F483324
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 847 | 317 | 1694 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_100107336|Ga0070712_1001073362 |
| Length | 243 |
| Sequence | VCPLQASCQGAARGGLDVSARVLVVDDEPQFLRALTTNLRGAGYEVETATNAAEALAAAGLQPPDAIVLDLLLPDGTGTEVCRELRAWTDAPIILVSAVGDEAEKIAALDAGADDYVTKPFAPGELLARLRAVLRRAGQPGTPIVTVGEITIDLDKAEVSVSGRHVHLTPHEFKILRLLARNPGKLLTHRTILREVWGPAYGEESNYMHVYVSQLRRKLERDPASPQMILTEPGAGYRLVDPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 165 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 175 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 178 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 200 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 201 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 202 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 203 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 204 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 205 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 206 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 207 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.17 |
| Metatranscriptomes | 0.83 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.74 |
| Rhizosphere | 90.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070712_100107336 | 3300006175 | Bacteria | 2077 |
| 2 | Ga0070658_10029398 | 3300005327 | Bacteria | 4414 |
| 3 | Ga0070658_10030486 | 3300005327 | Bacteria | 4333 |
| 4 | Ga0070658_10258860 | 3300005327 | Bacteria | 1477 |
| 5 | Ga0070658_10519873 | 3300005327 | Bacteria | 1029 |
| 6 | Ga0070683_100002472 | 3300005329 | Bacteria | 14707 |
| 7 | Ga0070683_100010372 | 3300005329 | Bacteria | 8012 |
| 8 | Ga0070683_100021670 | 3300005329 | Bacteria | 5737 |
| 9 | Ga0070683_100039988 | 3300005329 | Bacteria | 4309 |
| 10 | Ga0070683_100063383 | 3300005329 | Bacteria | 3438 |
| 11 | Ga0070683_100064591 | 3300005329 | Bacteria | 3407 |
| 12 | Ga0070683_100092932 | 3300005329 | Bacteria | 2833 |
| 13 | Ga0068869_100038703 | 3300005334 | Bacteria | 3401 |
| 14 | Ga0070680_100036568 | 3300005336 | Bacteria | 3966 |
| 15 | Ga0070680_100045492 | 3300005336 | Bacteria | 3568 |
| 16 | Ga0070680_100045924 | 3300005336 | Bacteria | 3553 |
| 17 | Ga0070680_100053862 | 3300005336 | Bacteria | 3284 |
| 18 | Ga0070680_100127399 | 3300005336 | Bacteria | 2127 |
| 19 | Ga0070680_100373156 | 3300005336 | Bacteria | 1214 |
| 20 | Ga0070682_100009164 | 3300005337 | Bacteria | 5596 |
| 21 | Ga0070682_100129714 | 3300005337 | Bacteria | 1704 |
| 22 | Ga0068868_100028128 | 3300005338 | Bacteria | 4295 |
| 23 | Ga0068868_100032866 | 3300005338 | Bacteria | 3994 |
| 24 | Ga0068868_100246733 | 3300005338 | Bacteria | 1502 |
| 25 | Ga0070660_100007335 | 3300005339 | Bacteria | 7686 |
| 26 | Ga0070660_100011648 | 3300005339 | Bacteria | 6260 |
| 27 | Ga0070660_100013751 | 3300005339 | Bacteria | 5819 |
| 28 | Ga0070687_100073830 | 3300005343 | Bacteria | 1840 |
| 29 | Ga0070661_100007966 | 3300005344 | Bacteria | 7319 |
| 30 | Ga0070661_100027817 | 3300005344 | Bacteria | 4075 |
| 31 | Ga0070661_100073156 | 3300005344 | Bacteria | 2523 |
| 32 | Ga0070661_100075500 | 3300005344 | Bacteria | 2483 |
| 33 | Ga0070661_100076004 | 3300005344 | Bacteria | 2475 |
| 34 | Ga0070692_10016571 | 3300005345 | Bacteria | 3505 |
| 35 | Ga0070668_100016550 | 3300005347 | Bacteria | 5513 |
| 36 | Ga0070668_100031052 | 3300005347 | Bacteria | 4065 |
| 37 | Ga0070669_100098008 | 3300005353 | Bacteria | 2208 |
| 38 | Ga0070675_100010505 | 3300005354 | Bacteria | 7231 |
| 39 | Ga0070675_100021924 | 3300005354 | Bacteria | 5104 |
| 40 | Ga0070675_100092359 | 3300005354 | Bacteria | 2537 |
| 41 | Ga0070671_100466816 | 3300005355 | Bacteria | 1084 |
| 42 | Ga0070674_100179099 | 3300005356 | Bacteria | 1622 |
| 43 | Ga0070674_100521180 | 3300005356 | Bacteria | 993 |
| 44 | Ga0070673_100024882 | 3300005364 | Bacteria | 4396 |
| 45 | Ga0070659_100004431 | 3300005366 | Bacteria | 10030 |
| 46 | Ga0070659_100007242 | 3300005366 | Bacteria | 8052 |
| 47 | Ga0070659_100010831 | 3300005366 | Bacteria | 6723 |
| 48 | Ga0070659_100243433 | 3300005366 | Bacteria | 1489 |
| 49 | Ga0070667_100033281 | 3300005367 | Bacteria | 4307 |
| 50 | Ga0070667_100538341 | 3300005367 | Bacteria | 1073 |
| 51 | Ga0070714_100038182 | 3300005435 | Bacteria | 4038 |
| 52 | Ga0070714_100076863 | 3300005435 | Bacteria | 2899 |
| 53 | Ga0070714_100078199 | 3300005435 | Bacteria | 2875 |
| 54 | Ga0070714_100123818 | 3300005435 | Bacteria | 2302 |
| 55 | Ga0070714_100335489 | 3300005435 | Bacteria | 1417 |
| 56 | Ga0070714_100651439 | 3300005435 | Bacteria | 1014 |
| 57 | Ga0070713_100138256 | 3300005436 | Bacteria | 2155 |
| 58 | Ga0070713_100585727 | 3300005436 | Bacteria | 1059 |
| 59 | Ga0070710_10101627 | 3300005437 | Bacteria | 1713 |
| 60 | Ga0070701_10068550 | 3300005438 | Bacteria | 1890 |
| 61 | Ga0070701_10150010 | 3300005438 | Bacteria | 1341 |
| 62 | Ga0070711_100181113 | 3300005439 | Bacteria | 1613 |
| 63 | Ga0070705_100004030 | 3300005440 | Bacteria | 7175 |
| 64 | Ga0070705_100036522 | 3300005440 | Bacteria | 2763 |
| 65 | Ga0070700_100005497 | 3300005441 | Bacteria | 6723 |
| 66 | Ga0070700_100696503 | 3300005441 | Bacteria | 807 |
| 67 | Ga0070694_100002457 | 3300005444 | Bacteria | 10937 |
| 68 | Ga0070708_100035628 | 3300005445 | Bacteria | 4336 |
| 69 | Ga0070708_100072583 | 3300005445 | Bacteria | 3101 |
| 70 | Ga0070663_100015229 | 3300005455 | Bacteria | 4957 |
| 71 | Ga0070663_100166263 | 3300005455 | Bacteria | 1702 |
| 72 | Ga0070678_100614321 | 3300005456 | Bacteria | 972 |
| 73 | Ga0070662_100040182 | 3300005457 | Bacteria | 3330 |
| 74 | Ga0070681_10001591 | 3300005458 | Bacteria | 20191 |
| 75 | Ga0070681_10006990 | 3300005458 | Bacteria | 10986 |
| 76 | Ga0070681_10012573 | 3300005458 | Bacteria | 8400 |
| 77 | Ga0070681_10015213 | 3300005458 | Bacteria | 7653 |
| 78 | Ga0070681_10016355 | 3300005458 | Bacteria | 7404 |
| 79 | Ga0070681_10028165 | 3300005458 | Bacteria | 5648 |
| 80 | Ga0070681_10037319 | 3300005458 | Bacteria | 4877 |
| 81 | Ga0070681_10063340 | 3300005458 | Bacteria | 3670 |
| 82 | Ga0070681_10163230 | 3300005458 | Bacteria | 2151 |
| 83 | Ga0068867_100122526 | 3300005459 | Bacteria | 2011 |
| 84 | Ga0070685_10000846 | 3300005466 | Bacteria | 16648 |
| 85 | Ga0070707_100001810 | 3300005468 | Bacteria | 20550 |
| 86 | Ga0070698_100101374 | 3300005471 | Bacteria | 2850 |
| 87 | Ga0070699_100266006 | 3300005518 | Bacteria | 1534 |
| 88 | Ga0070679_100019432 | 3300005530 | Bacteria | 6606 |
| 89 | Ga0070679_100041881 | 3300005530 | Bacteria | 4559 |
| 90 | Ga0070679_100080399 | 3300005530 | Bacteria | 3248 |
| 91 | Ga0070679_100085490 | 3300005530 | Bacteria | 3141 |
| 92 | Ga0070679_100106642 | 3300005530 | Bacteria | 2787 |
| 93 | Ga0070679_100122734 | 3300005530 | Bacteria | 2581 |
| 94 | Ga0070679_100124503 | 3300005530 | Bacteria | 2560 |
| 95 | Ga0070679_100126066 | 3300005530 | Bacteria | 2543 |
| 96 | Ga0070684_100001383 | 3300005535 | Bacteria | 17420 |
| 97 | Ga0070684_100002522 | 3300005535 | Bacteria | 13503 |
| 98 | Ga0070684_100074954 | 3300005535 | Bacteria | 2983 |
| 99 | Ga0070684_100188172 | 3300005535 | Bacteria | 1878 |
| 100 | Ga0070684_100196586 | 3300005535 | Bacteria | 1836 |
| 101 | Ga0070697_100249833 | 3300005536 | Bacteria | 1516 |
| 102 | Ga0068853_100018280 | 3300005539 | Bacteria | 5800 |
| 103 | Ga0070672_100568544 | 3300005543 | Bacteria | 985 |
| 104 | Ga0070695_100016906 | 3300005545 | Bacteria | 4421 |
| 105 | Ga0070693_100008449 | 3300005547 | Bacteria | 5078 |
| 106 | Ga0070665_100035251 | 3300005548 | Bacteria | 5031 |
| 107 | Ga0070665_100111245 | 3300005548 | Bacteria | 2741 |
| 108 | Ga0070704_100007457 | 3300005549 | Bacteria | 6515 |
| 109 | Ga0068855_100081737 | 3300005563 | Bacteria | 3744 |
| 110 | Ga0068855_100084573 | 3300005563 | Bacteria | 3673 |
| 111 | Ga0068855_100090847 | 3300005563 | Bacteria | 3523 |
| 112 | Ga0068855_100094862 | 3300005563 | Bacteria | 3440 |
| 113 | Ga0068855_100107328 | 3300005563 | Bacteria | 3208 |
| 114 | Ga0068855_100143711 | 3300005563 | Bacteria | 2717 |
| 115 | Ga0068855_100148546 | 3300005563 | Bacteria | 2666 |
| 116 | Ga0068855_100193096 | 3300005563 | Bacteria | 2295 |
| 117 | Ga0068855_100289432 | 3300005563 | Bacteria | 1816 |
| 118 | Ga0068855_100617180 | 3300005563 | Bacteria | 1168 |
| 119 | Ga0070664_100045837 | 3300005564 | Bacteria | 3692 |
| 120 | Ga0070664_100105372 | 3300005564 | Bacteria | 2456 |
| 121 | Ga0068857_100069412 | 3300005577 | Bacteria | 3138 |
| 122 | Ga0068857_100085508 | 3300005577 | Bacteria | 2819 |
| 123 | Ga0068856_100005747 | 3300005614 | Bacteria | 12223 |
| 124 | Ga0068856_100109046 | 3300005614 | Bacteria | 2764 |
| 125 | Ga0068856_100349635 | 3300005614 | Bacteria | 1497 |
| 126 | Ga0068856_100412772 | 3300005614 | Bacteria | 1370 |
| 127 | Ga0070702_100165370 | 3300005615 | Bacteria | 1434 |
| 128 | Ga0068852_100027639 | 3300005616 | Bacteria | 4626 |
| 129 | Ga0068852_100154476 | 3300005616 | Bacteria | 2136 |
| 130 | Ga0068852_100806600 | 3300005616 | Bacteria | 953 |
| 131 | Ga0068864_100044403 | 3300005618 | Bacteria | 3809 |
| 132 | Ga0068866_10005588 | 3300005718 | Bacteria | 5200 |
| 133 | Ga0068861_100032632 | 3300005719 | Bacteria | 3835 |
| 134 | Ga0068870_10029180 | 3300005840 | Bacteria | 2776 |
| 135 | Ga0068870_10312810 | 3300005840 | Bacteria | 995 |
| 136 | Ga0068863_100012957 | 3300005841 | Bacteria | 8040 |
| 137 | Ga0068858_100029846 | 3300005842 | Bacteria | 5065 |
| 138 | Ga0068858_100041547 | 3300005842 | Bacteria | 4263 |
| 139 | Ga0068860_100027455 | 3300005843 | Bacteria | 5482 |
| 140 | Ga0068862_100152732 | 3300005844 | Bacteria | 2056 |
| 141 | Ga0081455_10308068 | 3300005937 | Bacteria | 1133 |
| 142 | Ga0070717_10035566 | 3300006028 | Bacteria | 4033 |
| 143 | Ga0070717_10111903 | 3300006028 | Bacteria | 2330 |
| 144 | Ga0070717_10261900 | 3300006028 | Bacteria | 1530 |
| 145 | Ga0070717_10270506 | 3300006028 | Bacteria | 1505 |
| 146 | Ga0075432_10046956 | 3300006058 | Bacteria | 1517 |
| 147 | Ga0070716_100013626 | 3300006173 | Bacteria | 4148 |
| 148 | Ga0070716_100015130 | 3300006173 | Bacteria | 3958 |
| 149 | Ga0070712_100007701 | 3300006175 | Bacteria | 6737 |
| 150 | Ga0070712_100025589 | 3300006175 | Bacteria | 3925 |
| 151 | Ga0097621_100032307 | 3300006237 | Bacteria | 4160 |
| 152 | Ga0075434_100005086 | 3300006871 | Bacteria | 11943 |
| 153 | Ga0068865_100002315 | 3300006881 | Bacteria | 11221 |
| 154 | Ga0075436_100138139 | 3300006914 | Bacteria | 1712 |
| 155 | Ga0105240_10059366 | 3300009093 | Bacteria | 4774 |
| 156 | Ga0105240_10068736 | 3300009093 | Bacteria | 4387 |
| 157 | Ga0105240_10204640 | 3300009093 | Bacteria | 2311 |
| 158 | Ga0105240_10207015 | 3300009093 | Bacteria | 2295 |
| 159 | Ga0111539_10037840 | 3300009094 | Bacteria | 5821 |
| 160 | Ga0111539_10072362 | 3300009094 | Bacteria | 4065 |
| 161 | Ga0111539_10226464 | 3300009094 | Bacteria | 2178 |
| 162 | Ga0105245_10028493 | 3300009098 | Bacteria | 4928 |
| 163 | Ga0105245_10085056 | 3300009098 | Bacteria | 2899 |
| 164 | Ga0105245_10099685 | 3300009098 | Bacteria | 2686 |
| 165 | Ga0105245_10326714 | 3300009098 | Bacteria | 1513 |
| 166 | Ga0105245_10362402 | 3300009098 | Bacteria | 1439 |
| 167 | Ga0105247_10149099 | 3300009101 | Bacteria | 1540 |
| 168 | Ga0114129_10035786 | 3300009147 | Bacteria | 7013 |
| 169 | Ga0105243_10062453 | 3300009148 | Bacteria | 2982 |
| 170 | Ga0105243_10090904 | 3300009148 | Bacteria | 2513 |
| 171 | Ga0105241_10068396 | 3300009174 | Bacteria | 2752 |
| 172 | Ga0105242_10009215 | 3300009176 | Bacteria | 7574 |
| 173 | Ga0105242_10019641 | 3300009176 | Bacteria | 5297 |
| 174 | Ga0105242_10641675 | 3300009176 | Bacteria | 1031 |
| 175 | Ga0105248_10321226 | 3300009177 | Bacteria | 1744 |
| 176 | Ga0105248_10364936 | 3300009177 | Bacteria | 1626 |
| 177 | Ga0105237_10013082 | 3300009545 | Bacteria | 8713 |
| 178 | Ga0105237_10013814 | 3300009545 | Bacteria | 8452 |
| 179 | Ga0105238_10020242 | 3300009551 | Bacteria | 6772 |
| 180 | Ga0105238_10068356 | 3300009551 | Bacteria | 3554 |
| 181 | Ga0105238_10371380 | 3300009551 | Bacteria | 1421 |
| 182 | Ga0105249_10020856 | 3300009553 | Bacteria | 5859 |
| 183 | Ga0105249_10034022 | 3300009553 | Bacteria | 4616 |
| 184 | Ga0105239_10045777 | 3300010375 | Bacteria | 4795 |
| 185 | Ga0105239_10079298 | 3300010375 | Bacteria | 3613 |
| 186 | Ga0105239_10636468 | 3300010375 | Bacteria | 1218 |
| 187 | Ga0105239_10880086 | 3300010375 | Bacteria | 1028 |
| 188 | Ga0105246_10160044 | 3300011119 | Bacteria | 1714 |
| 189 | Ga0105246_10839173 | 3300011119 | Bacteria | 819 |
| 190 | Ga0157373_10061788 | 3300013100 | Bacteria | 2653 |
| 191 | Ga0157373_10096894 | 3300013100 | Bacteria | 2077 |
| 192 | Ga0157370_10007863 | 3300013104 | Bacteria | 11555 |
| 193 | Ga0157370_10262436 | 3300013104 | Bacteria | 1596 |
| 194 | Ga0157370_10306053 | 3300013104 | Bacteria | 1467 |
| 195 | Ga0157370_10371400 | 3300013104 | Bacteria | 1318 |
| 196 | Ga0157369_10007653 | 3300013105 | Bacteria | 12426 |
| 197 | Ga0157369_10060259 | 3300013105 | Bacteria | 4093 |
| 198 | Ga0157369_10193803 | 3300013105 | Bacteria | 2134 |
| 199 | Ga0157369_10279503 | 3300013105 | Bacteria | 1739 |
| 200 | Ga0157369_10502133 | 3300013105 | Bacteria | 1255 |
| 201 | Ga0157374_10257626 | 3300013296 | Bacteria | 1718 |
| 202 | Ga0157374_10286340 | 3300013296 | Bacteria | 1627 |
| 203 | Ga0157378_10040693 | 3300013297 | Bacteria | 4122 |
| 204 | Ga0163162_10058821 | 3300013306 | Bacteria | 3874 |
| 205 | Ga0157372_10085380 | 3300013307 | Bacteria | 3580 |
| 206 | Ga0157372_10098613 | 3300013307 | Bacteria | 3334 |
| 207 | Ga0157372_10283965 | 3300013307 | Bacteria | 1925 |
| 208 | Ga0157372_10465443 | 3300013307 | Bacteria | 1474 |
| 209 | Ga0157372_10541625 | 3300013307 | Bacteria | 1357 |
| 210 | Ga0157375_10681267 | 3300013308 | Bacteria | 1183 |
| 211 | Ga0157375_11205255 | 3300013308 | Bacteria | 888 |
| 212 | Ga0157380_10147827 | 3300014326 | Bacteria | 2027 |
| 213 | Ga0157377_10012184 | 3300014745 | Bacteria | 4316 |
| 214 | Ga0157377_10021214 | 3300014745 | Bacteria | 3415 |
| 215 | Ga0157379_10010152 | 3300014968 | Bacteria | 8207 |
| 216 | Ga0163161_10007758 | 3300017792 | Bacteria | 7424 |
| 217 | Ga0206356_10929261 | 3300020070 | Bacteria | 1798 |
| 218 | Ga0206356_11728262 | 3300020070 | Bacteria | 1066 |
| 219 | Ga0206354_10144672 | 3300020081 | Bacteria | 1341 |
| 220 | Ga0206354_10736586 | 3300020081 | Bacteria | 1464 |
| 221 | Ga0206354_11227078 | 3300020081 | Bacteria | 1186 |
| 222 | Ga0206353_10202598 | 3300020082 | Bacteria | 2498 |
| 223 | Ga0206353_10920896 | 3300020082 | Bacteria | 5283 |
| 224 | Ga0213876_10281607 | 3300021384 | Bacteria | 884 |
| 225 | Ga0207656_10025785 | 3300025321 | Bacteria | 2390 |
| 226 | Ga0207692_10092305 | 3300025898 | Bacteria | 1645 |
| 227 | Ga0207642_10178119 | 3300025899 | Bacteria | 1156 |
| 228 | Ga0207699_10038398 | 3300025906 | Bacteria | 2744 |
| 229 | Ga0207645_10035260 | 3300025907 | Bacteria | 3212 |
| 230 | Ga0207643_10002872 | 3300025908 | Bacteria | 9292 |
| 231 | Ga0207705_10100334 | 3300025909 | Bacteria | 2129 |
| 232 | Ga0207705_10122372 | 3300025909 | Bacteria | 1932 |
| 233 | Ga0207705_10173291 | 3300025909 | Bacteria | 1625 |
| 234 | Ga0207684_10195388 | 3300025910 | Bacteria | 1745 |
| 235 | Ga0207654_10307982 | 3300025911 | Bacteria | 1079 |
| 236 | Ga0207707_10001636 | 3300025912 | Bacteria | 20667 |
| 237 | Ga0207707_10011399 | 3300025912 | Bacteria | 7741 |
| 238 | Ga0207707_10044323 | 3300025912 | Bacteria | 3879 |
| 239 | Ga0207707_10044795 | 3300025912 | Bacteria | 3856 |
| 240 | Ga0207707_10095630 | 3300025912 | Bacteria | 2596 |
| 241 | Ga0207707_10134802 | 3300025912 | Bacteria | 2159 |
| 242 | Ga0207707_10508104 | 3300025912 | Bacteria | 1027 |
| 243 | Ga0207695_10063007 | 3300025913 | Bacteria | 3824 |
| 244 | Ga0207695_10145740 | 3300025913 | Bacteria | 2312 |
| 245 | Ga0207695_10149152 | 3300025913 | Bacteria | 2279 |
| 246 | Ga0207695_10184504 | 3300025913 | Bacteria | 2006 |
| 247 | Ga0207695_10263679 | 3300025913 | Bacteria | 1620 |
| 248 | Ga0207695_10430609 | 3300025913 | Bacteria | 1203 |
| 249 | Ga0207693_10014528 | 3300025915 | Bacteria | 6328 |
| 250 | Ga0207693_10024330 | 3300025915 | Bacteria | 4807 |
| 251 | Ga0207693_10088614 | 3300025915 | Bacteria | 2425 |
| 252 | Ga0207693_10451140 | 3300025915 | Bacteria | 1005 |
| 253 | Ga0207663_10026838 | 3300025916 | Bacteria | 3348 |
| 254 | Ga0207660_10025871 | 3300025917 | Bacteria | 3989 |
| 255 | Ga0207660_10090264 | 3300025917 | Bacteria | 2270 |
| 256 | Ga0207660_10143723 | 3300025917 | Bacteria | 1826 |
| 257 | Ga0207660_10311225 | 3300025917 | Bacteria | 1256 |
| 258 | Ga0207662_10184243 | 3300025918 | Bacteria | 1345 |
| 259 | Ga0207657_10000271 | 3300025919 | Bacteria | 55055 |
| 260 | Ga0207657_10001734 | 3300025919 | Bacteria | 23503 |
| 261 | Ga0207657_10002752 | 3300025919 | Bacteria | 18928 |
| 262 | Ga0207657_10005062 | 3300025919 | Bacteria | 13828 |
| 263 | Ga0207657_10017370 | 3300025919 | Bacteria | 6902 |
| 264 | Ga0207657_10020835 | 3300025919 | Bacteria | 6186 |
| 265 | Ga0207657_10352343 | 3300025919 | Bacteria | 1161 |
| 266 | Ga0207649_10015371 | 3300025920 | Bacteria | 4301 |
| 267 | Ga0207649_10016572 | 3300025920 | Bacteria | 4159 |
| 268 | Ga0207649_10030320 | 3300025920 | Bacteria | 3202 |
| 269 | Ga0207649_10044435 | 3300025920 | Bacteria | 2720 |
| 270 | Ga0207652_10126259 | 3300025921 | Bacteria | 2279 |
| 271 | Ga0207652_10175684 | 3300025921 | Bacteria | 1923 |
| 272 | Ga0207652_10268042 | 3300025921 | Bacteria | 1540 |
| 273 | Ga0207652_10463225 | 3300025921 | Bacteria | 1142 |
| 274 | Ga0207681_10019179 | 3300025923 | Bacteria | 4320 |
| 275 | Ga0207659_10136192 | 3300025926 | Bacteria | 1901 |
| 276 | Ga0207687_10052343 | 3300025927 | Bacteria | 2849 |
| 277 | Ga0207700_10365456 | 3300025928 | Bacteria | 1259 |
| 278 | Ga0207700_10463575 | 3300025928 | Bacteria | 1118 |
| 279 | Ga0207664_10038797 | 3300025929 | Bacteria | 3695 |
| 280 | Ga0207664_10095825 | 3300025929 | Bacteria | 2442 |
| 281 | Ga0207664_10138558 | 3300025929 | Bacteria | 2055 |
| 282 | Ga0207664_10216891 | 3300025929 | Bacteria | 1658 |
| 283 | Ga0207664_10244987 | 3300025929 | Bacteria | 1562 |
| 284 | Ga0207664_10271858 | 3300025929 | Bacteria | 1485 |
| 285 | Ga0207664_10526295 | 3300025929 | Bacteria | 1060 |
| 286 | Ga0207644_10177706 | 3300025931 | Bacteria | 1666 |
| 287 | Ga0207690_10024031 | 3300025932 | Bacteria | 3812 |
| 288 | Ga0207690_10079880 | 3300025932 | Bacteria | 2281 |
| 289 | Ga0207690_10261340 | 3300025932 | Bacteria | 1341 |
| 290 | Ga0207706_10084127 | 3300025933 | Bacteria | 2797 |
| 291 | Ga0207709_10282869 | 3300025935 | Bacteria | 1226 |
| 292 | Ga0207709_10302085 | 3300025935 | Bacteria | 1191 |
| 293 | Ga0207670_10149341 | 3300025936 | Bacteria | 1732 |
| 294 | Ga0207669_10199180 | 3300025937 | Bacteria | 1452 |
| 295 | Ga0207704_10003983 | 3300025938 | Bacteria | 6722 |
| 296 | Ga0207665_10024146 | 3300025939 | Bacteria | 4007 |
| 297 | Ga0207665_10216799 | 3300025939 | Bacteria | 1401 |
| 298 | Ga0207691_10010834 | 3300025940 | Bacteria | 8752 |
| 299 | Ga0207691_10528775 | 3300025940 | Bacteria | 1000 |
| 300 | Ga0207711_10120003 | 3300025941 | Bacteria | 2346 |
| 301 | Ga0207689_10021680 | 3300025942 | Bacteria | 5404 |
| 302 | Ga0207661_10009907 | 3300025944 | Bacteria | 6843 |
| 303 | Ga0207661_10014784 | 3300025944 | Bacteria | 5727 |
| 304 | Ga0207661_10115050 | 3300025944 | Bacteria | 2281 |
| 305 | Ga0207661_10164431 | 3300025944 | Bacteria | 1927 |
| 306 | Ga0207661_10200582 | 3300025944 | Bacteria | 1754 |
| 307 | Ga0207667_10057484 | 3300025949 | Bacteria | 4083 |
| 308 | Ga0207667_10210401 | 3300025949 | Bacteria | 1993 |
| 309 | Ga0207667_10242252 | 3300025949 | Bacteria | 1845 |
| 310 | Ga0207667_10339380 | 3300025949 | Bacteria | 1533 |
| 311 | Ga0207667_10448555 | 3300025949 | Bacteria | 1311 |
| 312 | Ga0207667_10614980 | 3300025949 | Bacteria | 1094 |
| 313 | Ga0207668_10035099 | 3300025972 | Bacteria | 3336 |
| 314 | Ga0207640_10237505 | 3300025981 | Bacteria | 1406 |
| 315 | Ga0207658_10009646 | 3300025986 | Bacteria | 6551 |
| 316 | Ga0207677_10030703 | 3300026023 | Bacteria | 3433 |
| 317 | Ga0207703_10038900 | 3300026035 | Bacteria | 3799 |
| 318 | Ga0207639_10031082 | 3300026041 | Bacteria | 3922 |
| 319 | Ga0207639_10065410 | 3300026041 | Bacteria | 2823 |
| 320 | Ga0207639_10447331 | 3300026041 | Bacteria | 1172 |
| 321 | Ga0207678_10015001 | 3300026067 | Bacteria | 6817 |
| 322 | Ga0207708_10003687 | 3300026075 | Bacteria | 11307 |
| 323 | Ga0207708_10450125 | 3300026075 | Bacteria | 1072 |
| 324 | Ga0207702_10154445 | 3300026078 | Bacteria | 2091 |
| 325 | Ga0207702_10293760 | 3300026078 | Bacteria | 1540 |
| 326 | Ga0207702_10732130 | 3300026078 | Bacteria | 976 |
| 327 | Ga0207648_10030986 | 3300026089 | Bacteria | 4730 |
| 328 | Ga0207648_10149662 | 3300026089 | Bacteria | 2059 |
| 329 | Ga0207674_10022473 | 3300026116 | Bacteria | 6771 |
| 330 | Ga0207674_10024377 | 3300026116 | Bacteria | 6467 |
| 331 | Ga0207674_10196098 | 3300026116 | Bacteria | 1969 |
| 332 | Ga0207674_10464996 | 3300026116 | Bacteria | 1223 |
| 333 | Ga0207675_100004518 | 3300026118 | Bacteria | 13433 |
| 334 | Ga0207675_100035672 | 3300026118 | Bacteria | 4639 |
| 335 | Ga0207683_10009815 | 3300026121 | Bacteria | 8166 |
| 336 | Ga0207683_10223055 | 3300026121 | Bacteria | 1718 |
| 337 | Ga0207698_10263142 | 3300026142 | Bacteria | 1585 |
| 338 | Ga0207428_10097151 | 3300027907 | Bacteria | 2280 |
| 339 | Ga0207428_10114120 | 3300027907 | Bacteria | 2076 |
| 340 | Ga0268266_10517075 | 3300028379 | Bacteria | 1141 |
| 341 | Ga0268266_10524144 | 3300028379 | Bacteria | 1133 |
| 342 | Ga0268265_10106544 | 3300028380 | Bacteria | 2277 |
| 343 | Ga0268264_10007521 | 3300028381 | Bacteria | 9088 |
| 344 | Ga0265326_10030950 | 3300028558 | Bacteria | 1524 |
| 345 | Ga0265319_1002729 | 3300028563 | Bacteria | 9477 |
| 346 | Ga0265319_1044882 | 3300028563 | Bacteria | 1479 |
| 347 | Ga0265334_10004197 | 3300028573 | Bacteria | 6438 |
| 348 | Ga0265334_10037521 | 3300028573 | Bacteria | 1910 |
| 349 | Ga0265318_10000570 | 3300028577 | Bacteria | 26016 |
| 350 | Ga0265318_10001892 | 3300028577 | Bacteria | 11740 |
| 351 | Ga0265323_10047803 | 3300028653 | Bacteria | 1529 |
| 352 | Ga0265322_10002018 | 3300028654 | Bacteria | 6393 |
| 353 | Ga0265322_10009415 | 3300028654 | Bacteria | 2836 |
| 354 | Ga0265322_10031037 | 3300028654 | Bacteria | 1525 |
| 355 | Ga0265338_10005891 | 3300028800 | Bacteria | 15808 |
| 356 | Ga0265338_10028608 | 3300028800 | Bacteria | 5552 |
| 357 | Ga0265338_10043440 | 3300028800 | Bacteria | 4168 |
| 358 | Ga0265330_10003326 | 3300031235 | Bacteria | 8448 |
| 359 | Ga0265332_10006789 | 3300031238 | Bacteria | 5187 |
| 360 | Ga0265328_10000690 | 3300031239 | Bacteria | 15667 |
| 361 | Ga0265320_10015968 | 3300031240 | Bacteria | 4223 |
| 362 | Ga0265320_10063252 | 3300031240 | Bacteria | 1760 |
| 363 | Ga0265325_10000453 | 3300031241 | Bacteria | 29634 |
| 364 | Ga0265329_10001864 | 3300031242 | Bacteria | 9979 |
| 365 | Ga0265329_10012351 | 3300031242 | Bacteria | 3070 |
| 366 | Ga0265340_10003414 | 3300031247 | Bacteria | 8970 |
| 367 | Ga0265339_10002745 | 3300031249 | Bacteria | 12498 |
| 368 | Ga0265339_10020249 | 3300031249 | Bacteria | 3889 |
| 369 | Ga0265331_10001679 | 3300031250 | Bacteria | 15998 |
| 370 | Ga0265327_10002344 | 3300031251 | Bacteria | 20191 |
| 371 | Ga0265327_10006936 | 3300031251 | Bacteria | 8902 |
| 372 | Ga0265327_10067616 | 3300031251 | Bacteria | 1799 |
| 373 | Ga0265316_10006037 | 3300031344 | Bacteria | 11637 |
| 374 | Ga0265316_10031157 | 3300031344 | Bacteria | 4364 |
| 375 | Ga0265313_10001477 | 3300031595 | Bacteria | 21902 |
| 376 | Ga0265313_10005561 | 3300031595 | Bacteria | 9235 |
| 377 | Ga0265314_10002833 | 3300031711 | Bacteria | 17262 |
| 378 | Ga0265314_10003450 | 3300031711 | Bacteria | 15282 |
| 379 | Ga0265342_10034556 | 3300031712 | Bacteria | 3101 |
| 380 | Ga0265342_10060700 | 3300031712 | Bacteria | 2229 |
| 381 | Ga0265342_10136462 | 3300031712 | Bacteria | 1371 |
| 382 | Ga0373926_0012162 | 3300035083 | Bacteria | 2907 |
| 383 | Ga0373934_0042816 | 3300035086 | Bacteria | 1789 |
| 384 | Ga0373944_0001755 | 3300035089 | Bacteria | 5480 |
| 385 | Ga0373944_0105752 | 3300035089 | Bacteria | 956 |
| 386 | Ga0373952_0002697 | 3300035092 | Bacteria | 3204 |
| 387 | Ga0373945_0025313 | 3300035116 | Bacteria | 2061 |
| 388 | Ga0373945_0048775 | 3300035116 | Bacteria | 1552 |
| 389 | Ga0373953_0051176 | 3300035117 | Bacteria | 1670 |
| 390 | Ga0373956_0085304 | 3300035119 | Bacteria | 1452 |
| 391 | Ga0373957_0124647 | 3300035120 | Bacteria | 1045 |
| 392 | Ga0373943_0001033 | 3300035170 | Bacteria | 12361 |
| 393 | Ga0373943_0002122 | 3300035170 | Bacteria | 9012 |
| 394 | Ga0373946_0070460 | 3300035171 | Bacteria | 1509 |
| 395 | Ga0373955_0067135 | 3300035172 | Bacteria | 1996 |
| 396 | Ga0373955_0168422 | 3300035172 | Bacteria | 1296 |
| 397 | Ga0373962_0008242 | 3300035242 | Bacteria | 2562 |
| 398 | Ga0373924_0192642 | 3300035410 | Bacteria | 898 |
| 399 | Ga0373931_0053899 | 3300035691 | Bacteria | 2147 |
| 400 | Ga0373927_0017671 | 3300035695 | Bacteria | 4692 |
| 401 | Ga0373927_0221146 | 3300035695 | Bacteria | 1244 |
| 402 | Ga0373933_0097499 | 3300035724 | Bacteria | 1821 |
| 403 | Ga0373933_0133925 | 3300035724 | Bacteria | 1560 |
| 404 | Ga0373947_0001683 | 3300035725 | Bacteria | 13546 |
| 405 | Ga0373947_0005400 | 3300035725 | Bacteria | 7459 |
| 406 | Ga0373947_0211455 | 3300035725 | Bacteria | 1272 |
| 407 | Ga0373937_0001274 | 3300036401 | Bacteria | 21107 |
| 408 | Ga0373937_0284025 | 3300036401 | Bacteria | 1563 |
| 409 | Ga0373925_0009985 | 3300037068 | Bacteria | 6893 |
| 410 | Ga0373925_0111666 | 3300037068 | Bacteria | 2112 |
| 411 | Ga0373925_0133115 | 3300037068 | Bacteria | 1940 |
| 412 | Ga0395899_0047358 | 3300037312 | Bacteria | 3201 |
| 413 | Ga0395898_0029889 | 3300037466 | Bacteria | 5454 |
| 414 | Ga0395898_0157653 | 3300037466 | Bacteria | 2171 |
| 415 | Ga0395898_0209163 | 3300037466 | Bacteria | 1861 |
| 416 | Ga0395898_0982572 | 3300037466 | Bacteria | 780 |
| 417 | Ga0395905_0025097 | 3300037471 | Bacteria | 5622 |
| 418 | Ga0395901_0006460 | 3300038443 | Bacteria | 11876 |
| 419 | Ga0395901_0015268 | 3300038443 | Bacteria | 7813 |
| 420 | Ga0395901_0184831 | 3300038443 | Bacteria | 2186 |
| 421 | Ga0395901_0196184 | 3300038443 | Bacteria | 2117 |
| 422 | Ga0395901_0405034 | 3300038443 | Bacteria | 1401 |
| 423 | Ga0436365_0068224 | 3300039437 | Bacteria | 935 |
| 424 | Ga0436363_1206340 | 3300039450 | Bacteria | 1616 |
| 425 | Ga0466969_0132451 | 3300044656 | Bacteria | 1155 |
| 426 | Ga0466969_0272829 | 3300044656 | Bacteria | 766 |
| 427 | Ga0466965_0012162 | 3300044683 | Bacteria | 4044 |
| 428 | Ga0466965_0295187 | 3300044683 | Bacteria | 878 |
| 429 | Ga0466966_0028861 | 3300044684 | Bacteria | 3612 |
| 430 | Ga0466966_0042861 | 3300044684 | Bacteria | 2902 |
| 431 | Ga0466966_0044670 | 3300044684 | Bacteria | 2836 |
| 432 | Ga0466966_0050280 | 3300044684 | Bacteria | 2652 |
| 433 | Ga0466966_0284648 | 3300044684 | Bacteria | 994 |
| 434 | Ga0466961_0003803 | 3300044693 | Bacteria | 9443 |
| 435 | Ga0466961_0004938 | 3300044693 | Bacteria | 8384 |
| 436 | Ga0466961_0021773 | 3300044693 | Bacteria | 4124 |
| 437 | Ga0466961_0023452 | 3300044693 | Bacteria | 3970 |
| 438 | Ga0466961_0051399 | 3300044693 | Bacteria | 2632 |
| 439 | Ga0466963_0000386 | 3300044694 | Bacteria | 20129 |
| 440 | Ga0466963_0001586 | 3300044694 | Bacteria | 12353 |
| 441 | Ga0466963_0003789 | 3300044694 | Bacteria | 8712 |
| 442 | Ga0466963_0008766 | 3300044694 | Bacteria | 6073 |
| 443 | Ga0466963_0009223 | 3300044694 | Bacteria | 5939 |
| 444 | Ga0466963_0010840 | 3300044694 | Bacteria | 5534 |
| 445 | Ga0466963_0011354 | 3300044694 | Bacteria | 5421 |
| 446 | Ga0466963_0028857 | 3300044694 | Bacteria | 3566 |
| 447 | Ga0466963_0036072 | 3300044694 | Bacteria | 3223 |
| 448 | Ga0466963_0042897 | 3300044694 | Bacteria | 2971 |
| 449 | Ga0466963_0090113 | 3300044694 | Bacteria | 2087 |
| 450 | Ga0466963_0095672 | 3300044694 | Bacteria | 2028 |
| 451 | Ga0466963_0112729 | 3300044694 | Bacteria | 1867 |
| 452 | Ga0466963_0128222 | 3300044694 | Bacteria | 1750 |
| 453 | Ga0466963_0152071 | 3300044694 | Bacteria | 1607 |
| 454 | Ga0466963_0219144 | 3300044694 | Bacteria | 1332 |
| 455 | Ga0466963_0239214 | 3300044694 | Bacteria | 1273 |
| 456 | Ga0466964_0004340 | 3300044706 | Bacteria | 5226 |
| 457 | Ga0466964_0009162 | 3300044706 | Bacteria | 3723 |
| 458 | Ga0466964_0144251 | 3300044706 | Bacteria | 1097 |
| 459 | Ga0466964_0279072 | 3300044706 | Bacteria | 834 |
| 460 | Ga0466971_0000690 | 3300044719 | Bacteria | 13513 |
| 461 | Ga0466971_0006293 | 3300044719 | Bacteria | 5155 |
| 462 | Ga0466971_0050550 | 3300044719 | Bacteria | 1871 |
| 463 | Ga0466968_0002055 | 3300044735 | Bacteria | 7326 |
| 464 | Ga0466968_0002787 | 3300044735 | Bacteria | 6456 |
| 465 | Ga0466968_0185564 | 3300044735 | Bacteria | 969 |
| 466 | Ga0466970_0093845 | 3300044765 | Bacteria | 1630 |
| 467 | Ga0466957_0005175 | 3300044842 | Bacteria | 7296 |
| 468 | Ga0466957_0005266 | 3300044842 | Bacteria | 7245 |
| 469 | Ga0466957_0009625 | 3300044842 | Bacteria | 5519 |
| 470 | Ga0466957_0013777 | 3300044842 | Bacteria | 4697 |
| 471 | Ga0466957_0095829 | 3300044842 | Bacteria | 1864 |
| 472 | Ga0466957_0099007 | 3300044842 | Bacteria | 1835 |
| 473 | Ga0466957_0254132 | 3300044842 | Bacteria | 1169 |
| 474 | Ga0466957_0263917 | 3300044842 | Bacteria | 1148 |
| 475 | Ga0466957_0295910 | 3300044842 | Bacteria | 1086 |
| 476 | Ga0466960_0003135 | 3300044901 | Bacteria | 6339 |
| 477 | Ga0466960_0015980 | 3300044901 | Bacteria | 3246 |
| 478 | Ga0466960_0043635 | 3300044901 | Bacteria | 2134 |
| 479 | Ga0466959_0000924 | 3300045049 | Bacteria | 17433 |
| 480 | Ga0466959_0003221 | 3300045049 | Bacteria | 10615 |
| 481 | Ga0466959_0023689 | 3300045049 | Bacteria | 4544 |
| 482 | Ga0466959_0035001 | 3300045049 | Bacteria | 3714 |
| 483 | Ga0466959_0345300 | 3300045049 | Bacteria | 1015 |
| 484 | Ga0451576_0309275 | 3300045051 | Bacteria | 1653 |
| 485 | Ga0466958_0002392 | 3300045836 | Bacteria | 9393 |
| 486 | Ga0466958_0007133 | 3300045836 | Bacteria | 6124 |
| 487 | Ga0466958_0087943 | 3300045836 | Bacteria | 1919 |
| 488 | Ga0466958_0106210 | 3300045836 | Bacteria | 1750 |
| 489 | Ga0466958_0119313 | 3300045836 | Bacteria | 1650 |
| 490 | Ga0466958_0178710 | 3300045836 | Bacteria | 1346 |
| 491 | Ga0466958_0358612 | 3300045836 | Bacteria | 939 |
| 492 | Ga0466958_0477888 | 3300045836 | Bacteria | 808 |
| 493 | Ga0466967_0000782 | 3300045976 | Bacteria | 16553 |
| 494 | Ga0466967_0002172 | 3300045976 | Bacteria | 12055 |
| 495 | Ga0466967_0002211 | 3300045976 | Bacteria | 11962 |
| 496 | Ga0466967_0005420 | 3300045976 | Bacteria | 8839 |
| 497 | Ga0466967_0005428 | 3300045976 | Bacteria | 8835 |
| 498 | Ga0466967_0005681 | 3300045976 | Bacteria | 8694 |
| 499 | Ga0466967_0005922 | 3300045976 | Bacteria | 8572 |
| 500 | Ga0466967_0006778 | 3300045976 | Bacteria | 8159 |
| 501 | Ga0466967_0008193 | 3300045976 | Bacteria | 7632 |
| 502 | Ga0466967_0020684 | 3300045976 | Bacteria | 5326 |
| 503 | Ga0466967_0027074 | 3300045976 | Bacteria | 4763 |
| 504 | Ga0466967_0050672 | 3300045976 | Bacteria | 3636 |
| 505 | Ga0466967_0053792 | 3300045976 | Bacteria | 3540 |
| 506 | Ga0466967_0057201 | 3300045976 | Bacteria | 3442 |
| 507 | Ga0466967_0064066 | 3300045976 | Bacteria | 3268 |
| 508 | Ga0466967_0072798 | 3300045976 | Bacteria | 3081 |
| 509 | Ga0466967_0084476 | 3300045976 | Bacteria | 2872 |
| 510 | Ga0466967_0111558 | 3300045976 | Bacteria | 2513 |
| 511 | Ga0466967_0113424 | 3300045976 | Bacteria | 2493 |
| 512 | Ga0466967_0127570 | 3300045976 | Bacteria | 2358 |
| 513 | Ga0466967_0173945 | 3300045976 | Bacteria | 2027 |
| 514 | Ga0466967_0244431 | 3300045976 | Bacteria | 1712 |
| 515 | Ga0466967_0331339 | 3300045976 | Bacteria | 1470 |
| 516 | Ga0466967_0511512 | 3300045976 | Bacteria | 1179 |
| 517 | Ga0495592_0000065 | 3300046454 | Bacteria | 95955 |
| 518 | Ga0495592_0001368 | 3300046454 | Bacteria | 16849 |
| 519 | Ga0495592_0010312 | 3300046454 | Bacteria | 7043 |
| 520 | Ga0495592_0243615 | 3300046454 | Bacteria | 1192 |
| 521 | Ga0495592_0249739 | 3300046454 | Bacteria | 1173 |
| 522 | Ga0495603_0004591 | 3300046455 | Bacteria | 8239 |
| 523 | Ga0495603_0038289 | 3300046455 | Bacteria | 2876 |
| 524 | Ga0495603_0045522 | 3300046455 | Bacteria | 2617 |
| 525 | Ga0495629_0000322 | 3300046459 | Bacteria | 41005 |
| 526 | Ga0495629_0024135 | 3300046459 | Bacteria | 4330 |
| 527 | Ga0495629_0024136 | 3300046459 | Bacteria | 4330 |
| 528 | Ga0495629_0038177 | 3300046459 | Bacteria | 3384 |
| 529 | Ga0495629_0187087 | 3300046459 | Bacteria | 1434 |
| 530 | Ga0495641_0000172 | 3300046461 | Bacteria | 48876 |
| 531 | Ga0495641_0005111 | 3300046461 | Bacteria | 8991 |
| 532 | Ga0495641_0109949 | 3300046461 | Bacteria | 1230 |
| 533 | Ga0495641_0156400 | 3300046461 | Bacteria | 1019 |
| 534 | Ga0495651_0000001 | 3300046462 | Bacteria | 210544 |
| 535 | Ga0495651_0004373 | 3300046462 | Bacteria | 10817 |
| 536 | Ga0495651_0011256 | 3300046462 | Bacteria | 6875 |
| 537 | Ga0495651_0025488 | 3300046462 | Bacteria | 4602 |
| 538 | Ga0495651_0136947 | 3300046462 | Bacteria | 1780 |
| 539 | Ga0495651_0257717 | 3300046462 | Bacteria | 1188 |
| 540 | Ga0495653_0024383 | 3300046463 | Bacteria | 4876 |
| 541 | Ga0495653_0043824 | 3300046463 | Bacteria | 3475 |
| 542 | Ga0495653_0046246 | 3300046463 | Bacteria | 3371 |
| 543 | Ga0495653_0108117 | 3300046463 | Bacteria | 2003 |
| 544 | Ga0495653_0163880 | 3300046463 | Bacteria | 1541 |
| 545 | Ga0495582_0000293 | 3300046473 | Bacteria | 27593 |
| 546 | Ga0495582_0003471 | 3300046473 | Bacteria | 8882 |
| 547 | Ga0495582_0074870 | 3300046473 | Bacteria | 1875 |
| 548 | Ga0495582_0107766 | 3300046473 | Bacteria | 1564 |
| 549 | Ga0495582_0161332 | 3300046473 | Bacteria | 1275 |
| 550 | Ga0495582_0218817 | 3300046473 | Bacteria | 1089 |
| 551 | Ga0495639_0000669 | 3300046475 | Bacteria | 15781 |
| 552 | Ga0495639_0023241 | 3300046475 | Bacteria | 2723 |
| 553 | Ga0495662_0003584 | 3300046476 | Bacteria | 7843 |
| 554 | Ga0495662_0008222 | 3300046476 | Bacteria | 5139 |
| 555 | Ga0495664_0040693 | 3300046477 | Bacteria | 2749 |
| 556 | Ga0495664_0137089 | 3300046477 | Bacteria | 1483 |
| 557 | Ga0495664_0154896 | 3300046477 | Bacteria | 1390 |
| 558 | Ga0495664_0342632 | 3300046477 | Bacteria | 900 |
| 559 | Ga0495584_0134042 | 3300046491 | Bacteria | 1257 |
| 560 | Ga0495594_0182594 | 3300046499 | Bacteria | 1194 |
| 561 | Ga0495594_0219265 | 3300046499 | Bacteria | 1085 |
| 562 | Ga0495596_0119794 | 3300046500 | Bacteria | 1022 |
| 563 | Ga0495608_0006151 | 3300046511 | Bacteria | 8521 |
| 564 | Ga0495608_0018767 | 3300046511 | Bacteria | 4765 |
| 565 | Ga0495608_0123634 | 3300046511 | Bacteria | 1658 |
| 566 | Ga0495608_0305549 | 3300046511 | Bacteria | 984 |
| 567 | Ga0495618_0003562 | 3300046514 | Bacteria | 9648 |
| 568 | Ga0495618_0022003 | 3300046514 | Bacteria | 3935 |
| 569 | Ga0495618_0070781 | 3300046514 | Bacteria | 2218 |
| 570 | Ga0495618_0131446 | 3300046514 | Bacteria | 1602 |
| 571 | Ga0495618_0324686 | 3300046514 | Bacteria | 953 |
| 572 | Ga0495618_0479234 | 3300046514 | Bacteria | 752 |
| 573 | Ga0495628_0000500 | 3300046516 | Bacteria | 35932 |
| 574 | Ga0495628_0003524 | 3300046516 | Bacteria | 14008 |
| 575 | Ga0495628_0118438 | 3300046516 | Bacteria | 2033 |
| 576 | Ga0495628_0171047 | 3300046516 | Bacteria | 1647 |
| 577 | Ga0495628_0568845 | 3300046516 | Bacteria | 812 |
| 578 | Ga0495630_0004985 | 3300046517 | Bacteria | 9340 |
| 579 | Ga0495630_0048995 | 3300046517 | Bacteria | 3162 |
| 580 | Ga0495630_0099856 | 3300046517 | Bacteria | 2195 |
| 581 | Ga0495630_0131430 | 3300046517 | Bacteria | 1901 |
| 582 | Ga0495644_0026499 | 3300046523 | Bacteria | 2199 |
| 583 | Ga0495666_0011729 | 3300046526 | Bacteria | 4369 |
| 584 | Ga0495652_0000015 | 3300046529 | Bacteria | 222624 |
| 585 | Ga0495652_0021734 | 3300046529 | Bacteria | 5704 |
| 586 | Ga0495652_0038388 | 3300046529 | Bacteria | 4150 |
| 587 | Ga0495652_0038786 | 3300046529 | Bacteria | 4124 |
| 588 | Ga0495652_0047605 | 3300046529 | Bacteria | 3676 |
| 589 | Ga0495652_0094633 | 3300046529 | Bacteria | 2436 |
| 590 | Ga0495652_0143928 | 3300046529 | Bacteria | 1871 |
| 591 | Ga0495652_0494859 | 3300046529 | Bacteria | 849 |
| 592 | Ga0495665_0001010 | 3300046531 | Bacteria | 14892 |
| 593 | Ga0495665_0003453 | 3300046531 | Bacteria | 8579 |
| 594 | Ga0495640_0022647 | 3300046533 | Bacteria | 4588 |
| 595 | Ga0495640_0033650 | 3300046533 | Bacteria | 3640 |
| 596 | Ga0495640_0067976 | 3300046533 | Bacteria | 2399 |
| 597 | Ga0495640_0208962 | 3300046533 | Bacteria | 1235 |
| 598 | Ga0495640_0331119 | 3300046533 | Bacteria | 942 |
| 599 | Ga0495586_0043847 | 3300046535 | Bacteria | 2408 |
| 600 | Ga0495587_0000036 | 3300046536 | Bacteria | 117570 |
| 601 | Ga0495587_0047561 | 3300046536 | Bacteria | 2543 |
| 602 | Ga0495645_0000039 | 3300046543 | Bacteria | 94569 |
| 603 | Ga0495645_0001725 | 3300046543 | Bacteria | 14834 |
| 604 | Ga0495645_0077445 | 3300046543 | Bacteria | 2391 |
| 605 | Ga0495645_0077840 | 3300046543 | Bacteria | 2384 |
| 606 | Ga0495645_0105087 | 3300046543 | Bacteria | 2004 |
| 607 | Ga0495667_0022009 | 3300046559 | Bacteria | 4298 |
| 608 | Ga0495667_0037899 | 3300046559 | Bacteria | 3211 |
| 609 | Ga0495667_0039586 | 3300046559 | Bacteria | 3134 |
| 610 | Ga0495667_0065085 | 3300046559 | Bacteria | 2385 |
| 611 | Ga0495667_0141311 | 3300046559 | Bacteria | 1551 |
| 612 | Ga0495656_0063715 | 3300046615 | Bacteria | 1617 |
| 613 | Ga0495656_0089822 | 3300046615 | Bacteria | 1403 |
| 614 | Ga0495634_0087264 | 3300046642 | Bacteria | 2030 |
| 615 | Ga0495635_0009181 | 3300046663 | Bacteria | 6905 |
| 616 | Ga0495635_0034317 | 3300046663 | Bacteria | 3519 |
| 617 | Ga0495635_0053920 | 3300046663 | Bacteria | 2769 |
| 618 | Ga0495635_0202884 | 3300046663 | Bacteria | 1344 |
| 619 | Ga0495635_0503316 | 3300046663 | Bacteria | 797 |
| 620 | Ga0495588_0107354 | 3300046674 | Bacteria | 1470 |
| 621 | Ga0495657_0005022 | 3300046675 | Bacteria | 10511 |
| 622 | Ga0495657_0013431 | 3300046675 | Bacteria | 6045 |
| 623 | Ga0495657_0243294 | 3300046675 | Bacteria | 1085 |
| 624 | Ga0495657_0285011 | 3300046675 | Bacteria | 988 |
| 625 | Ga0495657_0401695 | 3300046675 | Bacteria | 806 |
| 626 | Ga0495599_0000055 | 3300046678 | Bacteria | 79065 |
| 627 | Ga0495599_0101722 | 3300046678 | Bacteria | 1791 |
| 628 | Ga0495599_0105205 | 3300046678 | Bacteria | 1758 |
| 629 | Ga0495599_0130598 | 3300046678 | Bacteria | 1560 |
| 630 | Ga0495623_0000445 | 3300046679 | Bacteria | 27187 |
| 631 | Ga0495623_0049196 | 3300046679 | Bacteria | 2672 |
| 632 | Ga0495646_0003435 | 3300046680 | Bacteria | 9851 |
| 633 | Ga0495647_0000798 | 3300046681 | Bacteria | 9404 |
| 634 | Ga0495647_0011432 | 3300046681 | Bacteria | 3042 |
| 635 | Ga0495647_0018748 | 3300046681 | Bacteria | 2468 |
| 636 | Ga0495647_0103539 | 3300046681 | Bacteria | 1181 |
| 637 | Ga0495658_0000583 | 3300046683 | Bacteria | 19945 |
| 638 | Ga0495658_0002666 | 3300046683 | Bacteria | 8977 |
| 639 | Ga0495613_0002165 | 3300046689 | Bacteria | 14898 |
| 640 | Ga0495613_0033229 | 3300046689 | Bacteria | 3833 |
| 641 | Ga0495613_0048163 | 3300046689 | Bacteria | 3147 |
| 642 | Ga0495613_0088388 | 3300046689 | Bacteria | 2245 |
| 643 | Ga0495613_0384893 | 3300046689 | Bacteria | 959 |
| 644 | Ga0495624_0004502 | 3300046690 | Bacteria | 10193 |
| 645 | Ga0495624_0006697 | 3300046690 | Bacteria | 8141 |
| 646 | Ga0495624_0295395 | 3300046690 | Bacteria | 977 |
| 647 | Ga0495600_0083608 | 3300046809 | Bacteria | 2083 |
| 648 | Ga0495600_0135843 | 3300046809 | Bacteria | 1598 |
| 649 | Ga0495600_0212188 | 3300046809 | Bacteria | 1240 |
| 650 | Ga0495581_0001529 | 3300047315 | Bacteria | 12888 |
| 651 | Ga0495581_0003549 | 3300047315 | Bacteria | 8955 |
| 652 | Ga0495581_0368938 | 3300047315 | Bacteria | 838 |
| 653 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 654 | Ga0495604_0007706 | 3300047317 | Bacteria | 8530 |
| 655 | Ga0495604_0170373 | 3300047317 | Bacteria | 1532 |
| 656 | Ga0495604_0228635 | 3300047317 | Bacteria | 1277 |
| 657 | Ga0495674_0005899 | 3300047319 | Bacteria | 11749 |
| 658 | Ga0495674_0044726 | 3300047319 | Bacteria | 3934 |
| 659 | Ga0495674_0087851 | 3300047319 | Bacteria | 2660 |
| 660 | Ga0495674_0115104 | 3300047319 | Bacteria | 2276 |
| 661 | Ga0495674_0184659 | 3300047319 | Bacteria | 1735 |
| 662 | Ga0495676_0025869 | 3300047321 | Bacteria | 5058 |
| 663 | Ga0495676_0063270 | 3300047321 | Bacteria | 2884 |
| 664 | Ga0495676_0218632 | 3300047321 | Bacteria | 1314 |
| 665 | Ga0495676_0323947 | 3300047321 | Bacteria | 1035 |
| 666 | Ga0495676_0379993 | 3300047321 | Bacteria | 940 |
| 667 | Ga0495680_0003870 | 3300047322 | Bacteria | 14479 |
| 668 | Ga0495680_0007676 | 3300047322 | Bacteria | 9850 |
| 669 | Ga0495680_0023590 | 3300047322 | Bacteria | 5113 |
| 670 | Ga0495680_0042385 | 3300047322 | Bacteria | 3612 |
| 671 | Ga0495680_0048810 | 3300047322 | Bacteria | 3322 |
| 672 | Ga0495675_0003350 | 3300047444 | Bacteria | 9647 |
| 673 | Ga0495684_0002259 | 3300047471 | Bacteria | 15438 |
| 674 | Ga0495684_0012400 | 3300047471 | Bacteria | 6572 |
| 675 | Ga0495684_0108412 | 3300047471 | Bacteria | 2097 |
| 676 | Ga0495684_0249458 | 3300047471 | Bacteria | 1292 |
| 677 | Ga0495593_0003569 | 3300047673 | Bacteria | 9299 |
| 678 | Ga0495593_0038928 | 3300047673 | Bacteria | 2566 |
| 679 | Ga0495602_0000235 | 3300048088 | Bacteria | 51786 |
| 680 | Ga0495602_0030125 | 3300048088 | Bacteria | 5153 |
| 681 | Ga0495614_0000112 | 3300048089 | Bacteria | 27892 |
| 682 | Ga0495614_0006376 | 3300048089 | Bacteria | 5297 |
| 683 | Ga0496100_0001948 | 3300048903 | Bacteria | 10329 |
| 684 | Ga0496100_0025874 | 3300048903 | Bacteria | 3591 |
| 685 | Ga0496100_0151390 | 3300048903 | Bacteria | 1655 |
| 686 | Ga0496101_0005006 | 3300048904 | Bacteria | 8416 |
| 687 | Ga0496101_0009733 | 3300048904 | Bacteria | 6327 |
| 688 | Ga0496101_0161332 | 3300048904 | Bacteria | 1719 |
| 689 | Ga0496101_0209573 | 3300048904 | Bacteria | 1509 |
| 690 | Ga0496101_0214568 | 3300048904 | Bacteria | 1492 |
| 691 | Ga0496102_0001373 | 3300048905 | Bacteria | 21702 |
| 692 | Ga0496102_0015470 | 3300048905 | Bacteria | 6646 |
| 693 | Ga0496102_0040328 | 3300048905 | Bacteria | 4223 |
| 694 | Ga0496102_0046162 | 3300048905 | Bacteria | 3956 |
| 695 | Ga0496102_0541151 | 3300048905 | Bacteria | 1087 |
| 696 | Ga0496103_0048792 | 3300048906 | Bacteria | 2617 |
| 697 | Ga0496104_0013970 | 3300048907 | Bacteria | 7243 |
| 698 | Ga0496104_0067803 | 3300048907 | Bacteria | 3390 |
| 699 | Ga0496104_0079160 | 3300048907 | Bacteria | 3132 |
| 700 | Ga0496104_0092659 | 3300048907 | Bacteria | 2889 |
| 701 | Ga0496104_0107997 | 3300048907 | Bacteria | 2666 |
| 702 | Ga0496104_0164531 | 3300048907 | Bacteria | 2127 |
| 703 | Ga0496104_0212757 | 3300048907 | Bacteria | 1845 |
| 704 | Ga0496105_0000466 | 3300048908 | Bacteria | 26582 |
| 705 | Ga0496105_0219119 | 3300048908 | Bacteria | 1549 |
| 706 | Ga0496105_0322980 | 3300048908 | Bacteria | 1237 |
| 707 | Ga0496106_0030085 | 3300048909 | Bacteria | 4049 |
| 708 | Ga0496106_0036904 | 3300048909 | Bacteria | 3655 |
| 709 | Ga0496106_0323243 | 3300048909 | Bacteria | 1238 |
| 710 | Ga0496107_0010989 | 3300048910 | Bacteria | 6300 |
| 711 | Ga0496107_0131590 | 3300048910 | Bacteria | 1847 |
| 712 | Ga0496107_0422914 | 3300048910 | Bacteria | 990 |
| 713 | Ga0496108_0003292 | 3300048911 | Bacteria | 12976 |
| 714 | Ga0496108_0033318 | 3300048911 | Bacteria | 4280 |
| 715 | Ga0496108_0062374 | 3300048911 | Bacteria | 3138 |
| 716 | Ga0496109_0000847 | 3300048912 | Bacteria | 25593 |
| 717 | Ga0496109_0003458 | 3300048912 | Bacteria | 13189 |
| 718 | Ga0496109_0209747 | 3300048912 | Bacteria | 1832 |
| 719 | Ga0496109_0224354 | 3300048912 | Bacteria | 1767 |
| 720 | Ga0496109_0307101 | 3300048912 | Bacteria | 1496 |
| 721 | Ga0496109_0393659 | 3300048912 | Bacteria | 1309 |
| 722 | Ga0496109_0440467 | 3300048912 | Bacteria | 1231 |
| 723 | Ga0496110_0006627 | 3300048913 | Bacteria | 9198 |
| 724 | Ga0496110_0014631 | 3300048913 | Bacteria | 6519 |
| 725 | Ga0496110_0231839 | 3300048913 | Bacteria | 1679 |
| 726 | Ga0496110_0324756 | 3300048913 | Bacteria | 1402 |
| 727 | Ga0496110_0786005 | 3300048913 | Bacteria | 856 |
| 728 | Ga0496111_0034239 | 3300048914 | Bacteria | 3626 |
| 729 | Ga0496111_0134370 | 3300048914 | Bacteria | 1832 |
| 730 | Ga0496112_0013740 | 3300048915 | Bacteria | 7486 |
| 731 | Ga0496112_0021043 | 3300048915 | Bacteria | 6195 |
| 732 | Ga0496112_0023688 | 3300048915 | Bacteria | 5872 |
| 733 | Ga0496112_0045113 | 3300048915 | Bacteria | 4321 |
| 734 | Ga0496112_0202585 | 3300048915 | Bacteria | 1943 |
| 735 | Ga0496112_0274062 | 3300048915 | Bacteria | 1635 |
| 736 | Ga0496112_0334136 | 3300048915 | Bacteria | 1459 |
| 737 | Ga0496112_0394183 | 3300048915 | Bacteria | 1325 |
| 738 | Ga0496112_0481350 | 3300048915 | Bacteria | 1178 |
| 739 | Ga0496112_0493192 | 3300048915 | Bacteria | 1161 |
| 740 | Ga0496112_0511235 | 3300048915 | Bacteria | 1136 |
| 741 | Ga0496112_0780653 | 3300048915 | Bacteria | 881 |
| 742 | Ga0496113_0013027 | 3300048916 | Bacteria | 5613 |
| 743 | Ga0496113_0026491 | 3300048916 | Bacteria | 4146 |
| 744 | Ga0496114_0000954 | 3300048917 | Bacteria | 21635 |
| 745 | Ga0496114_0093554 | 3300048917 | Bacteria | 2556 |
| 746 | Ga0496114_0107097 | 3300048917 | Bacteria | 2392 |
| 747 | Ga0496114_0131223 | 3300048917 | Bacteria | 2164 |
| 748 | Ga0496114_0290218 | 3300048917 | Bacteria | 1443 |
| 749 | Ga0496114_0470116 | 3300048917 | Bacteria | 1113 |
| 750 | Ga0496115_0001782 | 3300048918 | Bacteria | 15400 |
| 751 | Ga0496115_0009857 | 3300048918 | Bacteria | 7114 |
| 752 | Ga0496115_0034878 | 3300048918 | Bacteria | 3977 |
| 753 | Ga0496115_0076116 | 3300048918 | Bacteria | 2727 |
| 754 | Ga0496115_0142276 | 3300048918 | Bacteria | 1979 |
| 755 | Ga0496115_0276077 | 3300048918 | Bacteria | 1380 |
| 756 | Ga0496115_0283334 | 3300048918 | Bacteria | 1360 |
| 757 | Ga0501031_0102490 | 3300049568 | Bacteria | 1867 |
| 758 | Ga0501031_0416723 | 3300049568 | Bacteria | 868 |
| 759 | Ga0501033_0084016 | 3300049570 | Bacteria | 2333 |
| 760 | Ga0501036_0014510 | 3300049572 | Bacteria | 6563 |
| 761 | Ga0501036_0202325 | 3300049572 | Bacteria | 1670 |
| 762 | Ga0501036_0485296 | 3300049572 | Bacteria | 1029 |
| 763 | Ga0501037_0265404 | 3300049573 | Bacteria | 1199 |
| 764 | Ga0501038_0202901 | 3300049574 | Bacteria | 1590 |
| 765 | Ga0501038_0242904 | 3300049574 | Bacteria | 1429 |
| 766 | Ga0501039_0029802 | 3300049575 | Bacteria | 4204 |
| 767 | Ga0501039_0036544 | 3300049575 | Bacteria | 3791 |
| 768 | Ga0501039_0289134 | 3300049575 | Bacteria | 1289 |
| 769 | Ga0501040_0011605 | 3300049576 | Bacteria | 5767 |
| 770 | Ga0501040_0147603 | 3300049576 | Bacteria | 1658 |
| 771 | Ga0501041_0096998 | 3300049577 | Bacteria | 1822 |
| 772 | Ga0501042_0035512 | 3300049578 | Bacteria | 3536 |
| 773 | Ga0501042_0058438 | 3300049578 | Bacteria | 2753 |
| 774 | Ga0501042_0088240 | 3300049578 | Bacteria | 2225 |
| 775 | Ga0501043_0019136 | 3300049579 | Bacteria | 5375 |
| 776 | Ga0501043_0185839 | 3300049579 | Bacteria | 1618 |
| 777 | Ga0501046_0068016 | 3300049580 | Bacteria | 2773 |
| 778 | Ga0501046_0111194 | 3300049580 | Bacteria | 2093 |
| 779 | Ga0501048_0010135 | 3300049582 | Bacteria | 7049 |
| 780 | Ga0501048_0128340 | 3300049582 | Bacteria | 1793 |
| 781 | Ga0501067_0091787 | 3300049583 | Bacteria | 1686 |
| 782 | Ga0501067_0108696 | 3300049583 | Bacteria | 1542 |
| 783 | Ga0501068_0023711 | 3300049584 | Bacteria | 3598 |
| 784 | Ga0501070_0008954 | 3300049586 | Bacteria | 8465 |
| 785 | Ga0501070_0213100 | 3300049586 | Bacteria | 1585 |
| 786 | Ga0501070_0422321 | 3300049586 | Bacteria | 1077 |
| 787 | Ga0501071_0005185 | 3300049587 | Bacteria | 8346 |
| 788 | Ga0501071_0037245 | 3300049587 | Bacteria | 3472 |
| 789 | Ga0501071_0076105 | 3300049587 | Bacteria | 2451 |
| 790 | Ga0501072_0000889 | 3300049588 | Bacteria | 21919 |
| 791 | Ga0501072_0053299 | 3300049588 | Bacteria | 3185 |
| 792 | Ga0501072_0099956 | 3300049588 | Bacteria | 2306 |
| 793 | Ga0501073_0420943 | 3300049589 | Bacteria | 923 |
| 794 | Ga0501074_0008848 | 3300049590 | Bacteria | 7297 |
| 795 | Ga0501075_0001771 | 3300049591 | Bacteria | 14199 |
| 796 | Ga0501075_0057044 | 3300049591 | Bacteria | 2940 |
| 797 | Ga0501075_0166704 | 3300049591 | Bacteria | 1681 |
| 798 | Ga0501076_0003983 | 3300049592 | Bacteria | 10429 |
| 799 | Ga0501076_0006412 | 3300049592 | Bacteria | 8529 |
| 800 | Ga0501077_0091764 | 3300049593 | Bacteria | 1924 |
| 801 | Ga0501077_0427935 | 3300049593 | Bacteria | 847 |
| 802 | Ga0501079_0005185 | 3300049741 | Bacteria | 9688 |
| 803 | Ga0501079_0041241 | 3300049741 | Bacteria | 3562 |
| 804 | Ga0501079_0193170 | 3300049741 | Bacteria | 1589 |
| 805 | Ga0501080_0032087 | 3300049742 | Bacteria | 4897 |
| 806 | Ga0501080_0034173 | 3300049742 | Bacteria | 4745 |
| 807 | Ga0501080_0171923 | 3300049742 | Bacteria | 1998 |
| 808 | Ga0501080_0183279 | 3300049742 | Bacteria | 1926 |
| 809 | Ga0501081_0101707 | 3300049743 | Bacteria | 2032 |
| 810 | Ga0501081_0156939 | 3300049743 | Bacteria | 1637 |
| 811 | Ga0501035_0427200 | 3300049822 | Bacteria | 1099 |
| 812 | Ga0501044_0152238 | 3300049823 | Bacteria | 2295 |
| 813 | Ga0501045_0002284 | 3300049824 | Bacteria | 12987 |
| 814 | Ga0501045_0016561 | 3300049824 | Bacteria | 5238 |
| 815 | nmdc:mga08y16_182190_c1 | 3300050511 | Bacteria | 2181 |
| 816 | nmdc:mga08y16_322800_c1 | 3300050511 | Bacteria | 1589 |
| 817 | nmdc:mga08y16_96632_c1 | 3300050511 | Bacteria | 3076 |
| 818 | nmdc:mga0n895_1855_c1 | 3300050512 | Bacteria | 16124 |
| 819 | nmdc:mga0rr50_576016_c1 | 3300050513 | Bacteria | 959 |
| 820 | nmdc:mga0a205_214248_c1 | 3300050515 | Bacteria | 1813 |
| 821 | Ga0495601_0000553 | 3300053077 | Bacteria | 19807 |
| 822 | Ga0495601_0015697 | 3300053077 | Bacteria | 4579 |
| 823 | Ga0495601_0017845 | 3300053077 | Bacteria | 4313 |
| 824 | Ga0495601_0059692 | 3300053077 | Bacteria | 2419 |
| 825 | Ga0495601_0095659 | 3300053077 | Bacteria | 1915 |
| 826 | Ga0495601_0223676 | 3300053077 | Bacteria | 1229 |
| 827 | Ga0495612_0005207 | 3300053078 | Bacteria | 5374 |
| 828 | Ga0495612_0078981 | 3300053078 | Bacteria | 1381 |
| 829 | Ga0495595_0000636 | 3300053084 | Bacteria | 13352 |
| 830 | Ga0495595_0001097 | 3300053084 | Bacteria | 10483 |
| 831 | Ga0495595_0057023 | 3300053084 | Bacteria | 1821 |
| 832 | Ga0495595_0128093 | 3300053084 | Bacteria | 1239 |
| 833 | Ga0495619_0001119 | 3300053085 | Bacteria | 17601 |
| 834 | Ga0495619_0002389 | 3300053085 | Bacteria | 12327 |
| 835 | Ga0495619_0014496 | 3300053085 | Bacteria | 4979 |
| 836 | Ga0495619_0058848 | 3300053085 | Bacteria | 2552 |
| 837 | Ga0495619_0115661 | 3300053085 | Bacteria | 1835 |
| 838 | Ga0501084_0001857 | 3300054114 | Bacteria | 16834 |
| 839 | Ga0501084_0116988 | 3300054114 | Bacteria | 2241 |
| 840 | Ga0501084_0543907 | 3300054114 | Bacteria | 981 |
| 841 | Ga0501082_0024749 | 3300060353 | Bacteria | 5175 |
| 842 | Ga0501082_0184636 | 3300060353 | Bacteria | 1814 |
| 843 | Ga0501082_0633371 | 3300060353 | Bacteria | 936 |
| 844 | Ga0466962_0006402 | 3300061719 | Bacteria | 5652 |
| 845 | Ga0466962_0006748 | 3300061719 | Bacteria | 5504 |
| 846 | Ga0466962_0031697 | 3300061719 | Bacteria | 2531 |
| 847 | Ga0466962_0068377 | 3300061719 | Bacteria | 1696 |
| 848 | Ga0070712_100107336 | |||
| 849 | Ga0070658_10029398 | |||
| 850 | Ga0070658_10030486 | |||
| 851 | Ga0070658_10258860 | |||
| 852 | Ga0070658_10519873 | |||
| 853 | Ga0070683_100002472 | |||
| 854 | Ga0070683_100010372 | |||
| 855 | Ga0070683_100021670 | |||
| 856 | Ga0070683_100039988 | |||
| 857 | Ga0070683_100063383 | |||
| 858 | Ga0070683_100064591 | |||
| 859 | Ga0070683_100092932 | |||
| 860 | Ga0068869_100038703 | |||
| 861 | Ga0070680_100036568 | |||
| 862 | Ga0070680_100045492 | |||
| 863 | Ga0070680_100045924 | |||
| 864 | Ga0070680_100053862 | |||
| 865 | Ga0070680_100127399 | |||
| 866 | Ga0070680_100373156 | |||
| 867 | Ga0070682_100009164 | |||
| 868 | Ga0070682_100129714 | |||
| 869 | Ga0068868_100028128 | |||
| 870 | Ga0068868_100032866 | |||
| 871 | Ga0068868_100246733 | |||
| 872 | Ga0070660_100007335 | |||
| 873 | Ga0070660_100011648 | |||
| 874 | Ga0070660_100013751 | |||
| 875 | Ga0070687_100073830 | |||
| 876 | Ga0070661_100007966 | |||
| 877 | Ga0070661_100027817 | |||
| 878 | Ga0070661_100073156 | |||
| 879 | Ga0070661_100075500 | |||
| 880 | Ga0070661_100076004 | |||
| 881 | Ga0070692_10016571 | |||
| 882 | Ga0070668_100016550 | |||
| 883 | Ga0070668_100031052 | |||
| 884 | Ga0070669_100098008 | |||
| 885 | Ga0070675_100010505 | |||
| 886 | Ga0070675_100021924 | |||
| 887 | Ga0070675_100092359 | |||
| 888 | Ga0070671_100466816 | |||
| 889 | Ga0070674_100179099 | |||
| 890 | Ga0070674_100521180 | |||
| 891 | Ga0070673_100024882 | |||
| 892 | Ga0070659_100004431 | |||
| 893 | Ga0070659_100007242 | |||
| 894 | Ga0070659_100010831 | |||
| 895 | Ga0070659_100243433 | |||
| 896 | Ga0070667_100033281 | |||
| 897 | Ga0070667_100538341 | |||
| 898 | Ga0070714_100038182 | |||
| 899 | Ga0070714_100076863 | |||
| 900 | Ga0070714_100078199 | |||
| 901 | Ga0070714_100123818 | |||
| 902 | Ga0070714_100335489 | |||
| 903 | Ga0070714_100651439 | |||
| 904 | Ga0070713_100138256 | |||
| 905 | Ga0070713_100585727 | |||
| 906 | Ga0070710_10101627 | |||
| 907 | Ga0070701_10068550 | |||
| 908 | Ga0070701_10150010 | |||
| 909 | Ga0070711_100181113 | |||
| 910 | Ga0070705_100004030 | |||
| 911 | Ga0070705_100036522 | |||
| 912 | Ga0070700_100005497 | |||
| 913 | Ga0070700_100696503 | |||
| 914 | Ga0070694_100002457 | |||
| 915 | Ga0070708_100035628 | |||
| 916 | Ga0070708_100072583 | |||
| 917 | Ga0070663_100015229 | |||
| 918 | Ga0070663_100166263 | |||
| 919 | Ga0070678_100614321 | |||
| 920 | Ga0070662_100040182 | |||
| 921 | Ga0070681_10001591 | |||
| 922 | Ga0070681_10006990 | |||
| 923 | Ga0070681_10012573 | |||
| 924 | Ga0070681_10015213 | |||
| 925 | Ga0070681_10016355 | |||
| 926 | Ga0070681_10028165 | |||
| 927 | Ga0070681_10037319 | |||
| 928 | Ga0070681_10063340 | |||
| 929 | Ga0070681_10163230 | |||
| 930 | Ga0068867_100122526 | |||
| 931 | Ga0070685_10000846 | |||
| 932 | Ga0070707_100001810 | |||
| 933 | Ga0070698_100101374 | |||
| 934 | Ga0070699_100266006 | |||
| 935 | Ga0070679_100019432 | |||
| 936 | Ga0070679_100041881 | |||
| 937 | Ga0070679_100080399 | |||
| 938 | Ga0070679_100085490 | |||
| 939 | Ga0070679_100106642 | |||
| 940 | Ga0070679_100122734 | |||
| 941 | Ga0070679_100124503 | |||
| 942 | Ga0070679_100126066 | |||
| 943 | Ga0070684_100001383 | |||
| 944 | Ga0070684_100002522 | |||
| 945 | Ga0070684_100074954 | |||
| 946 | Ga0070684_100188172 | |||
| 947 | Ga0070684_100196586 | |||
| 948 | Ga0070697_100249833 | |||
| 949 | Ga0068853_100018280 | |||
| 950 | Ga0070672_100568544 | |||
| 951 | Ga0070695_100016906 | |||
| 952 | Ga0070693_100008449 | |||
| 953 | Ga0070665_100035251 | |||
| 954 | Ga0070665_100111245 | |||
| 955 | Ga0070704_100007457 | |||
| 956 | Ga0068855_100081737 | |||
| 957 | Ga0068855_100084573 | |||
| 958 | Ga0068855_100090847 | |||
| 959 | Ga0068855_100094862 | |||
| 960 | Ga0068855_100107328 | |||
| 961 | Ga0068855_100143711 | |||
| 962 | Ga0068855_100148546 | |||
| 963 | Ga0068855_100193096 | |||
| 964 | Ga0068855_100289432 | |||
| 965 | Ga0068855_100617180 | |||
| 966 | Ga0070664_100045837 | |||
| 967 | Ga0070664_100105372 | |||
| 968 | Ga0068857_100069412 | |||
| 969 | Ga0068857_100085508 | |||
| 970 | Ga0068856_100005747 | |||
| 971 | Ga0068856_100109046 | |||
| 972 | Ga0068856_100349635 | |||
| 973 | Ga0068856_100412772 | |||
| 974 | Ga0070702_100165370 | |||
| 975 | Ga0068852_100027639 | |||
| 976 | Ga0068852_100154476 | |||
| 977 | Ga0068852_100806600 | |||
| 978 | Ga0068864_100044403 | |||
| 979 | Ga0068866_10005588 | |||
| 980 | Ga0068861_100032632 | |||
| 981 | Ga0068870_10029180 | |||
| 982 | Ga0068870_10312810 | |||
| 983 | Ga0068863_100012957 | |||
| 984 | Ga0068858_100029846 | |||
| 985 | Ga0068858_100041547 | |||
| 986 | Ga0068860_100027455 | |||
| 987 | Ga0068862_100152732 | |||
| 988 | Ga0081455_10308068 | |||
| 989 | Ga0070717_10035566 | |||
| 990 | Ga0070717_10111903 | |||
| 991 | Ga0070717_10261900 | |||
| 992 | Ga0070717_10270506 | |||
| 993 | Ga0075432_10046956 | |||
| 994 | Ga0070716_100013626 | |||
| 995 | Ga0070716_100015130 | |||
| 996 | Ga0070712_100007701 | |||
| 997 | Ga0070712_100025589 | |||
| 998 | Ga0097621_100032307 | |||
| 999 | Ga0075434_100005086 | |||
| 1000 | Ga0068865_100002315 | |||
| 1001 | Ga0075436_100138139 | |||
| 1002 | Ga0105240_10059366 | |||
| 1003 | Ga0105240_10068736 | |||
| 1004 | Ga0105240_10204640 | |||
| 1005 | Ga0105240_10207015 | |||
| 1006 | Ga0111539_10037840 | |||
| 1007 | Ga0111539_10072362 | |||
| 1008 | Ga0111539_10226464 | |||
| 1009 | Ga0105245_10028493 | |||
| 1010 | Ga0105245_10085056 | |||
| 1011 | Ga0105245_10099685 | |||
| 1012 | Ga0105245_10326714 | |||
| 1013 | Ga0105245_10362402 | |||
| 1014 | Ga0105247_10149099 | |||
| 1015 | Ga0114129_10035786 | |||
| 1016 | Ga0105243_10062453 | |||
| 1017 | Ga0105243_10090904 | |||
| 1018 | Ga0105241_10068396 | |||
| 1019 | Ga0105242_10009215 | |||
| 1020 | Ga0105242_10019641 | |||
| 1021 | Ga0105242_10641675 | |||
| 1022 | Ga0105248_10321226 | |||
| 1023 | Ga0105248_10364936 | |||
| 1024 | Ga0105237_10013082 | |||
| 1025 | Ga0105237_10013814 | |||
| 1026 | Ga0105238_10020242 | |||
| 1027 | Ga0105238_10068356 | |||
| 1028 | Ga0105238_10371380 | |||
| 1029 | Ga0105249_10020856 | |||
| 1030 | Ga0105249_10034022 | |||
| 1031 | Ga0105239_10045777 | |||
| 1032 | Ga0105239_10079298 | |||
| 1033 | Ga0105239_10636468 | |||
| 1034 | Ga0105239_10880086 | |||
| 1035 | Ga0105246_10160044 | |||
| 1036 | Ga0105246_10839173 | |||
| 1037 | Ga0157373_10061788 | |||
| 1038 | Ga0157373_10096894 | |||
| 1039 | Ga0157370_10007863 | |||
| 1040 | Ga0157370_10262436 | |||
| 1041 | Ga0157370_10306053 | |||
| 1042 | Ga0157370_10371400 | |||
| 1043 | Ga0157369_10007653 | |||
| 1044 | Ga0157369_10060259 | |||
| 1045 | Ga0157369_10193803 | |||
| 1046 | Ga0157369_10279503 | |||
| 1047 | Ga0157369_10502133 | |||
| 1048 | Ga0157374_10257626 | |||
| 1049 | Ga0157374_10286340 | |||
| 1050 | Ga0157378_10040693 | |||
| 1051 | Ga0163162_10058821 | |||
| 1052 | Ga0157372_10085380 | |||
| 1053 | Ga0157372_10098613 | |||
| 1054 | Ga0157372_10283965 | |||
| 1055 | Ga0157372_10465443 | |||
| 1056 | Ga0157372_10541625 | |||
| 1057 | Ga0157375_10681267 | |||
| 1058 | Ga0157375_11205255 | |||
| 1059 | Ga0157380_10147827 | |||
| 1060 | Ga0157377_10012184 | |||
| 1061 | Ga0157377_10021214 | |||
| 1062 | Ga0157379_10010152 | |||
| 1063 | Ga0163161_10007758 | |||
| 1064 | Ga0206356_10929261 | |||
| 1065 | Ga0206356_11728262 | |||
| 1066 | Ga0206354_10144672 | |||
| 1067 | Ga0206354_10736586 | |||
| 1068 | Ga0206354_11227078 | |||
| 1069 | Ga0206353_10202598 | |||
| 1070 | Ga0206353_10920896 | |||
| 1071 | Ga0213876_10281607 | |||
| 1072 | Ga0207656_10025785 | |||
| 1073 | Ga0207692_10092305 | |||
| 1074 | Ga0207642_10178119 | |||
| 1075 | Ga0207699_10038398 | |||
| 1076 | Ga0207645_10035260 | |||
| 1077 | Ga0207643_10002872 | |||
| 1078 | Ga0207705_10100334 | |||
| 1079 | Ga0207705_10122372 | |||
| 1080 | Ga0207705_10173291 | |||
| 1081 | Ga0207684_10195388 | |||
| 1082 | Ga0207654_10307982 | |||
| 1083 | Ga0207707_10001636 | |||
| 1084 | Ga0207707_10011399 | |||
| 1085 | Ga0207707_10044323 | |||
| 1086 | Ga0207707_10044795 | |||
| 1087 | Ga0207707_10095630 | |||
| 1088 | Ga0207707_10134802 | |||
| 1089 | Ga0207707_10508104 | |||
| 1090 | Ga0207695_10063007 | |||
| 1091 | Ga0207695_10145740 | |||
| 1092 | Ga0207695_10149152 | |||
| 1093 | Ga0207695_10184504 | |||
| 1094 | Ga0207695_10263679 | |||
| 1095 | Ga0207695_10430609 | |||
| 1096 | Ga0207693_10014528 | |||
| 1097 | Ga0207693_10024330 | |||
| 1098 | Ga0207693_10088614 | |||
| 1099 | Ga0207693_10451140 | |||
| 1100 | Ga0207663_10026838 | |||
| 1101 | Ga0207660_10025871 | |||
| 1102 | Ga0207660_10090264 | |||
| 1103 | Ga0207660_10143723 | |||
| 1104 | Ga0207660_10311225 | |||
| 1105 | Ga0207662_10184243 | |||
| 1106 | Ga0207657_10000271 | |||
| 1107 | Ga0207657_10001734 | |||
| 1108 | Ga0207657_10002752 | |||
| 1109 | Ga0207657_10005062 | |||
| 1110 | Ga0207657_10017370 | |||
| 1111 | Ga0207657_10020835 | |||
| 1112 | Ga0207657_10352343 | |||
| 1113 | Ga0207649_10015371 | |||
| 1114 | Ga0207649_10016572 | |||
| 1115 | Ga0207649_10030320 | |||
| 1116 | Ga0207649_10044435 | |||
| 1117 | Ga0207652_10126259 | |||
| 1118 | Ga0207652_10175684 | |||
| 1119 | Ga0207652_10268042 | |||
| 1120 | Ga0207652_10463225 | |||
| 1121 | Ga0207681_10019179 | |||
| 1122 | Ga0207659_10136192 | |||
| 1123 | Ga0207687_10052343 | |||
| 1124 | Ga0207700_10365456 | |||
| 1125 | Ga0207700_10463575 | |||
| 1126 | Ga0207664_10038797 | |||
| 1127 | Ga0207664_10095825 | |||
| 1128 | Ga0207664_10138558 | |||
| 1129 | Ga0207664_10216891 | |||
| 1130 | Ga0207664_10244987 | |||
| 1131 | Ga0207664_10271858 | |||
| 1132 | Ga0207664_10526295 | |||
| 1133 | Ga0207644_10177706 | |||
| 1134 | Ga0207690_10024031 | |||
| 1135 | Ga0207690_10079880 | |||
| 1136 | Ga0207690_10261340 | |||
| 1137 | Ga0207706_10084127 | |||
| 1138 | Ga0207709_10282869 | |||
| 1139 | Ga0207709_10302085 | |||
| 1140 | Ga0207670_10149341 | |||
| 1141 | Ga0207669_10199180 | |||
| 1142 | Ga0207704_10003983 | |||
| 1143 | Ga0207665_10024146 | |||
| 1144 | Ga0207665_10216799 | |||
| 1145 | Ga0207691_10010834 | |||
| 1146 | Ga0207691_10528775 | |||
| 1147 | Ga0207711_10120003 | |||
| 1148 | Ga0207689_10021680 | |||
| 1149 | Ga0207661_10009907 | |||
| 1150 | Ga0207661_10014784 | |||
| 1151 | Ga0207661_10115050 | |||
| 1152 | Ga0207661_10164431 | |||
| 1153 | Ga0207661_10200582 | |||
| 1154 | Ga0207667_10057484 | |||
| 1155 | Ga0207667_10210401 | |||
| 1156 | Ga0207667_10242252 | |||
| 1157 | Ga0207667_10339380 | |||
| 1158 | Ga0207667_10448555 | |||
| 1159 | Ga0207667_10614980 | |||
| 1160 | Ga0207668_10035099 | |||
| 1161 | Ga0207640_10237505 | |||
| 1162 | Ga0207658_10009646 | |||
| 1163 | Ga0207677_10030703 | |||
| 1164 | Ga0207703_10038900 | |||
| 1165 | Ga0207639_10031082 | |||
| 1166 | Ga0207639_10065410 | |||
| 1167 | Ga0207639_10447331 | |||
| 1168 | Ga0207678_10015001 | |||
| 1169 | Ga0207708_10003687 | |||
| 1170 | Ga0207708_10450125 | |||
| 1171 | Ga0207702_10154445 | |||
| 1172 | Ga0207702_10293760 | |||
| 1173 | Ga0207702_10732130 | |||
| 1174 | Ga0207648_10030986 | |||
| 1175 | Ga0207648_10149662 | |||
| 1176 | Ga0207674_10022473 | |||
| 1177 | Ga0207674_10024377 | |||
| 1178 | Ga0207674_10196098 | |||
| 1179 | Ga0207674_10464996 | |||
| 1180 | Ga0207675_100004518 | |||
| 1181 | Ga0207675_100035672 | |||
| 1182 | Ga0207683_10009815 | |||
| 1183 | Ga0207683_10223055 | |||
| 1184 | Ga0207698_10263142 | |||
| 1185 | Ga0207428_10097151 | |||
| 1186 | Ga0207428_10114120 | |||
| 1187 | Ga0268266_10517075 | |||
| 1188 | Ga0268266_10524144 | |||
| 1189 | Ga0268265_10106544 | |||
| 1190 | Ga0268264_10007521 | |||
| 1191 | Ga0265326_10030950 | |||
| 1192 | Ga0265319_1002729 | |||
| 1193 | Ga0265319_1044882 | |||
| 1194 | Ga0265334_10004197 | |||
| 1195 | Ga0265334_10037521 | |||
| 1196 | Ga0265318_10000570 | |||
| 1197 | Ga0265318_10001892 | |||
| 1198 | Ga0265323_10047803 | |||
| 1199 | Ga0265322_10002018 | |||
| 1200 | Ga0265322_10009415 | |||
| 1201 | Ga0265322_10031037 | |||
| 1202 | Ga0265338_10005891 | |||
| 1203 | Ga0265338_10028608 | |||
| 1204 | Ga0265338_10043440 | |||
| 1205 | Ga0265330_10003326 | |||
| 1206 | Ga0265332_10006789 | |||
| 1207 | Ga0265328_10000690 | |||
| 1208 | Ga0265320_10015968 | |||
| 1209 | Ga0265320_10063252 | |||
| 1210 | Ga0265325_10000453 | |||
| 1211 | Ga0265329_10001864 | |||
| 1212 | Ga0265329_10012351 | |||
| 1213 | Ga0265340_10003414 | |||
| 1214 | Ga0265339_10002745 | |||
| 1215 | Ga0265339_10020249 | |||
| 1216 | Ga0265331_10001679 | |||
| 1217 | Ga0265327_10002344 | |||
| 1218 | Ga0265327_10006936 | |||
| 1219 | Ga0265327_10067616 | |||
| 1220 | Ga0265316_10006037 | |||
| 1221 | Ga0265316_10031157 | |||
| 1222 | Ga0265313_10001477 | |||
| 1223 | Ga0265313_10005561 | |||
| 1224 | Ga0265314_10002833 | |||
| 1225 | Ga0265314_10003450 | |||
| 1226 | Ga0265342_10034556 | |||
| 1227 | Ga0265342_10060700 | |||
| 1228 | Ga0265342_10136462 | |||
| 1229 | Ga0373926_0012162 | |||
| 1230 | Ga0373934_0042816 | |||
| 1231 | Ga0373944_0001755 | |||
| 1232 | Ga0373944_0105752 | |||
| 1233 | Ga0373952_0002697 | |||
| 1234 | Ga0373945_0025313 | |||
| 1235 | Ga0373945_0048775 | |||
| 1236 | Ga0373953_0051176 | |||
| 1237 | Ga0373956_0085304 | |||
| 1238 | Ga0373957_0124647 | |||
| 1239 | Ga0373943_0001033 | |||
| 1240 | Ga0373943_0002122 | |||
| 1241 | Ga0373946_0070460 | |||
| 1242 | Ga0373955_0067135 | |||
| 1243 | Ga0373955_0168422 | |||
| 1244 | Ga0373962_0008242 | |||
| 1245 | Ga0373924_0192642 | |||
| 1246 | Ga0373931_0053899 | |||
| 1247 | Ga0373927_0017671 | |||
| 1248 | Ga0373927_0221146 | |||
| 1249 | Ga0373933_0097499 | |||
| 1250 | Ga0373933_0133925 | |||
| 1251 | Ga0373947_0001683 | |||
| 1252 | Ga0373947_0005400 | |||
| 1253 | Ga0373947_0211455 | |||
| 1254 | Ga0373937_0001274 | |||
| 1255 | Ga0373937_0284025 | |||
| 1256 | Ga0373925_0009985 | |||
| 1257 | Ga0373925_0111666 | |||
| 1258 | Ga0373925_0133115 | |||
| 1259 | Ga0395899_0047358 | |||
| 1260 | Ga0395898_0029889 | |||
| 1261 | Ga0395898_0157653 | |||
| 1262 | Ga0395898_0209163 | |||
| 1263 | Ga0395898_0982572 | |||
| 1264 | Ga0395905_0025097 | |||
| 1265 | Ga0395901_0006460 | |||
| 1266 | Ga0395901_0015268 | |||
| 1267 | Ga0395901_0184831 | |||
| 1268 | Ga0395901_0196184 | |||
| 1269 | Ga0395901_0405034 | |||
| 1270 | Ga0436365_0068224 | |||
| 1271 | Ga0436363_1206340 | |||
| 1272 | Ga0466969_0132451 | |||
| 1273 | Ga0466969_0272829 | |||
| 1274 | Ga0466965_0012162 | |||
| 1275 | Ga0466965_0295187 | |||
| 1276 | Ga0466966_0028861 | |||
| 1277 | Ga0466966_0042861 | |||
| 1278 | Ga0466966_0044670 | |||
| 1279 | Ga0466966_0050280 | |||
| 1280 | Ga0466966_0284648 | |||
| 1281 | Ga0466961_0003803 | |||
| 1282 | Ga0466961_0004938 | |||
| 1283 | Ga0466961_0021773 | |||
| 1284 | Ga0466961_0023452 | |||
| 1285 | Ga0466961_0051399 | |||
| 1286 | Ga0466963_0000386 | |||
| 1287 | Ga0466963_0001586 | |||
| 1288 | Ga0466963_0003789 | |||
| 1289 | Ga0466963_0008766 | |||
| 1290 | Ga0466963_0009223 | |||
| 1291 | Ga0466963_0010840 | |||
| 1292 | Ga0466963_0011354 | |||
| 1293 | Ga0466963_0028857 | |||
| 1294 | Ga0466963_0036072 | |||
| 1295 | Ga0466963_0042897 | |||
| 1296 | Ga0466963_0090113 | |||
| 1297 | Ga0466963_0095672 | |||
| 1298 | Ga0466963_0112729 | |||
| 1299 | Ga0466963_0128222 | |||
| 1300 | Ga0466963_0152071 | |||
| 1301 | Ga0466963_0219144 | |||
| 1302 | Ga0466963_0239214 | |||
| 1303 | Ga0466964_0004340 | |||
| 1304 | Ga0466964_0009162 | |||
| 1305 | Ga0466964_0144251 | |||
| 1306 | Ga0466964_0279072 | |||
| 1307 | Ga0466971_0000690 | |||
| 1308 | Ga0466971_0006293 | |||
| 1309 | Ga0466971_0050550 | |||
| 1310 | Ga0466968_0002055 | |||
| 1311 | Ga0466968_0002787 | |||
| 1312 | Ga0466968_0185564 | |||
| 1313 | Ga0466970_0093845 | |||
| 1314 | Ga0466957_0005175 | |||
| 1315 | Ga0466957_0005266 | |||
| 1316 | Ga0466957_0009625 | |||
| 1317 | Ga0466957_0013777 | |||
| 1318 | Ga0466957_0095829 | |||
| 1319 | Ga0466957_0099007 | |||
| 1320 | Ga0466957_0254132 | |||
| 1321 | Ga0466957_0263917 | |||
| 1322 | Ga0466957_0295910 | |||
| 1323 | Ga0466960_0003135 | |||
| 1324 | Ga0466960_0015980 | |||
| 1325 | Ga0466960_0043635 | |||
| 1326 | Ga0466959_0000924 | |||
| 1327 | Ga0466959_0003221 | |||
| 1328 | Ga0466959_0023689 | |||
| 1329 | Ga0466959_0035001 | |||
| 1330 | Ga0466959_0345300 | |||
| 1331 | Ga0451576_0309275 | |||
| 1332 | Ga0466958_0002392 | |||
| 1333 | Ga0466958_0007133 | |||
| 1334 | Ga0466958_0087943 | |||
| 1335 | Ga0466958_0106210 | |||
| 1336 | Ga0466958_0119313 | |||
| 1337 | Ga0466958_0178710 | |||
| 1338 | Ga0466958_0358612 | |||
| 1339 | Ga0466958_0477888 | |||
| 1340 | Ga0466967_0000782 | |||
| 1341 | Ga0466967_0002172 | |||
| 1342 | Ga0466967_0002211 | |||
| 1343 | Ga0466967_0005420 | |||
| 1344 | Ga0466967_0005428 | |||
| 1345 | Ga0466967_0005681 | |||
| 1346 | Ga0466967_0005922 | |||
| 1347 | Ga0466967_0006778 | |||
| 1348 | Ga0466967_0008193 | |||
| 1349 | Ga0466967_0020684 | |||
| 1350 | Ga0466967_0027074 | |||
| 1351 | Ga0466967_0050672 | |||
| 1352 | Ga0466967_0053792 | |||
| 1353 | Ga0466967_0057201 | |||
| 1354 | Ga0466967_0064066 | |||
| 1355 | Ga0466967_0072798 | |||
| 1356 | Ga0466967_0084476 | |||
| 1357 | Ga0466967_0111558 | |||
| 1358 | Ga0466967_0113424 | |||
| 1359 | Ga0466967_0127570 | |||
| 1360 | Ga0466967_0173945 | |||
| 1361 | Ga0466967_0244431 | |||
| 1362 | Ga0466967_0331339 | |||
| 1363 | Ga0466967_0511512 | |||
| 1364 | Ga0495592_0000065 | |||
| 1365 | Ga0495592_0001368 | |||
| 1366 | Ga0495592_0010312 | |||
| 1367 | Ga0495592_0243615 | |||
| 1368 | Ga0495592_0249739 | |||
| 1369 | Ga0495603_0004591 | |||
| 1370 | Ga0495603_0038289 | |||
| 1371 | Ga0495603_0045522 | |||
| 1372 | Ga0495629_0000322 | |||
| 1373 | Ga0495629_0024135 | |||
| 1374 | Ga0495629_0024136 | |||
| 1375 | Ga0495629_0038177 | |||
| 1376 | Ga0495629_0187087 | |||
| 1377 | Ga0495641_0000172 | |||
| 1378 | Ga0495641_0005111 | |||
| 1379 | Ga0495641_0109949 | |||
| 1380 | Ga0495641_0156400 | |||
| 1381 | Ga0495651_0000001 | |||
| 1382 | Ga0495651_0004373 | |||
| 1383 | Ga0495651_0011256 | |||
| 1384 | Ga0495651_0025488 | |||
| 1385 | Ga0495651_0136947 | |||
| 1386 | Ga0495651_0257717 | |||
| 1387 | Ga0495653_0024383 | |||
| 1388 | Ga0495653_0043824 | |||
| 1389 | Ga0495653_0046246 | |||
| 1390 | Ga0495653_0108117 | |||
| 1391 | Ga0495653_0163880 | |||
| 1392 | Ga0495582_0000293 | |||
| 1393 | Ga0495582_0003471 | |||
| 1394 | Ga0495582_0074870 | |||
| 1395 | Ga0495582_0107766 | |||
| 1396 | Ga0495582_0161332 | |||
| 1397 | Ga0495582_0218817 | |||
| 1398 | Ga0495639_0000669 | |||
| 1399 | Ga0495639_0023241 | |||
| 1400 | Ga0495662_0003584 | |||
| 1401 | Ga0495662_0008222 | |||
| 1402 | Ga0495664_0040693 | |||
| 1403 | Ga0495664_0137089 | |||
| 1404 | Ga0495664_0154896 | |||
| 1405 | Ga0495664_0342632 | |||
| 1406 | Ga0495584_0134042 | |||
| 1407 | Ga0495594_0182594 | |||
| 1408 | Ga0495594_0219265 | |||
| 1409 | Ga0495596_0119794 | |||
| 1410 | Ga0495608_0006151 | |||
| 1411 | Ga0495608_0018767 | |||
| 1412 | Ga0495608_0123634 | |||
| 1413 | Ga0495608_0305549 | |||
| 1414 | Ga0495618_0003562 | |||
| 1415 | Ga0495618_0022003 | |||
| 1416 | Ga0495618_0070781 | |||
| 1417 | Ga0495618_0131446 | |||
| 1418 | Ga0495618_0324686 | |||
| 1419 | Ga0495618_0479234 | |||
| 1420 | Ga0495628_0000500 | |||
| 1421 | Ga0495628_0003524 | |||
| 1422 | Ga0495628_0118438 | |||
| 1423 | Ga0495628_0171047 | |||
| 1424 | Ga0495628_0568845 | |||
| 1425 | Ga0495630_0004985 | |||
| 1426 | Ga0495630_0048995 | |||
| 1427 | Ga0495630_0099856 | |||
| 1428 | Ga0495630_0131430 | |||
| 1429 | Ga0495644_0026499 | |||
| 1430 | Ga0495666_0011729 | |||
| 1431 | Ga0495652_0000015 | |||
| 1432 | Ga0495652_0021734 | |||
| 1433 | Ga0495652_0038388 | |||
| 1434 | Ga0495652_0038786 | |||
| 1435 | Ga0495652_0047605 | |||
| 1436 | Ga0495652_0094633 | |||
| 1437 | Ga0495652_0143928 | |||
| 1438 | Ga0495652_0494859 | |||
| 1439 | Ga0495665_0001010 | |||
| 1440 | Ga0495665_0003453 | |||
| 1441 | Ga0495640_0022647 | |||
| 1442 | Ga0495640_0033650 | |||
| 1443 | Ga0495640_0067976 | |||
| 1444 | Ga0495640_0208962 | |||
| 1445 | Ga0495640_0331119 | |||
| 1446 | Ga0495586_0043847 | |||
| 1447 | Ga0495587_0000036 | |||
| 1448 | Ga0495587_0047561 | |||
| 1449 | Ga0495645_0000039 | |||
| 1450 | Ga0495645_0001725 | |||
| 1451 | Ga0495645_0077445 | |||
| 1452 | Ga0495645_0077840 | |||
| 1453 | Ga0495645_0105087 | |||
| 1454 | Ga0495667_0022009 | |||
| 1455 | Ga0495667_0037899 | |||
| 1456 | Ga0495667_0039586 | |||
| 1457 | Ga0495667_0065085 | |||
| 1458 | Ga0495667_0141311 | |||
| 1459 | Ga0495656_0063715 | |||
| 1460 | Ga0495656_0089822 | |||
| 1461 | Ga0495634_0087264 | |||
| 1462 | Ga0495635_0009181 | |||
| 1463 | Ga0495635_0034317 | |||
| 1464 | Ga0495635_0053920 | |||
| 1465 | Ga0495635_0202884 | |||
| 1466 | Ga0495635_0503316 | |||
| 1467 | Ga0495588_0107354 | |||
| 1468 | Ga0495657_0005022 | |||
| 1469 | Ga0495657_0013431 | |||
| 1470 | Ga0495657_0243294 | |||
| 1471 | Ga0495657_0285011 | |||
| 1472 | Ga0495657_0401695 | |||
| 1473 | Ga0495599_0000055 | |||
| 1474 | Ga0495599_0101722 | |||
| 1475 | Ga0495599_0105205 | |||
| 1476 | Ga0495599_0130598 | |||
| 1477 | Ga0495623_0000445 | |||
| 1478 | Ga0495623_0049196 | |||
| 1479 | Ga0495646_0003435 | |||
| 1480 | Ga0495647_0000798 | |||
| 1481 | Ga0495647_0011432 | |||
| 1482 | Ga0495647_0018748 | |||
| 1483 | Ga0495647_0103539 | |||
| 1484 | Ga0495658_0000583 | |||
| 1485 | Ga0495658_0002666 | |||
| 1486 | Ga0495613_0002165 | |||
| 1487 | Ga0495613_0033229 | |||
| 1488 | Ga0495613_0048163 | |||
| 1489 | Ga0495613_0088388 | |||
| 1490 | Ga0495613_0384893 | |||
| 1491 | Ga0495624_0004502 | |||
| 1492 | Ga0495624_0006697 | |||
| 1493 | Ga0495624_0295395 | |||
| 1494 | Ga0495600_0083608 | |||
| 1495 | Ga0495600_0135843 | |||
| 1496 | Ga0495600_0212188 | |||
| 1497 | Ga0495581_0001529 | |||
| 1498 | Ga0495581_0003549 | |||
| 1499 | Ga0495581_0368938 | |||
| 1500 | Ga0495604_0000004 | |||
| 1501 | Ga0495604_0007706 | |||
| 1502 | Ga0495604_0170373 | |||
| 1503 | Ga0495604_0228635 | |||
| 1504 | Ga0495674_0005899 | |||
| 1505 | Ga0495674_0044726 | |||
| 1506 | Ga0495674_0087851 | |||
| 1507 | Ga0495674_0115104 | |||
| 1508 | Ga0495674_0184659 | |||
| 1509 | Ga0495676_0025869 | |||
| 1510 | Ga0495676_0063270 | |||
| 1511 | Ga0495676_0218632 | |||
| 1512 | Ga0495676_0323947 | |||
| 1513 | Ga0495676_0379993 | |||
| 1514 | Ga0495680_0003870 | |||
| 1515 | Ga0495680_0007676 | |||
| 1516 | Ga0495680_0023590 | |||
| 1517 | Ga0495680_0042385 | |||
| 1518 | Ga0495680_0048810 | |||
| 1519 | Ga0495675_0003350 | |||
| 1520 | Ga0495684_0002259 | |||
| 1521 | Ga0495684_0012400 | |||
| 1522 | Ga0495684_0108412 | |||
| 1523 | Ga0495684_0249458 | |||
| 1524 | Ga0495593_0003569 | |||
| 1525 | Ga0495593_0038928 | |||
| 1526 | Ga0495602_0000235 | |||
| 1527 | Ga0495602_0030125 | |||
| 1528 | Ga0495614_0000112 | |||
| 1529 | Ga0495614_0006376 | |||
| 1530 | Ga0496100_0001948 | |||
| 1531 | Ga0496100_0025874 | |||
| 1532 | Ga0496100_0151390 | |||
| 1533 | Ga0496101_0005006 | |||
| 1534 | Ga0496101_0009733 | |||
| 1535 | Ga0496101_0161332 | |||
| 1536 | Ga0496101_0209573 | |||
| 1537 | Ga0496101_0214568 | |||
| 1538 | Ga0496102_0001373 | |||
| 1539 | Ga0496102_0015470 | |||
| 1540 | Ga0496102_0040328 | |||
| 1541 | Ga0496102_0046162 | |||
| 1542 | Ga0496102_0541151 | |||
| 1543 | Ga0496103_0048792 | |||
| 1544 | Ga0496104_0013970 | |||
| 1545 | Ga0496104_0067803 | |||
| 1546 | Ga0496104_0079160 | |||
| 1547 | Ga0496104_0092659 | |||
| 1548 | Ga0496104_0107997 | |||
| 1549 | Ga0496104_0164531 | |||
| 1550 | Ga0496104_0212757 | |||
| 1551 | Ga0496105_0000466 | |||
| 1552 | Ga0496105_0219119 | |||
| 1553 | Ga0496105_0322980 | |||
| 1554 | Ga0496106_0030085 | |||
| 1555 | Ga0496106_0036904 | |||
| 1556 | Ga0496106_0323243 | |||
| 1557 | Ga0496107_0010989 | |||
| 1558 | Ga0496107_0131590 | |||
| 1559 | Ga0496107_0422914 | |||
| 1560 | Ga0496108_0003292 | |||
| 1561 | Ga0496108_0033318 | |||
| 1562 | Ga0496108_0062374 | |||
| 1563 | Ga0496109_0000847 | |||
| 1564 | Ga0496109_0003458 | |||
| 1565 | Ga0496109_0209747 | |||
| 1566 | Ga0496109_0224354 | |||
| 1567 | Ga0496109_0307101 | |||
| 1568 | Ga0496109_0393659 | |||
| 1569 | Ga0496109_0440467 | |||
| 1570 | Ga0496110_0006627 | |||
| 1571 | Ga0496110_0014631 | |||
| 1572 | Ga0496110_0231839 | |||
| 1573 | Ga0496110_0324756 | |||
| 1574 | Ga0496110_0786005 | |||
| 1575 | Ga0496111_0034239 | |||
| 1576 | Ga0496111_0134370 | |||
| 1577 | Ga0496112_0013740 | |||
| 1578 | Ga0496112_0021043 | |||
| 1579 | Ga0496112_0023688 | |||
| 1580 | Ga0496112_0045113 | |||
| 1581 | Ga0496112_0202585 | |||
| 1582 | Ga0496112_0274062 | |||
| 1583 | Ga0496112_0334136 | |||
| 1584 | Ga0496112_0394183 | |||
| 1585 | Ga0496112_0481350 | |||
| 1586 | Ga0496112_0493192 | |||
| 1587 | Ga0496112_0511235 | |||
| 1588 | Ga0496112_0780653 | |||
| 1589 | Ga0496113_0013027 | |||
| 1590 | Ga0496113_0026491 | |||
| 1591 | Ga0496114_0000954 | |||
| 1592 | Ga0496114_0093554 | |||
| 1593 | Ga0496114_0107097 | |||
| 1594 | Ga0496114_0131223 | |||
| 1595 | Ga0496114_0290218 | |||
| 1596 | Ga0496114_0470116 | |||
| 1597 | Ga0496115_0001782 | |||
| 1598 | Ga0496115_0009857 | |||
| 1599 | Ga0496115_0034878 | |||
| 1600 | Ga0496115_0076116 | |||
| 1601 | Ga0496115_0142276 | |||
| 1602 | Ga0496115_0276077 | |||
| 1603 | Ga0496115_0283334 | |||
| 1604 | Ga0501031_0102490 | |||
| 1605 | Ga0501031_0416723 | |||
| 1606 | Ga0501033_0084016 | |||
| 1607 | Ga0501036_0014510 | |||
| 1608 | Ga0501036_0202325 | |||
| 1609 | Ga0501036_0485296 | |||
| 1610 | Ga0501037_0265404 | |||
| 1611 | Ga0501038_0202901 | |||
| 1612 | Ga0501038_0242904 | |||
| 1613 | Ga0501039_0029802 | |||
| 1614 | Ga0501039_0036544 | |||
| 1615 | Ga0501039_0289134 | |||
| 1616 | Ga0501040_0011605 | |||
| 1617 | Ga0501040_0147603 | |||
| 1618 | Ga0501041_0096998 | |||
| 1619 | Ga0501042_0035512 | |||
| 1620 | Ga0501042_0058438 | |||
| 1621 | Ga0501042_0088240 | |||
| 1622 | Ga0501043_0019136 | |||
| 1623 | Ga0501043_0185839 | |||
| 1624 | Ga0501046_0068016 | |||
| 1625 | Ga0501046_0111194 | |||
| 1626 | Ga0501048_0010135 | |||
| 1627 | Ga0501048_0128340 | |||
| 1628 | Ga0501067_0091787 | |||
| 1629 | Ga0501067_0108696 | |||
| 1630 | Ga0501068_0023711 | |||
| 1631 | Ga0501070_0008954 | |||
| 1632 | Ga0501070_0213100 | |||
| 1633 | Ga0501070_0422321 | |||
| 1634 | Ga0501071_0005185 | |||
| 1635 | Ga0501071_0037245 | |||
| 1636 | Ga0501071_0076105 | |||
| 1637 | Ga0501072_0000889 | |||
| 1638 | Ga0501072_0053299 | |||
| 1639 | Ga0501072_0099956 | |||
| 1640 | Ga0501073_0420943 | |||
| 1641 | Ga0501074_0008848 | |||
| 1642 | Ga0501075_0001771 | |||
| 1643 | Ga0501075_0057044 | |||
| 1644 | Ga0501075_0166704 | |||
| 1645 | Ga0501076_0003983 | |||
| 1646 | Ga0501076_0006412 | |||
| 1647 | Ga0501077_0091764 | |||
| 1648 | Ga0501077_0427935 | |||
| 1649 | Ga0501079_0005185 | |||
| 1650 | Ga0501079_0041241 | |||
| 1651 | Ga0501079_0193170 | |||
| 1652 | Ga0501080_0032087 | |||
| 1653 | Ga0501080_0034173 | |||
| 1654 | Ga0501080_0171923 | |||
| 1655 | Ga0501080_0183279 | |||
| 1656 | Ga0501081_0101707 | |||
| 1657 | Ga0501081_0156939 | |||
| 1658 | Ga0501035_0427200 | |||
| 1659 | Ga0501044_0152238 | |||
| 1660 | Ga0501045_0002284 | |||
| 1661 | Ga0501045_0016561 | |||
| 1662 | nmdc:mga08y16_182190_c1 | |||
| 1663 | nmdc:mga08y16_322800_c1 | |||
| 1664 | nmdc:mga08y16_96632_c1 | |||
| 1665 | nmdc:mga0n895_1855_c1 | |||
| 1666 | nmdc:mga0rr50_576016_c1 | |||
| 1667 | nmdc:mga0a205_214248_c1 | |||
| 1668 | Ga0495601_0000553 | |||
| 1669 | Ga0495601_0015697 | |||
| 1670 | Ga0495601_0017845 | |||
| 1671 | Ga0495601_0059692 | |||
| 1672 | Ga0495601_0095659 | |||
| 1673 | Ga0495601_0223676 | |||
| 1674 | Ga0495612_0005207 | |||
| 1675 | Ga0495612_0078981 | |||
| 1676 | Ga0495595_0000636 | |||
| 1677 | Ga0495595_0001097 | |||
| 1678 | Ga0495595_0057023 | |||
| 1679 | Ga0495595_0128093 | |||
| 1680 | Ga0495619_0001119 | |||
| 1681 | Ga0495619_0002389 | |||
| 1682 | Ga0495619_0014496 | |||
| 1683 | Ga0495619_0058848 | |||
| 1684 | Ga0495619_0115661 | |||
| 1685 | Ga0501084_0001857 | |||
| 1686 | Ga0501084_0116988 | |||
| 1687 | Ga0501084_0543907 | |||
| 1688 | Ga0501082_0024749 | |||
| 1689 | Ga0501082_0184636 | |||
| 1690 | Ga0501082_0633371 | |||
| 1691 | Ga0466962_0006402 | |||
| 1692 | Ga0466962_0006748 | |||
| 1693 | Ga0466962_0031697 | |||
| 1694 | Ga0466962_0068377 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cqg-assembly1.cif.gz_A | yycf effector domain structure without dna bound | 0.9528 | 129 | 224 |
| 2zxj-assembly2.cif.gz_B | crystal structure of yycf dna-binding domain from staphylococcus aureus | 0.9442 | 128 | 225 |
| 2hwv-assembly1.cif.gz_A | crystal structure of an essential response regulator dna binding domain, vicrc in enterococcus faecalis, a member of the yycf subfamily. | 0.9417 | 128 | 227 |
| 6ifh-assembly1.cif.gz_A | unphosphorylated spo0f from paenisporosarcina sp. tg-14 | 0.9407 | 13 | 119 |
| 5za3-assembly1.cif.gz_B | structure of a c-terminal s. mutans response regulator vicr domain | 0.9402 | 127 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5za3A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9487 | 127 | 225 | 1.10.10.10 |
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9269 | 10 | 79 | 3.40.50.2300 |
| af_P0A9Q1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9231 | 15 | 79 | 3.40.50.2300 |
| af_P14375_1_129_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9225 | 14 | 126 | 3.40.50.2300 |
| 5hm6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9221 | 12 | 119 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0V810-F1-model_v4 | OmpR/PhoB-type domain-containing protein | 0.9636 | 144 | 224 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A4V1UXS5-F1-model_v4 | deleted | 0.9531 | 139 | 225 |
|
| AF-A0A7C1YRM9-F1-model_v4 | Winged helix family transcriptional regulator | 0.9518 | 136 | 224 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A4U2NVC7-F1-model_v4 | deleted | 0.9502 | 128 | 224 |
|
| AF-A0A6L9HMY7-F1-model_v4 | deleted | 0.9478 | 129 | 224 |
|