036_61758_62642 | 294 |
| 536 | 3300046501 | Ga0495607_0000041 | Ga0495607_0000041_119538_120422 | 294 |
| 537 | 3300046501 | Ga0495607_0003777 | Ga0495607_0003777_8292_9176 | 294 |
| 538 | 3300046501 | Ga0495607_0004345 | Ga0495607_0004345_941_1825 | 294 |
| 539 | 3300046501 | Ga0495607_0006048 | Ga0495607_0006048_7238_8122 | 294 |
| 540 | 3300046501 | Ga0495607_0006235 | Ga0495607_0006235_4134_5018 | 294 |
| 541 | 3300046501 | Ga0495607_0007191 | Ga0495607_0007191_242_1126 | 294 |
| 542 | 3300046501 | Ga0495607_0015516 | Ga0495607_0015516_2751_3635 | 294 |
| 543 | 3300046501 | Ga0495607_0019764 | Ga0495607_0019764_340_1224 | 294 |
| 544 | 3300046501 | Ga0495607_0040366 | Ga0495607_0040366_1428_2312 | 294 |
| 545 | 3300046501 | Ga0495607_0107225 | Ga0495607_0107225_590_1474 | 294 |
| 546 | 3300046501 | Ga0495607_0111142 | Ga0495607_0111142_95_979 | 294 |
| 547 | 3300046506 | Ga0495583_0000007 | Ga0495583_0000007_301186_302070 | 294 |
| 548 | 3300046506 | Ga0495583_0000865 | Ga0495583_0000865_114_998 | 294 |
| 549 | 3300046506 | Ga0495583_0001830 | Ga0495583_0001830_7103_7987 | 294 |
| 550 | 3300046506 | Ga0495583_0005112 | Ga0495583_0005112_3097_3981 | 294 |
| 551 | 3300046507 | Ga0495606_0000079 | Ga0495606_0000079_85126_86010 | 294 |
| 552 | 3300046507 | Ga0495606_0000473 | Ga0495606_0000473_58199_59083 | 294 |
| 553 | 3300046507 | Ga0495606_0001688 | Ga0495606_0001688_12591_13475 | 294 |
| 554 | 3300046507 | Ga0495606_0016943 | Ga0495606_0016943_4033_4917 | 294 |
| 555 | 3300046507 | Ga0495606_0026227 | Ga0495606_0026227_3106_3993 | 294 |
| 556 | 3300046507 | Ga0495606_0076632 | Ga0495606_0076632_1153_2037 | 294 |
| 557 | 3300046507 | Ga0495606_0148379 | Ga0495606_0148379_349_1233 | 294 |
| 558 | 3300046512 | Ga0495610_0000455 | Ga0495610_0000455_28396_29280 | 294 |
| 559 | 3300046512 | Ga0495610_0005425 | Ga0495610_0005425_1775_2659 | 294 |
| 560 | 3300046512 | Ga0495610_0007848 | Ga0495610_0007848_686_1570 | 294 |
| 561 | 3300046512 | Ga0495610_0023899 | Ga0495610_0023899_2216_3100 | 294 |
| 562 | 3300046512 | Ga0495610_0027121 | Ga0495610_0027121_1195_2079 | 294 |
| 563 | 3300046512 | Ga0495610_0036057 | Ga0495610_0036057_189_1073 | 294 |
| 564 | 3300046512 | Ga0495610_0062649 | Ga0495610_0062649_785_1669 | 294 |
| 565 | 3300046512 | Ga0495610_0063665 | Ga0495610_0063665_493_1377 | 294 |
| 566 | 3300046513 | Ga0495616_0000535 | Ga0495616_0000535_19580_20464 | 294 |
| 567 | 3300046513 | Ga0495616_0000626 | Ga0495616_0000626_12015_12899 | 294 |
| 568 | 3300046513 | Ga0495616_0000695 | Ga0495616_0000695_19803_20687 | 294 |
| 569 | 3300046513 | Ga0495616_0001570 | Ga0495616_0001570_2718_3602 | 294 |
| 570 | 3300046513 | Ga0495616_0008679 | Ga0495616_0008679_3683_4567 | 294 |
| 571 | 3300046513 | Ga0495616_0011630 | Ga0495616_0011630_867_1751 | 294 |
| 572 | 3300046513 | Ga0495616_0019605 | Ga0495616_0019605_694_1578 | 294 |
| 573 | 3300046513 | Ga0495616_0063770 | Ga0495616_0063770_417_1301 | 294 |
| 574 | 3300046515 | Ga0495620_0000014 | Ga0495620_0000014_135989_136873 | 294 |
| 575 | 3300046515 | Ga0495620_0000152 | Ga0495620_0000152_751_1635 | 294 |
| 576 | 3300046515 | Ga0495620_0001722 | Ga0495620_0001722_7418_8302 | 294 |
| 577 | 3300046515 | Ga0495620_0004792 | Ga0495620_0004792_238_1122 | 294 |
| 578 | 3300046515 | Ga0495620_0011843 | Ga0495620_0011843_576_1460 | 294 |
| 579 | 3300046515 | Ga0495620_0058903 | Ga0495620_0058903_579_1463 | 294 |
| 580 | 3300046517 | Ga0495630_0009776 | Ga0495630_0009776_2965_3849 | 294 |
| 581 | 3300046517 | Ga0495630_0016625 | Ga0495630_0016625_3788_4672 | 294 |
| 582 | 3300046517 | Ga0495630_0019132 | Ga0495630_0019132_811_1695 | 294 |
| 583 | 3300046518 | Ga0495631_0000175 | Ga0495631_0000175_33960_34850 | 294 |
| 584 | 3300046518 | Ga0495631_0000526 | Ga0495631_0000526_3563_4447 | 294 |
| 585 | 3300046518 | Ga0495631_0005621 | Ga0495631_0005621_2581_3465 | 294 |
| 586 | 3300046518 | Ga0495631_0009829 | Ga0495631_0009829_3080_3964 | 294 |
| 587 | 3300046519 | Ga0495632_0000361 | Ga0495632_0000361_3040_3924 | 294 |
| 588 | 3300046519 | Ga0495632_0003232 | Ga0495632_0003232_3075_3959 | 294 |
| 589 | 3300046519 | Ga0495632_0005275 | Ga0495632_0005275_6814_7698 | 294 |
| 590 | 3300046519 | Ga0495632_0008562 | Ga0495632_0008562_3646_4530 | 294 |
| 591 | 3300046519 | Ga0495632_0010316 | Ga0495632_0010316_4288_5172 | 294 |
| 592 | 3300046519 | Ga0495632_0074200 | Ga0495632_0074200_126_1010 | 294 |
| 593 | 3300046519 | Ga0495632_0108940 | Ga0495632_0108940_222_1106 | 294 |
| 594 | 3300046520 | Ga0495637_0000606 | Ga0495637_0000606_12689_13573 | 294 |
| 595 | 3300046520 | Ga0495637_0000950 | Ga0495637_0000950_8326_9210 | 294 |
| 596 | 3300046520 | Ga0495637_0001129 | Ga0495637_0001129_6652_7536 | 294 |
| 597 | 3300046520 | Ga0495637_0001455 | Ga0495637_0001455_3064_3948 | 294 |
| 598 | 3300046520 | Ga0495637_0011047 | Ga0495637_0011047_345_1229 | 294 |
| 599 | 3300046520 | Ga0495637_0023176 | Ga0495637_0023176_210_1094 | 294 |
| 600 | 3300046520 | Ga0495637_0048733 | Ga0495637_0048733_871_1755 | 294 |
| 601 | 3300046522 | Ga0495643_0061324 | Ga0495643_0061324_763_1647 | 294 |
| 602 | 3300046523 | Ga0495644_0002949 | Ga0495644_0002949_1211_2095 | 294 |
| 603 | 3300046524 | Ga0495648_0000062 | Ga0495648_0000062_41903_42787 | 294 |
| 604 | 3300046524 | Ga0495648_0002500 | Ga0495648_0002500_15949_16833 | 294 |
| 605 | 3300046524 | Ga0495648_0002645 | Ga0495648_0002645_2140_3024 | 294 |
| 606 | 3300046524 | Ga0495648_0013756 | Ga0495648_0013756_5051_5935 | 294 |
| 607 | 3300046524 | Ga0495648_0017504 | Ga0495648_0017504_4090_4974 | 294 |
| 608 | 3300046524 | Ga0495648_0025045 | Ga0495648_0025045_2321_3205 | 294 |
| 609 | 3300046524 | Ga0495648_0030439 | Ga0495648_0030439_1015_1899 | 294 |
| 610 | 3300046524 | Ga0495648_0087622 | Ga0495648_0087622_309_1193 | 294 |
| 611 | 3300046524 | Ga0495648_0201893 | Ga0495648_0201893_30_914 | 294 |
| 612 | 3300046526 | Ga0495666_0000908 | Ga0495666_0000908_1098_1982 | 294 |
| 613 | 3300046526 | Ga0495666_0001595 | Ga0495666_0001595_4117_5001 | 294 |
| 614 | 3300046528 | Ga0495642_0000006 | Ga0495642_0000006_30060_30944 | 294 |
| 615 | 3300046528 | Ga0495642_0000044 | Ga0495642_0000044_65083_65967 | 294 |
| 616 | 3300046528 | Ga0495642_0001263 | Ga0495642_0001263_3473_4357 | 294 |
| 617 | 3300046530 | Ga0495654_0000113 | Ga0495654_0000113_90876_91760 | 294 |
| 618 | 3300046530 | Ga0495654_0000600 | Ga0495654_0000600_20080_20964 | 294 |
| 619 | 3300046530 | Ga0495654_0000688 | Ga0495654_0000688_13881_14765 | 294 |
| 620 | 3300046530 | Ga0495654_0001563 | Ga0495654_0001563_9789_10673 | 294 |
| 621 | 3300046530 | Ga0495654_0011138 | Ga0495654_0011138_802_1686 | 294 |
| 622 | 3300046530 | Ga0495654_0013073 | Ga0495654_0013073_407_1291 | 294 |
| 623 | 3300046530 | Ga0495654_0039041 | Ga0495654_0039041_742_1626 | 294 |
| 624 | 3300046530 | Ga0495654_0045145 | Ga0495654_0045145_1220_2104 | 294 |
| 625 | 3300046530 | Ga0495654_0113151 | Ga0495654_0113151_82_966 | 294 |
| 626 | 3300046536 | Ga0495587_0003803 | Ga0495587_0003803_2201_3085 | 294 |
| 627 | 3300046538 | Ga0495609_0000004 | Ga0495609_0000004_344946_345830 | 294 |
| 628 | 3300046538 | Ga0495609_0000016 | Ga0495609_0000016_226286_227170 | 294 |
| 629 | 3300046538 | Ga0495609_0001070 | Ga0495609_0001070_3322_4206 | 294 |
| 630 | 3300046538 | Ga0495609_0001736 | Ga0495609_0001736_773_1657 | 294 |
| 631 | 3300046538 | Ga0495609_0001936 | Ga0495609_0001936_7323_8207 | 294 |
| 632 | 3300046538 | Ga0495609_0002104 | Ga0495609_0002104_10892_11776 | 294 |
| 633 | 3300046538 | Ga0495609_0085081 | Ga0495609_0085081_302_1186 | 294 |
| 634 | 3300046542 | Ga0495597_0000800 | Ga0495597_0000800_673_1557 | 294 |
| 635 | 3300046542 | Ga0495597_0004988 | Ga0495597_0004988_216_1106 | 294 |
| 636 | 3300046542 | Ga0495597_0016693 | Ga0495597_0016693_2392_3276 | 294 |
| 637 | 3300046557 | Ga0495622_0000414 | Ga0495622_0000414_7569_8453 | 294 |
| 638 | 3300046557 | Ga0495622_0003325 | Ga0495622_0003325_936_1820 | 294 |
| 639 | 3300046557 | Ga0495622_0012172 | Ga0495622_0012172_654_1538 | 294 |
| 640 | 3300046557 | Ga0495622_0017579 | Ga0495622_0017579_393_1277 | 294 |
| 641 | 3300046557 | Ga0495622_0066032 | Ga0495622_0066032_602_1486 | 294 |
| 642 | 3300046558 | Ga0495633_0000051 | Ga0495633_0000051_125451_126335 | 294 |
| 643 | 3300046558 | Ga0495633_0003219 | Ga0495633_0003219_795_1679 | 294 |
| 644 | 3300046558 | Ga0495633_0026211 | Ga0495633_0026211_769_1653 | 294 |
| 645 | 3300046615 | Ga0495656_0000803 | Ga0495656_0000803_3515_4399 | 294 |
| 646 | 3300046616 | Ga0495668_0002764 | Ga0495668_0002764_12289_13173 | 294 |
| 647 | 3300046616 | Ga0495668_0007019 | Ga0495668_0007019_1075_1959 | 294 |
| 648 | 3300046616 | Ga0495668_0013998 | Ga0495668_0013998_3059_3943 | 294 |
| 649 | 3300046642 | Ga0495634_0000815 | Ga0495634_0000815_8737_9621 | 294 |
| 650 | 3300046648 | Ga0495611_0000019 | Ga0495611_0000019_28035_28919 | 294 |
| 651 | 3300046648 | Ga0495611_0000548 | Ga0495611_0000548_1454_2338 | 294 |
| 652 | 3300046660 | Ga0495625_0000084 | Ga0495625_0000084_71005_71889 | 294 |
| 653 | 3300046660 | Ga0495625_0003120 | Ga0495625_0003120_3304_4188 | 294 |
| 654 | 3300046660 | Ga0495625_0004063 | Ga0495625_0004063_10787_11671 | 294 |
| 655 | 3300046660 | Ga0495625_0029114 | Ga0495625_0029114_3186_4070 | 294 |
| 656 | 3300046660 | Ga0495625_0075677 | Ga0495625_0075677_420_1304 | 294 |
| 657 | 3300046663 | Ga0495635_0000522 | Ga0495635_0000522_20411_21295 | 294 |
| 658 | 3300046663 | Ga0495635_0005853 | Ga0495635_0005853_3847_4731 | 294 |
| 659 | 3300046664 | Ga0495659_0000119 | Ga0495659_0000119_9090_9974 | 294 |
| 660 | 3300046664 | Ga0495659_0009781 | Ga0495659_0009781_1159_2043 | 294 |
| 661 | 3300046664 | Ga0495659_0069119 | Ga0495659_0069119_209_1093 | 294 |
| 662 | 3300046665 | Ga0495661_0000035 | Ga0495661_0000035_96544_97428 | 294 |
| 663 | 3300046665 | Ga0495661_0000051 | Ga0495661_0000051_91176_92060 | 294 |
| 664 | 3300046665 | Ga0495661_0000106 | Ga0495661_0000106_38984_39868 | 294 |
| 665 | 3300046665 | Ga0495661_0000269 | Ga0495661_0000269_564_1448 | 294 |
| 666 | 3300046665 | Ga0495661_0005186 | Ga0495661_0005186_74_958 | 294 |
| 667 | 3300046665 | Ga0495661_0025282 | Ga0495661_0025282_2914_3798 | 294 |
| 668 | 3300046665 | Ga0495661_0092887 | Ga0495661_0092887_522_1412 | 294 |
| 669 | 3300046674 | Ga0495588_0025528 | Ga0495588_0025528_319_1203 | 294 |
| 670 | 3300046675 | Ga0495657_0021575 | Ga0495657_0021575_2986_3870 | 294 |
| 671 | 3300046679 | Ga0495623_0009066 | Ga0495623_0009066_2985_3869 | 294 |
| 672 | 3300046679 | Ga0495623_0016801 | Ga0495623_0016801_2871_3755 | 294 |
| 673 | 3300046680 | Ga0495646_0003353 | Ga0495646_0003353_6641_7525 | 294 |
| 674 | 3300046680 | Ga0495646_0003495 | Ga0495646_0003495_1743_2627 | 294 |
| 675 | 3300046680 | Ga0495646_0036488 | Ga0495646_0036488_1458_2342 | 294 |
| 676 | 3300046684 | Ga0495669_0001087 | Ga0495669_0001087_1545_2429 | 294 |
| 677 | 3300046684 | Ga0495669_0070768 | Ga0495669_0070768_117_1001 | 294 |
| 678 | 3300046689 | Ga0495613_0020085 | Ga0495613_0020085_4061_4945 | 294 |
| 679 | 3300046690 | Ga0495624_0000237 | Ga0495624_0000237_20877_21761 | 294 |
| 680 | 3300046691 | Ga0495670_0000455 | Ga0495670_0000455_15313_16197 | 294 |
| 681 | 3300046691 | Ga0495670_0000777 | Ga0495670_0000777_1621_2505 | 294 |
| 682 | 3300046691 | Ga0495670_0012161 | Ga0495670_0012161_51_935 | 294 |
| 683 | 3300046691 | Ga0495670_0140081 | Ga0495670_0140081_136_1020 | 294 |
| 684 | 3300046692 | Ga0495671_0000210 | Ga0495671_0000210_41167_42051 | 294 |
| 685 | 3300046692 | Ga0495671_0001187 | Ga0495671_0001187_8855_9739 | 294 |
| 686 | 3300046692 | Ga0495671_0001243 | Ga0495671_0001243_2054_2938 | 294 |
| 687 | 3300046692 | Ga0495671_0003398 | Ga0495671_0003398_720_1604 | 294 |
| 688 | 3300046692 | Ga0495671_0006777 | Ga0495671_0006777_2708_3592 | 294 |
| 689 | 3300046694 | Ga0495649_0000748 | Ga0495649_0000748_7474_8358 | 294 |
| 690 | 3300046694 | Ga0495649_0002964 | Ga0495649_0002964_8704_9588 | 294 |
| 691 | 3300046694 | Ga0495649_0005325 | Ga0495649_0005325_547_1431 | 294 |
| 692 | 3300046694 | Ga0495649_0009159 | Ga0495649_0009159_1732_2616 | 294 |
| 693 | 3300046694 | Ga0495649_0012051 | Ga0495649_0012051_2960_3844 | 294 |
| 694 | 3300046694 | Ga0495649_0033050 | Ga0495649_0033050_1594_2478 | 294 |
| 695 | 3300046694 | Ga0495649_0045854 | Ga0495649_0045854_605_1489 | 294 |
| 696 | 3300046794 | Ga0495589_0000326 | Ga0495589_0000326_31148_32032 | 294 |
| 697 | 3300046794 | Ga0495589_0000352 | Ga0495589_0000352_20680_21564 | 294 |
| 698 | 3300046794 | Ga0495589_0001450 | Ga0495589_0001450_7426_8310 | 294 |
| 699 | 3300046794 | Ga0495589_0012195 | Ga0495589_0012195_2833_3717 | 294 |
| 700 | 3300046794 | Ga0495589_0014155 | Ga0495589_0014155_155_1039 | 294 |
| 701 | 3300046794 | Ga0495589_0179640 | Ga0495589_0179640_97_981 | 294 |
| 702 | 3300046809 | Ga0495600_0006261 | Ga0495600_0006261_3907_4791 | 294 |
| 703 | 3300046809 | Ga0495600_0030109 | Ga0495600_0030109_328_1212 | 294 |
| 704 | 3300046810 | Ga0495660_0005494 | Ga0495660_0005494_566_1450 | 294 |
| 705 | 3300046810 | Ga0495660_0022962 | Ga0495660_0022962_2219_3103 | 294 |
| 706 | 3300046810 | Ga0495660_0071874 | Ga0495660_0071874_44_928 | 294 |
| 707 | 3300046810 | Ga0495660_0075648 | Ga0495660_0075648_629_1513 | 294 |
| 708 | 3300046810 | Ga0495660_0120459 | Ga0495660_0120459_396_1280 | 294 |
| 709 | 3300046810 | Ga0495660_0153188 | Ga0495660_0153188_185_1069 | 294 |
| 710 | 3300047315 | Ga0495581_0025132 | Ga0495581_0025132_2309_3193 | 294 |
| 711 | 3300047315 | Ga0495581_0038645 | Ga0495581_0038645_1234_2118 | 294 |
| 712 | 3300047317 | Ga0495604_0014324 | Ga0495604_0014324_1627_2511 | 294 |
| 713 | 3300047318 | Ga0495636_0005847 | Ga0495636_0005847_1708_2592 | 294 |
| 714 | 3300047318 | Ga0495636_0139341 | Ga0495636_0139341_31_915 | 294 |
| 715 | 3300047319 | Ga0495674_0009374 | Ga0495674_0009374_1109_1993 | 294 |
| 716 | 3300047320 | Ga0495672_0000787 | Ga0495672_0000787_20882_21766 | 294 |
| 717 | 3300047320 | Ga0495672_0000817 | Ga0495672_0000817_4764_5648 | 294 |
| 718 | 3300047320 | Ga0495672_0001555 | Ga0495672_0001555_17251_18135 | 294 |
| 719 | 3300047320 | Ga0495672_0001980 | Ga0495672_0001980_1820_2704 | 294 |
| 720 | 3300047320 | Ga0495672_0003332 | Ga0495672_0003332_104_988 | 294 |
| 721 | 3300047320 | Ga0495672_0016601 | Ga0495672_0016601_3156_4040 | 294 |
| 722 | 3300047321 | Ga0495676_0000368 | Ga0495676_0000368_15494_16378 | 294 |
| 723 | 3300047321 | Ga0495676_0002558 | Ga0495676_0002558_8746_9630 | 294 |
| 724 | 3300047322 | Ga0495680_0002029 | Ga0495680_0002029_9866_10750 | 294 |
| 725 | 3300047322 | Ga0495680_0007735 | Ga0495680_0007735_6179_7063 | 294 |
| 726 | 3300047322 | Ga0495680_0027810 | Ga0495680_0027810_925_1809 | 294 |
| 727 | 3300047323 | Ga0495683_0000004 | Ga0495683_0000004_140713_141597 | 294 |
| 728 | 3300047323 | Ga0495683_0000318 | Ga0495683_0000318_31709_32593 | 294 |
| 729 | 3300047323 | Ga0495683_0000356 | Ga0495683_0000356_29096_29980 | 294 |
| 730 | 3300047323 | Ga0495683_0010106 | Ga0495683_0010106_3903_4787 | 294 |
| 731 | 3300047323 | Ga0495683_0014694 | Ga0495683_0014694_344_1228 | 294 |
| 732 | 3300047323 | Ga0495683_0097249 | Ga0495683_0097249_276_1160 | 294 |
| 733 | 3300047323 | Ga0495683_0150538 | Ga0495683_0150538_157_1041 | 294 |
| 734 | 3300047443 | Ga0495687_000977 | Ga0495687_000977_1152_2036 | 294 |
| 735 | 3300047443 | Ga0495687_006152 | Ga0495687_006152_3088_3972 | 294 |
| 736 | 3300047443 | Ga0495687_007971 | Ga0495687_007971_3094_3978 | 294 |
| 737 | 3300047444 | Ga0495675_0009385 | Ga0495675_0009385_4142_5026 | 294 |
| 738 | 3300047445 | Ga0495677_0000848 | Ga0495677_0000848_8412_9296 | 294 |
| 739 | 3300047446 | Ga0495679_000137 | Ga0495679_000137_36429_37313 | 294 |
| 740 | 3300047446 | Ga0495679_000323 | Ga0495679_000323_8604_9488 | 294 |
| 741 | 3300047446 | Ga0495679_008771 | Ga0495679_008771_137_1021 | 294 |
| 742 | 3300047446 | Ga0495679_047765 | Ga0495679_047765_24_908 | 294 |
| 743 | 3300047469 | Ga0495673_0000118 | Ga0495673_0000118_22760_23644 | 294 |
| 744 | 3300047469 | Ga0495673_0000465 | Ga0495673_0000465_9377_10261 | 294 |
| 745 | 3300047469 | Ga0495673_0001449 | Ga0495673_0001449_3574_4458 | 294 |
| 746 | 3300047469 | Ga0495673_0001451 | Ga0495673_0001451_7709_8593 | 294 |
| 747 | 3300047469 | Ga0495673_0001736 | Ga0495673_0001736_15557_16441 | 294 |
| 748 | 3300047469 | Ga0495673_0011327 | Ga0495673_0011327_821_1705 | 294 |
| 749 | 3300047469 | Ga0495673_0018699 | Ga0495673_0018699_438_1322 | 294 |
| 750 | 3300047469 | Ga0495673_0049386 | Ga0495673_0049386_16_906 | 294 |
| 751 | 3300047469 | Ga0495673_0096219 | Ga0495673_0096219_204_1088 | 294 |
| 752 | 3300047469 | Ga0495673_0097333 | Ga0495673_0097333_73_957 | 294 |
| 753 | 3300047470 | Ga0495681_0000353 | Ga0495681_0000353_25053_25937 | 294 |
| 754 | 3300047470 | Ga0495681_0000478 | Ga0495681_0000478_13722_14606 | 294 |
| 755 | 3300047470 | Ga0495681_0002364 | Ga0495681_0002364_657_1541 | 294 |
| 756 | 3300047470 | Ga0495681_0003644 | Ga0495681_0003644_9480_10364 | 294 |
| 757 | 3300047470 | Ga0495681_0010181 | Ga0495681_0010181_2448_3332 | 294 |
| 758 | 3300047470 | Ga0495681_0014600 | Ga0495681_0014600_3143_4027 | 294 |
| 759 | 3300047470 | Ga0495681_0023899 | Ga0495681_0023899_1492_2376 | 294 |
| 760 | 3300047470 | Ga0495681_0027162 | Ga0495681_0027162_1968_2852 | 294 |
| 761 | 3300047471 | Ga0495684_0010777 | Ga0495684_0010777_6098_6982 | 294 |
| 762 | 3300047472 | Ga0495686_0092127 | Ga0495686_0092127_783_1667 | 294 |
| 763 | 3300047673 | Ga0495593_0001207 | Ga0495593_0001207_13416_14300 | 294 |
| 764 | 3300047673 | Ga0495593_0022745 | Ga0495593_0022745_403_1287 | 294 |
| 765 | 3300047673 | Ga0495593_0029111 | Ga0495593_0029111_261_1145 | 294 |
| 766 | 3300047673 | Ga0495593_0124356 | Ga0495593_0124356_25_909 | 294 |
| 767 | 3300048091 | Ga0495626_0000002 | Ga0495626_0000002_79845_80729 | 294 |
| 768 | 3300048091 | Ga0495626_0000064 | Ga0495626_0000064_120981_121865 | 294 |
| 769 | 3300048091 | Ga0495626_0000616 | Ga0495626_0000616_26134_27018 | 294 |
| 770 | 3300048091 | Ga0495626_0000958 | Ga0495626_0000958_18503_19387 | 294 |
| 771 | 3300048091 | Ga0495626_0001601 | Ga0495626_0001601_3260_4144 | 294 |
| 772 | 3300048091 | Ga0495626_0002256 | Ga0495626_0002256_3662_4546 | 294 |
| 773 | 3300048091 | Ga0495626_0016259 | Ga0495626_0016259_2429_3313 | 294 |
| 774 | 3300048091 | Ga0495626_0026985 | Ga0495626_0026985_1638_2522 | 294 |
| 775 | 3300048091 | Ga0495626_0027531 | Ga0495626_0027531_1610_2494 | 294 |
| 776 | 3300048091 | Ga0495626_0040702 | Ga0495626_0040702_981_1865 | 294 |
| 777 | 3300048905 | Ga0496102_0681244 | Ga0496102_0681244_18_902 | 294 |
| 778 | 3300048909 | Ga0496106_0269326 | Ga0496106_0269326_95_979 | 294 |
| 779 | 3300048909 | Ga0496106_0276004 | Ga0496106_0276004_181_1065 | 294 |
| 780 | 3300048913 | Ga0496110_0099192 | Ga0496110_0099192_1145_2029 | 294 |
| 781 | 3300048913 | Ga0496110_0177998 | Ga0496110_0177998_730_1614 | 294 |
| 782 | 3300048913 | Ga0496110_0527215 | Ga0496110_0527215_107_991 | 294 |
| 783 | 3300048916 | Ga0496113_0187105 | Ga0496113_0187105_604_1488 | 294 |
| 784 | 3300048919 | Ga0496116_0000038 | Ga0496116_0000038_361380_362264 | 294 |
| 785 | 3300048919 | Ga0496116_0000382 | Ga0496116_0000382_64228_65112 | 294 |
| 786 | 3300048919 | Ga0496116_0001933 | Ga0496116_0001933_649_1533 | 294 |
| 787 | 3300048919 | Ga0496116_0002265 | Ga0496116_0002265_519_1403 | 294 |
| 788 | 3300048919 | Ga0496116_0025816 | Ga0496116_0025816_462_1346 | 294 |
| 789 | 3300048920 | Ga0496117_0007085 | Ga0496117_0007085_9733_10617 | 294 |
| 790 | 3300048920 | Ga0496117_0030407 | Ga0496117_0030407_304_1188 | 294 |
| 791 | 3300048920 | Ga0496117_0050196 | Ga0496117_0050196_1094_1978 | 294 |
| 792 | 3300048920 | Ga0496117_0101515 | Ga0496117_0101515_709_1593 | 294 |
| 793 | 3300048921 | Ga0496118_0027699 | Ga0496118_0027699_1959_2843 | 294 |
| 794 | 3300048921 | Ga0496118_0028593 | Ga0496118_0028593_751_1635 | 294 |
| 795 | 3300048921 | Ga0496118_0031937 | Ga0496118_0031937_497_1381 | 294 |
| 796 | 3300048921 | Ga0496118_0044902 | Ga0496118_0044902_1426_2310 | 294 |
| 797 | 3300048921 | Ga0496118_0129631 | Ga0496118_0129631_600_1484 | 294 |
| 798 | 3300048921 | Ga0496118_0133520 | Ga0496118_0133520_506_1390 | 294 |
| 799 | 3300048922 | Ga0496119_0166960 | Ga0496119_0166960_126_1010 | 294 |
| 800 | 3300048923 | Ga0496120_0025586 | Ga0496120_0025586_93_977 | 294 |
| 801 | 3300048924 | Ga0496121_0000589 | Ga0496121_0000589_2575_3459 | 294 |
| 802 | 3300048924 | Ga0496121_0001708 | Ga0496121_0001708_26001_26885 | 294 |
| 803 | 3300048924 | Ga0496121_0001828 | Ga0496121_0001828_18453_19337 | 294 |
| 804 | 3300048924 | Ga0496121_0004020 | Ga0496121_0004020_15514_16398 | 294 |
| 805 | 3300048924 | Ga0496121_0036966 | Ga0496121_0036966_487_1371 | 294 |
| 806 | 3300048924 | Ga0496121_0249323 | Ga0496121_0249323_261_1145 | 294 |
| 807 | 3300048925 | Ga0496122_0000411 | Ga0496122_0000411_25138_26022 | 294 |
| 808 | 3300048925 | Ga0496122_0011920 | Ga0496122_0011920_1975_2859 | 294 |
| 809 | 3300048925 | Ga0496122_0025179 | Ga0496122_0025179_3158_4042 | 294 |
| 810 | 3300048925 | Ga0496122_0032954 | Ga0496122_0032954_491_1375 | 294 |
| 811 | 3300048925 | Ga0496122_0062334 | Ga0496122_0062334_1261_2145 | 294 |
| 812 | 3300048925 | Ga0496122_0187453 | Ga0496122_0187453_22_906 | 294 |
| 813 | 3300048926 | Ga0496123_0000055 | Ga0496123_0000055_73448_74332 | 294 |
| 814 | 3300048926 | Ga0496123_0003979 | Ga0496123_0003979_12307_13191 | 294 |
| 815 | 3300048926 | Ga0496123_0008610 | Ga0496123_0008610_7588_8472 | 294 |
| 816 | 3300048926 | Ga0496123_0025966 | Ga0496123_0025966_497_1381 | 294 |
| 817 | 3300048926 | Ga0496123_0062936 | Ga0496123_0062936_551_1435 | 294 |
| 818 | 3300048927 | Ga0496124_0001124 | Ga0496124_0001124_29521_30405 | 294 |
| 819 | 3300048927 | Ga0496124_0004348 | Ga0496124_0004348_15382_16266 | 294 |
| 820 | 3300048927 | Ga0496124_0081959 | Ga0496124_0081959_83_967 | 294 |
| 821 | 3300048927 | Ga0496124_0092891 | Ga0496124_0092891_730_1614 | 294 |
| 822 | 3300048927 | Ga0496124_0146638 | Ga0496124_0146638_219_1103 | 294 |
| 823 | 3300048927 | Ga0496124_0204453 | Ga0496124_0204453_241_1125 | 294 |
| 824 | 3300048928 | Ga0496125_0003572 | Ga0496125_0003572_1499_2383 | 294 |
| 825 | 3300048928 | Ga0496125_0004187 | Ga0496125_0004187_15383_16267 | 294 |
| 826 | 3300048928 | Ga0496125_0039387 | Ga0496125_0039387_185_1069 | 294 |
| 827 | 3300048929 | Ga0496126_0032027 | Ga0496126_0032027_550_1434 | 294 |
| 828 | 3300048929 | Ga0496126_0044557 | Ga0496126_0044557_2683_3567 | 294 |
| 829 | 3300048929 | Ga0496126_0160606 | Ga0496126_0160606_934_1818 | 294 |
| 830 | 3300049459 | Ga0495678_000014 | Ga0495678_000014_172772_173656 | 294 |
| 831 | 3300049459 | Ga0495678_000578 | Ga0495678_000578_7740_8624 | 294 |
| 832 | 3300049459 | Ga0495678_000628 | Ga0495678_000628_30001_30885 | 294 |
| 833 | 3300049459 | Ga0495678_002924 | Ga0495678_002924_208_1092 | 294 |
| 834 | 3300049459 | Ga0495678_003304 | Ga0495678_003304_2970_3854 | 294 |
| 835 | 3300049459 | Ga0495678_003870 | Ga0495678_003870_1818_2702 | 294 |
| 836 | 3300049459 | Ga0495678_004245 | Ga0495678_004245_410_1294 | 294 |
| 837 | 3300049459 | Ga0495678_013459 | Ga0495678_013459_454_1338 | 294 |
| 838 | 3300049459 | Ga0495678_017896 | Ga0495678_017896_714_1598 | 294 |
| 839 | 3300049459 | Ga0495678_028443 | Ga0495678_028443_493_1377 | 294 |
| 840 | 3300049459 | Ga0495678_077094 | Ga0495678_077094_208_1092 | 294 |
| 841 | 3300049460 | Ga0495682_0000025 | Ga0495682_0000025_65468_66352 | 294 |
| 842 | 3300049460 | Ga0495682_0000099 | Ga0495682_0000099_46889_47773 | 294 |
| 843 | 3300049460 | Ga0495682_0001018 | Ga0495682_0001018_775_1659 | 294 |
| 844 | 3300049460 | Ga0495682_0006579 | Ga0495682_0006579_3162_4046 | 294 |
| 845 | 3300049460 | Ga0495682_0006967 | Ga0495682_0006967_551_1435 | 294 |
| 846 | 3300049460 | Ga0495682_0007925 | Ga0495682_0007925_2887_3771 | 294 |
| 847 | 3300049460 | Ga0495682_0030020 | Ga0495682_0030020_813_1697 | 294 |
| 848 | 3300053111 | Ga0500572_000710 | Ga0500572_000710_9316_10200 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8t0j-assembly1.cif.gz_A | salmonella typhimurium arnd | 0.9725 | 1 | 294 |
| 8t0j-assembly1.cif.gz_A | salmonella typhimurium arnd | 0.9584 | 1 | 294 |
| 4m1b-assembly2.cif.gz_B | structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis | 0.8358 | 2 | 264 |
| 7y51-assembly1.cif.gz_A-2 | acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant | 0.8188 | 2 | 264 |
| 5o6y-assembly2.cif.gz_B | crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{n}-oxidanyl-benzamide | 0.8125 | 2 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76472_1_267_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8853 | 1 | 266 | 3.30.70.260 |
| af_P76472_1_267_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8788 | 1 | 266 | 3.30.70.260 |
| 4m1bB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8358 | 2 | 264 | 3.20.20.370 |
| 5lgcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8023 | 3 | 264 | 3.20.20.370 |
| 2cc0B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.798 | 2 | 271 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8E0J5-F1-model_v4 | deleted | 0.9894 | 100 | 294 |
|
| AF-A0A836ZPV7-F1-model_v4 | deleted | 0.989 | 144 | 292 |
|
| AF-A0A3D9E707-F1-model_v4 | NodB homology domain-containing protein | 0.9867 | 145 | 292 |
GO:0005975
GO:0016810 |
| AF-A0A7G7ESQ9-F1-model_v4 | deleted | 0.9814 | 103 | 294 |
|
| AF-A0A485AEY9-F1-model_v4 | Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (EC 3.5.1.n3) | 0.9811 | 2 | 294 |
GO:0009103
GO:0009245 GO:0016020 GO:0016811 GO:0036108 GO:0046677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar