F483111

General Info

Members Datasets Scaffolds Average Seq Length
841 670 332 589

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0024362|Ga0500573_0024362_893_2719
Length 608
Sequence MSSGFNSDGAGANPDDAVAKAEADLNDDALRTRAVIAARGDAPFDVLIAGGTLVDMVTGELRAADIGLIGPLIASVHAPGSRTDAAETIDATGSFVSPGLIDTHMHIESSMVTPATYAGAVLPRGVTTLVWDPHEFGNVHGIVGVRWAVDAVAKLPLRVIVLAPSCVPSAPGLELAGADFDADVLAELLSWPGIGGIAEVMTMRGVIDRDPRMSGILQAGLASRKLICGHARSLAGADLNAFIAAGVSSDHELTSGDDLMQKLRAGLTIELRGSHDHLLPEFVEVLNTLGHLPQTLTLCTDDVFPDDLVKGGGLDDVVRRLVRYGLKPQWALQAATLNAAVRLGRADLGLVATGRRADLVLFEDLSDFRARHVFADGVRIASDGTMQVALKDADPAPLHGSMKIAPLTTDDFRIPSTGTRAKLATIDRPRFTRWGEIEADVADGFVVPPQGVTMIAVAHRHGFSDSRPRVGFLTGWGDWRGAFATTISHDSHNLTVFGGNPQDMAVAANAVIAAGGGMAVASNGRVEALMPLPLSGLVSDRPMDEVATGFDRLRSAMDGVIDWQPPYLIFKACFGATLACNAGPHQTDRGIADVGTGRVLENPVLEVF

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
12 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
13 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
14 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
15 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
18 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
19 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
20 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
21 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
22 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
23 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
24 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
25 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
26 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
27 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
28 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
29 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
30 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
31 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
32 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
33 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
34 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
35 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
36 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
37 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
38 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
39 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
40 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
41 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
42 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
43 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
44 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
45 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
46 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
47 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
48 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
49 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
50 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
51 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
52 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
53 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
54 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
55 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
56 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
57 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
58 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
59 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
60 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
61 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
62 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
63 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
64 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
65 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
66 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
67 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
68 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
69 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
70 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
71 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
72 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
73 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
74 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
75 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
76 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
77 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
78 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
79 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
80 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
81 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
82 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
83 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
84 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
85 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
86 2643221557 Ensifer sp. Root558 Isolate Unclassified
87 2643221558 Rhizobium sp. Root149 Isolate Unclassified
88 2643221568 Rhizobium sp. Root564 Isolate Unclassified
89 2643221582 Rhizobium sp. Root651 Isolate Unclassified
90 2643221599 Rhizobium sp. Root708 Isolate Unclassified
91 2643221607 Rhizobium sp. Root73 Isolate Unclassified
92 2643221610 Ensifer sp. Root74 Isolate Unclassified
93 2643221618 Ensifer sp. Root231 Isolate Unclassified
94 2643221626 Ensifer sp. Root31 Isolate Unclassified
95 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
96 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
97 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
98 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
99 2643221655 Ensifer sp. Root1252 Isolate Unclassified
100 2643221659 Ensifer sp. Root127 Isolate Unclassified
101 2643221668 Ensifer sp. Root423 Isolate Unclassified
102 2643221675 Ensifer sp. Root1298 Isolate Unclassified
103 2643221680 Ensifer sp. Root1312 Isolate Unclassified
104 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
105 2643221693 Rhizobium sp. Root491 Isolate Unclassified
106 2643221698 Ensifer sp. Root142 Isolate Unclassified
107 2643221712 Ensifer sp. Root258 Isolate Unclassified
108 2643221718 Rhizobium sp. Root268 Isolate Unclassified
109 2643221723 Ensifer sp. Root278 Isolate Unclassified
110 2643221726 Ensifer sp. Root954 Isolate Unclassified
111 2718217882 Rhizobium sp. N741 Isolate Nodule
112 2718217927 Rhizobium sp. N324 Isolate Nodule
113 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
114 2718218009 Rhizobium sp. N561 Isolate Nodule
115 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
116 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
117 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
118 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
119 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
120 2718218363 Rhizobium sp. N113 Isolate Nodule
121 2718218365 Rhizobium sp. N731 Isolate Nodule
122 2718218366 Rhizobium sp. N621 Isolate Nodule
123 2718218423 Rhizobium sp. N941 Isolate Nodule
124 2721755514 Rhizobium sp. N6212 Isolate Nodule
125 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
126 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
127 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
128 2721755809 Rhizobium sp. N541 Isolate Nodule
129 2721755810 Rhizobium sp. N871 Isolate Nodule
130 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
131 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
132 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
133 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
134 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
135 2728369365 Rhizobium sp. N1341 Isolate Nodule
136 2728369397 Rhizobium sp. N1314 Isolate Nodule
137 2738541293 Rhizobium sp. GV031 Isolate Unclassified
138 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
139 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
140 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
141 2791355256 Rhizobium sp. M10 Isolate Nodule
142 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
143 2791355260 Rhizobium sp. L9 Isolate Nodule
144 2791355261 Rhizobium sp. J15 Isolate Nodule
145 2791355262 Rhizobium sp. M1 Isolate Nodule
146 2791355263 Rhizobium chutanense C5 Isolate Nodule
147 2791355264 Rhizobium sp. S9 Isolate Nodule
148 2791355265 Rhizobium sp. H4 Isolate Nodule
149 2791355266 Rhizobium sp. L43 Isolate Nodule
150 2791355267 Rhizobium sp. L18 Isolate Nodule
151 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
152 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
153 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
154 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
155 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
156 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
157 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
158 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
159 2802429633 Rhizobium anhuiense J3 Isolate Nodule
160 2802429634 Rhizobium anhuiense S10 Isolate Nodule
161 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
162 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
163 2802429637 Rhizobium anhuiense C15 Isolate Nodule
164 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
165 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
166 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
167 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
168 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
169 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
170 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
171 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
172 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
173 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
174 2838048938 Rhizobium pisi 27/80 Isolate Nodule
175 2838061910 Rhizobium phaseoli L15 Isolate Nodule
176 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
177 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
178 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
179 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
180 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
181 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
182 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
183 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
184 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
185 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
186 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
187 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
188 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
189 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
190 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
191 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
192 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
193 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
194 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
195 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
196 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
197 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
198 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
199 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
200 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
201 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
202 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
203 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
204 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
205 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
206 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
207 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
208 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
209 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
210 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
211 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
212 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
213 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
214 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
215 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
216 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
217 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
218 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
219 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
220 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
221 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
222 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
223 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
224 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
225 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
226 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
227 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
228 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
229 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
230 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
231 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
232 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
233 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
234 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
235 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
236 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
237 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
238 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
239 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
240 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
241 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
242 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
243 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
244 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
245 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
246 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
247 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
248 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
249 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
250 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
251 2844163670 Ensifer sp. 1H6 Isolate Unclassified
252 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
253 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
254 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
255 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
256 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
257 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
258 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
259 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
260 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
261 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
262 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
263 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
264 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
265 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
266 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
267 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
268 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
269 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
270 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
271 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
272 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
273 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
274 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
275 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
276 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
277 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
278 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
279 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
280 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
281 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
282 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
283 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
284 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
285 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
286 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
287 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
288 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
289 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
290 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
291 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
292 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
293 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
294 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
295 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
296 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
297 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
298 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
299 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
300 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
301 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
302 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
303 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
304 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
305 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
306 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
307 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
308 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
309 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
310 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
311 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
312 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
313 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
314 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
315 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
316 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
317 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
318 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
319 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
320 2933599457 Rhizobium phaseoli M3 Isolate Nodule
321 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
322 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
323 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
324 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
325 2936381700 Rhizobium chutanense C16 Isolate Unclassified
326 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
327 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
328 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
329 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
330 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
331 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
332 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
333 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
334 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
335 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
336 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
337 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
338 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
339 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
340 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
341 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
342 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
343 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
344 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
345 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
346 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
347 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
348 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
349 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
350 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
351 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
352 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
353 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
354 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
355 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
356 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
357 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
358 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
359 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
360 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
361 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
362 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
363 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
364 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
365 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
366 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
367 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
368 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
369 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
370 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
371 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
372 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
373 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
374 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
375 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
376 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
377 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
378 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
379 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
380 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
381 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
382 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
383 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
384 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
385 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
386 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
387 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
388 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
389 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
390 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
391 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
392 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
393 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
394 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
395 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
396 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
397 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
398 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
399 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
400 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
401 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
402 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
403 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
404 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
405 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
406 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
407 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
408 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
409 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
410 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
411 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
412 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
413 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
414 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
415 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
416 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
417 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
418 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
419 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
420 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
421 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
422 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
423 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
424 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
425 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
426 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
427 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
428 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
429 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
430 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
431 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
432 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
433 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
434 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
435 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
436 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
437 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
438 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
439 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
440 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
441 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
442 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
443 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
444 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
445 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
446 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
447 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
448 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
449 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
450 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
451 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
452 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
453 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
454 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
455 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
456 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
457 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
458 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
459 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
460 2996887358 Rhizobium sp. R711 Isolate Nodule
461 2996893221 Rhizobium sp. R635 Isolate Nodule
462 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
463 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
464 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
465 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
466 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
467 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
468 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
469 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
470 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
471 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
472 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
473 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
474 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
475 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
476 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
477 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
478 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
479 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
480 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
481 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
482 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
483 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
484 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
485 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
486 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
487 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
488 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
489 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
490 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
491 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
492 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
493 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
494 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
495 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
496 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
497 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
498 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
499 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
500 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
501 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
502 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
503 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
504 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
505 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
506 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
507 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
508 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
509 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
510 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
511 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
512 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
513 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
514 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
515 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
516 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
517 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
518 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
519 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
520 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
521 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
522 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
523 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
524 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
525 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
526 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
527 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
528 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
529 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
530 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
531 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
532 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
533 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
534 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
535 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
536 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
537 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
538 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
539 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
540 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
541 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
542 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
543 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
544 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
545 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
546 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
547 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
548 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
549 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
550 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
551 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
552 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
553 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
554 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
555 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
556 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
557 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
558 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
559 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
560 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
561 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
562 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
563 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
564 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
565 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
566 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
567 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
568 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
569 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
570 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
571 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
572 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
573 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
574 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
575 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
576 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
577 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
578 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
579 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
580 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
581 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
582 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
583 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
584 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
585 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
586 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
587 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
588 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
589 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
590 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
591 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
592 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
593 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
594 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
595 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
596 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
597 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
598 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
599 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
601 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
602 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
603 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
606 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
607 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
608 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
609 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
610 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
611 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
612 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
613 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
614 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
615 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
616 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
617 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
618 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
619 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
620 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
621 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
622 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
623 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
624 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
625 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
626 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
627 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
628 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
629 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
630 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
631 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
632 8005258706 Rhizobium sp. R693 Isolate Nodule
633 8005275841 Rhizobium sp. N4311 Isolate Nodule
634 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
635 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
636 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
637 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
638 8005321885 Rhizobium sp. R72 Isolate Nodule
639 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
640 8005382845 Rhizobium sp. R634 Isolate Nodule
641 8005395548 Rhizobium sp. R339 Isolate Nodule
642 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
643 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
644 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
645 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
646 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
647 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
648 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
649 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
650 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
651 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
652 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
653 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
654 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
655 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
656 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
657 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
658 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
659 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
660 8018176218 Rhizobium sp. N122 Isolate Nodule
661 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
662 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
663 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
664 8024501048 Rhizobium sp. H4 Isolate Nodule
665 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
666 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
667 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
668 8056382006 Rhizobium croatiense 13T Isolate Nodule
669 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
670 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.48
Metatranscriptomes 0
Isolates 60.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0
Endosphere 17.84
Nodule 46.97
Rhizoplane 1.9
Rhizosphere 14.51
Stem 0
Stem Tuber 0
Unclassified 18.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000075 3300002704 Bacteria 62215
2 JGI25156J39149_1000103 3300002705 Bacteria 62289
3 JGI25154J39366_1000018 3300002738 Bacteria 251612
4 JGI25158J39367_1000138 3300002739 Bacteria 17170
5 JGI25157J39369_1000074 3300002741 Bacteria 88240
6 JGI25152J39213_1002048 3300002773 Bacteria 7939
7 JGI25152J39213_1002126 3300002773 Bacteria 7768
8 JGI25152J39213_1003957 3300002773 Bacteria 4839
9 JGI25152J39213_1004690 3300002773 Bacteria 4228
10 JGI25150J39212_1000442 3300002774 Bacteria 18447
11 JGI25150J39212_1002790 3300002774 Bacteria 4240
12 JGI25159J45721_1000093 3300002987 Bacteria 42171
13 JGI25159J45721_1000100 3300002987 Bacteria 41372
14 JGI25159J45721_1000155 3300002987 Bacteria 32010
15 JGI25159J45721_1000377 3300002987 Bacteria 20611
16 JGI25151J46595_10001078 3300003187 Bacteria 20347
17 JGI25151J46595_10001202 3300003187 Bacteria 18543
18 JGI25151J46595_10005841 3300003187 Bacteria 6296
19 JGI25153J46596_10000831 3300003215 Bacteria 18867
20 JGI25153J46596_10002447 3300003215 Bacteria 10708
21 JGI25153J46596_10003889 3300003215 Bacteria 8207
22 JGI25153J46596_10020647 3300003215 Bacteria 2484
23 rootH1_10021345 3300003316 Bacteria 5305
24 rootH2_10045351 3300003320 Bacteria 5746
25 rootH1_10045123 3300003323 Bacteria 8064
26 JGI25160J50197_1000044 3300003354 Bacteria 145379
27 JGI25160J50197_1000086 3300003354 Bacteria 94046
28 JGI25160J50197_1003331 3300003354 Bacteria 7227
29 JGI25160J50197_1007513 3300003354 Bacteria 4256
30 JGI25161J50226_1000028 3300003374 Bacteria 145379
31 JGI25161J50226_1000389 3300003374 Bacteria 22186
32 JGI25161J50226_1000442 3300003374 Bacteria 19513
33 JGI25161J50226_1003657 3300003374 Bacteria 3445
34 Ga0055526_1000315 3300003771 Bacteria 40330
35 Ga0055526_1000664 3300003771 Bacteria 26413
36 Ga0055526_1000684 3300003771 Bacteria 25937
37 Ga0055524_1001602 3300003775 Bacteria 12666
38 Ga0055524_1002103 3300003775 Bacteria 10524
39 Ga0055524_1006753 3300003775 Bacteria 4954
40 Ga0055524_1010351 3300003775 Bacteria 3719
41 Ga0055536_1009876 3300003781 Bacteria 3877
42 Ga0055528_1000176 3300003790 Bacteria 54005
43 Ga0055528_1000649 3300003790 Bacteria 25297
44 Ga0055528_1002930 3300003790 Bacteria 8847
45 Ga0055528_1003745 3300003790 Bacteria 7505
46 Ga0055530_10008223 3300003791 Bacteria 4218
47 Ga0055540_1000301 3300003792 Bacteria 43713
48 Ga0055531_10003561 3300003794 Bacteria 9888
49 Ga0058692_1002214 3300003856 Bacteria 6624
50 Ga0055543_1000054 3300004625 Bacteria 104176
51 Ga0055543_1000166 3300004625 Bacteria 55052
52 Ga0055543_1000296 3300004625 Bacteria 35540
53 Ga0065165_1000813 3300005262 Bacteria 41429
54 Ga0065165_1002551 3300005262 Bacteria 15100
55 Ga0065165_1007048 3300005262 Bacteria 5656
56 Ga0065165_1009258 3300005262 Bacteria 4444
57 Ga0070665_100036673 3300005548 Bacteria 4930
58 Ga0068851_10026760 3300005834 Bacteria 2837
59 Ga0075365_10000225 3300006038 Bacteria 19139
60 Ga0075365_10000468 3300006038 Bacteria 15201
61 Ga0075365_10000513 3300006038 Bacteria 14784
62 Ga0075364_10010171 3300006051 Bacteria 5673
63 Ga0075362_10000666 3300006177 Bacteria 10135
64 Ga0075367_10001960 3300006178 Bacteria 9154
65 Ga0075366_10001633 3300006195 Bacteria 11244
66 Ga0075366_10002954 3300006195 Bacteria 8853
67 Ga0075370_10001391 3300006353 Bacteria 10430
68 Ga0079104_1000063 3300006946 Bacteria 159519
69 Ga0099826_10000045 3300006948 Bacteria 75912
70 Ga0099826_10001193 3300006948 Bacteria 15076
71 Ga0105240_10000910 3300009093 Bacteria 52855
72 Ga0105237_10001371 3300009545 Bacteria 32139
73 Ga0123340_1033321 3300009763 Bacteria 2918
74 Ga0123341_1000068 3300009765 Bacteria 44096
75 Ga0123341_1036814 3300009765 Bacteria 3368
76 Ga0123342_1007954 3300009766 Bacteria 13684
77 Ga0123342_1018003 3300009766 Bacteria 5736
78 Ga0157373_10002153 3300013100 Bacteria 14906
79 Ga0157371_10000031 3300013102 Bacteria 230441
80 Ga0157371_10008466 3300013102 Bacteria 8188
81 Ga0157370_10000909 3300013104 Bacteria 37515
82 Ga0171463_1010 3300013249 Bacteria 269975
83 Ga0171462_1032 3300013250 Bacteria 98473
84 Ga0182007_10009371 3300015262 Bacteria 3951
85 Ga0183363_1036 3300015690 Bacteria 44926
86 Ga0209435_100044 3300025206 Bacteria 99051
87 Ga0209436_100023 3300025208 Bacteria 96401
88 Ga0209436_100046 3300025208 Bacteria 68624
89 Ga0209437_105282 3300025233 Bacteria 2207
90 Ga0207425_1000058 3300025245 Bacteria 149214
91 Ga0207425_1005226 3300025245 Bacteria 3732
92 Ga0209646_1000151 3300025246 Bacteria 99050
93 Ga0209026_1000170 3300025250 Bacteria 99050
94 Ga0209677_101845 3300025253 Bacteria 8621
95 Ga0209759_1000186 3300025256 Bacteria 100413
96 Ga0209129_1000107 3300025258 Bacteria 154705
97 Ga0209129_1000242 3300025258 Bacteria 58534
98 Ga0209129_1000313 3300025258 Bacteria 43280
99 Ga0209129_1002045 3300025258 Bacteria 10414
100 Ga0209129_1007138 3300025258 Bacteria 3404
101 Ga0209233_1000232 3300025261 Bacteria 96361
102 Ga0209673_1000060 3300025273 Bacteria 263602
103 Ga0209673_1000233 3300025273 Bacteria 108504
104 Ga0209673_1000978 3300025273 Bacteria 35222
105 Ga0209673_1000980 3300025273 Bacteria 35156
106 Ga0209673_1002028 3300025273 Bacteria 15416
107 Ga0209673_1003790 3300025273 Bacteria 8588
108 Ga0209673_1008248 3300025273 Bacteria 4659
109 Ga0209673_1013495 3300025273 Bacteria 3220
110 Ga0209130_1000074 3300025284 Bacteria 173309
111 Ga0209130_1000093 3300025284 Bacteria 145707
112 Ga0209130_1000173 3300025284 Bacteria 92248
113 Ga0209676_1002284 3300025292 Bacteria 14013
114 Ga0209676_1014822 3300025292 Bacteria 2908
115 Ga0209025_1000083 3300025294 Bacteria 265556
116 Ga0209025_1000227 3300025294 Bacteria 132244
117 Ga0209025_1000758 3300025294 Bacteria 53948
118 Ga0209025_1001147 3300025294 Bacteria 37727
119 Ga0209025_1001249 3300025294 Bacteria 35273
120 Ga0209025_1002601 3300025294 Bacteria 18601
121 Ga0209025_1003257 3300025294 Bacteria 15637
122 Ga0209025_1009943 3300025294 Bacteria 6534
123 Ga0209025_1024890 3300025294 Bacteria 3072
124 Ga0209564_1000116 3300025295 Bacteria 207889
125 Ga0209564_1000125 3300025295 Bacteria 201709
126 Ga0209564_1000856 3300025295 Bacteria 40580
127 Ga0209564_1001100 3300025295 Bacteria 32100
128 Ga0209564_1003015 3300025295 Bacteria 12035
129 Ga0209564_1004731 3300025295 Bacteria 8150
130 Ga0209564_1018564 3300025295 Bacteria 2643
131 Ga0209758_1000105 3300025297 Bacteria 221415
132 Ga0209758_1001294 3300025297 Bacteria 30724
133 Ga0209758_1002006 3300025297 Bacteria 21897
134 Ga0209758_1002496 3300025297 Bacteria 18680
135 Ga0209758_1012628 3300025297 Bacteria 4705
136 Ga0209050_1002732 3300025298 Bacteria 14233
137 Ga0209050_1007855 3300025298 Bacteria 5859
138 Ga0209256_1000164 3300025299 Bacteria 135612
139 Ga0209256_1000302 3300025299 Bacteria 86634
140 Ga0209256_1000772 3300025299 Bacteria 41509
141 Ga0209256_1001023 3300025299 Bacteria 32869
142 Ga0209256_1003354 3300025299 Bacteria 11347
143 Ga0209256_1003614 3300025299 Bacteria 10610
144 Ga0209256_1004736 3300025299 Bacteria 8318
145 Ga0209256_1008028 3300025299 Bacteria 5003
146 Ga0209256_1015179 3300025299 Bacteria 2712
147 Ga0207426_1000012 3300025302 Bacteria 730942
148 Ga0207426_1000047 3300025302 Bacteria 417011
149 Ga0207426_1000165 3300025302 Bacteria 170244
150 Ga0207426_1000276 3300025302 Bacteria 106148
151 Ga0207426_1000457 3300025302 Bacteria 64140
152 Ga0209051_1000217 3300025303 Bacteria 97218
153 Ga0209051_1001739 3300025303 Bacteria 17361
154 Ga0209051_1002080 3300025303 Bacteria 15103
155 Ga0209051_1003444 3300025303 Bacteria 10367
156 Ga0209051_1003642 3300025303 Bacteria 9974
157 Ga0209257_1002649 3300025304 Bacteria 17210
158 Ga0209257_1007475 3300025304 Bacteria 6582
159 Ga0209257_1012210 3300025304 Bacteria 4007
160 Ga0207695_10000427 3300025913 Bacteria 93089
161 Ga0207671_10000288 3300025914 Bacteria 74500
162 Ga0209281_1000110 3300027111 Bacteria 215631
163 Ga0209371_1000003 3300027312 Bacteria 1122971
164 Ga0209371_1000283 3300027312 Bacteria 58483
165 Ga0209282_1000008 3300027666 Bacteria 248526
166 Ga0209282_1000210 3300027666 Bacteria 31123
167 Ga0209282_1019088 3300027666 Bacteria 4349
168 Ga0268266_10040657 3300028379 Bacteria 3964
169 Ga0307515_10002178 3300028794 Bacteria 43027
170 Ga0307515_10006437 3300028794 Bacteria 23488
171 Ga0307515_10024859 3300028794 Bacteria 10399
172 Ga0268256_1000004 3300030500 Bacteria 1122967
173 Ga0307513_10005733 3300031456 Bacteria 16340
174 Ga0307412_10000931 3300031911 Bacteria 16734
175 Ga0315914_1000011 3300031967 Bacteria 170175
176 Ga0315913_1008369 3300033430 Bacteria 12281
177 Ga0315915_1000009 3300033464 Bacteria 252178
178 Ga0439465_0011461 3300041413 Bacteria 2782
179 Ga0451835_0088077 3300041492 Bacteria 4679
180 Ga0451851_0179135 3300041507 Bacteria 4344
181 Ga0451851_1079014 3300041507 Bacteria 5114
182 Ga0451843_1290610 3300041509 Bacteria 3899
183 Ga0451853_2456616 3300041512 Bacteria 3654
184 Ga0466970_0072540 3300044765 Bacteria 1852
185 Ga0451576_0145110 3300045051 Bacteria 2474
186 Ga0495638_0000296 3300046460 Bacteria 64130
187 Ga0495605_0010740 3300046474 Bacteria 5116
188 Ga0495605_0016036 3300046474 Bacteria 4064
189 Ga0495585_0008558 3300046492 Bacteria 6197
190 Ga0495607_0099594 3300046501 Bacteria 1559
191 Ga0495583_0005215 3300046506 Bacteria 8926
192 Ga0495583_0014032 3300046506 Bacteria 4435
193 Ga0495606_0007840 3300046507 Bacteria 9428
194 Ga0495606_0047727 3300046507 Bacteria 2822
195 Ga0495606_0060240 3300046507 Bacteria 2432
196 Ga0495610_0001781 3300046512 Bacteria 18812
197 Ga0495610_0006011 3300046512 Bacteria 8480
198 Ga0495610_0028780 3300046512 Bacteria 2934
199 Ga0495610_0034396 3300046512 Bacteria 2611
200 Ga0495616_0027989 3300046513 Bacteria 2987
201 Ga0495620_0016122 3300046515 Bacteria 3759
202 Ga0495631_0006867 3300046518 Bacteria 5839
203 Ga0495632_0002338 3300046519 Bacteria 14540
204 Ga0495632_0007786 3300046519 Bacteria 6677
205 Ga0495648_0004210 3300046524 Bacteria 12355
206 Ga0495654_0000121 3300046530 Bacteria 86743
207 Ga0495609_0018814 3300046538 Bacteria 3200
208 Ga0495633_0033652 3300046558 Bacteria 2471
209 Ga0495625_0004692 3300046660 Bacteria 12814
210 Ga0495625_0012879 3300046660 Bacteria 6758
211 Ga0495588_0000403 3300046674 Bacteria 24269
212 Ga0495588_0014783 3300046674 Bacteria 3744
213 Ga0495657_0025250 3300046675 Bacteria 4223
214 Ga0495660_0004528 3300046810 Bacteria 8400
215 Ga0495660_0021738 3300046810 Bacteria 3669
216 Ga0495687_019733 3300047443 Bacteria 3299
217 Ga0495681_0006325 3300047470 Bacteria 7796
218 Ga0495686_0002724 3300047472 Bacteria 16159
219 Ga0495686_0008537 3300047472 Bacteria 7510
220 Ga0496100_0007860 3300048903 Bacteria 5920
221 Ga0496102_0169990 3300048905 Bacteria 2052
222 Ga0496103_0008885 3300048906 Bacteria 5960
223 Ga0496105_0044780 3300048908 Bacteria 3650
224 Ga0496106_0000245 3300048909 Bacteria 37807
225 Ga0496111_0000967 3300048914 Bacteria 15693
226 Ga0496113_0031171 3300048916 Bacteria 3867
227 Ga0496113_0106764 3300048916 Bacteria 2175
228 Ga0496114_0078711 3300048917 Bacteria 2781
229 Ga0496116_0000135 3300048919 Bacteria 153165
230 Ga0496116_0009606 3300048919 Bacteria 8231
231 Ga0496116_0009916 3300048919 Bacteria 8054
232 Ga0496116_0053210 3300048919 Bacteria 2675
233 Ga0496116_0072012 3300048919 Bacteria 2186
234 Ga0496117_0000030 3300048920 Bacteria 389141
235 Ga0496117_0006452 3300048920 Bacteria 11866
236 Ga0496118_0001480 3300048921 Bacteria 35175
237 Ga0496118_0004045 3300048921 Bacteria 17813
238 Ga0496118_0009207 3300048921 Bacteria 10030
239 Ga0496118_0067372 3300048921 Bacteria 2607
240 Ga0496119_0006282 3300048922 Bacteria 11079
241 Ga0496119_0032496 3300048922 Bacteria 3477
242 Ga0496120_0000047 3300048923 Bacteria 190569
243 Ga0496120_0014119 3300048923 Bacteria 5335
244 Ga0496120_0033491 3300048923 Bacteria 3087
245 Ga0496121_0000003 3300048924 Bacteria 1191431
246 Ga0496121_0003334 3300048924 Bacteria 23044
247 Ga0496121_0005225 3300048924 Bacteria 16807
248 Ga0496121_0015003 3300048924 Bacteria 8157
249 Ga0496121_0017187 3300048924 Bacteria 7408
250 Ga0496121_0020201 3300048924 Bacteria 6609
251 Ga0496121_0021842 3300048924 Bacteria 6249
252 Ga0496121_0028791 3300048924 Bacteria 5161
253 Ga0496121_0033603 3300048924 Bacteria 4637
254 Ga0496121_0037981 3300048924 Bacteria 4271
255 Ga0496121_0041506 3300048924 Bacteria 4019
256 Ga0496121_0087345 3300048924 Bacteria 2448
257 Ga0496121_0098308 3300048924 Bacteria 2265
258 Ga0496121_0119752 3300048924 Bacteria 1990
259 Ga0496122_0000076 3300048925 Bacteria 218690
260 Ga0496122_0000107 3300048925 Bacteria 193163
261 Ga0496122_0005592 3300048925 Bacteria 14877
262 Ga0496122_0010818 3300048925 Bacteria 9345
263 Ga0496122_0018249 3300048925 Bacteria 6495
264 Ga0496122_0020654 3300048925 Bacteria 5934
265 Ga0496122_0049201 3300048925 Bacteria 3232
266 Ga0496122_0051781 3300048925 Bacteria 3115
267 Ga0496122_0070137 3300048925 Bacteria 2506
268 Ga0496123_0000023 3300048926 Bacteria 346894
269 Ga0496123_0000063 3300048926 Bacteria 216072
270 Ga0496123_0008844 3300048926 Bacteria 9175
271 Ga0496123_0010369 3300048926 Bacteria 8248
272 Ga0496123_0013766 3300048926 Bacteria 6759
273 Ga0496123_0043085 3300048926 Bacteria 3105
274 Ga0496123_0060489 3300048926 Bacteria 2442
275 Ga0496123_0064194 3300048926 Bacteria 2341
276 Ga0496124_0000239 3300048927 Bacteria 106633
277 Ga0496124_0001919 3300048927 Bacteria 28475
278 Ga0496124_0015352 3300048927 Bacteria 7348
279 Ga0496124_0021457 3300048927 Bacteria 5949
280 Ga0496124_0041525 3300048927 Bacteria 3968
281 Ga0496124_0049203 3300048927 Bacteria 3597
282 Ga0496124_0068124 3300048927 Bacteria 2959
283 Ga0496125_0000200 3300048928 Bacteria 126369
284 Ga0496125_0005933 3300048928 Bacteria 13384
285 Ga0496125_0014144 3300048928 Bacteria 7787
286 Ga0496125_0040483 3300048928 Bacteria 3997
287 Ga0496125_0093971 3300048928 Bacteria 2236
288 Ga0496126_0000129 3300048929 Bacteria 174059
289 Ga0496126_0048201 3300048929 Bacteria 3895
290 Ga0496126_0099224 3300048929 Bacteria 2551
291 Ga0501031_0000005 3300049568 Bacteria 183960
292 Ga0501032_0000337 3300049569 Bacteria 39238
293 Ga0501033_0000631 3300049570 Bacteria 32526
294 Ga0501034_0001953 3300049571 Bacteria 26109
295 Ga0501036_0000014 3300049572 Bacteria 148705
296 Ga0501037_0000517 3300049573 Bacteria 30998
297 Ga0501038_0000024 3300049574 Bacteria 148705
298 Ga0501039_0000122 3300049575 Bacteria 53871
299 Ga0501040_0001738 3300049576 Bacteria 13985
300 Ga0501043_0000987 3300049579 Bacteria 25068
301 Ga0501043_0111150 3300049579 Bacteria 2151
302 Ga0501047_0001328 3300049581 Bacteria 24254
303 Ga0501070_0002802 3300049586 Bacteria 15213
304 Ga0501070_0003222 3300049586 Bacteria 14197
305 Ga0501073_0035804 3300049589 Bacteria 3527
306 Ga0501083_0037163 3300049744 Bacteria 3317
307 Ga0501035_0000045 3300049822 Bacteria 148705
308 Ga0501044_0000044 3300049823 Bacteria 148705
309 nmdc:mga00v17_440_c1 3300050491 Bacteria 22734
310 nmdc:mga00v17_4_c1 3300050491 Bacteria 238758
311 nmdc:mga0yw44_115_c1 3300050492 Bacteria 24900
312 nmdc:mga0k408_3667_c1 3300050493 Bacteria 8124
313 nmdc:mga0sz30_2179_c1 3300050516 Bacteria 7005
314 Ga0500560_000988 3300053107 Bacteria 4549
315 Ga0500560_003847 3300053107 Bacteria 3103
316 Ga0500562_009003 3300053108 Bacteria 2522
317 Ga0500572_001695 3300053111 Bacteria 5748
318 Ga0500618_000171 3300053125 Bacteria 54421
319 Ga0500618_002444 3300053125 Bacteria 6999
320 Ga0500618_008100 3300053125 Bacteria 2954
321 Ga0500658_0000185 3300053134 Bacteria 29770
322 Ga0500561_0001003 3300053137 Bacteria 4525
323 Ga0500568_0001930 3300053139 Bacteria 12712
324 Ga0500568_0007386 3300053139 Bacteria 5393
325 Ga0500568_0012695 3300053139 Bacteria 3865
326 Ga0500573_0024362 3300053140 Bacteria 3479
327 Ga0500616_0000402 3300053153 Bacteria 59210
328 Ga0500616_0005862 3300053153 Bacteria 8225
329 Ga0500633_0001006 3300053160 Bacteria 4998
330 Ga0500636_0000039 3300053177 Bacteria 69891
331 Ga0500636_0002338 3300053177 Bacteria 10526
332 Ga0501082_0037735 3300060353 Bacteria 4167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0072540 Ga0466970_0072540_368_1837 488
2 iso_pu_bacteria 2510917026 2511174801 489
3 3300046501 Ga0495607_0099594 Ga0495607_0099594_11_1528 504
4 3300048924 Ga0496121_0087345 Ga0496121_0087345_40_1566 504
5 3300048926 Ga0496123_0064194 Ga0496123_0064194_11_1537 504
6 3300046519 Ga0495632_0007786 Ga0495632_0007786_4992_6662 543
7 3300003354 JGI25160J50197_1007513 JGI25160J50197_10075132 562
8 3300025294 Ga0209025_1001147 Ga0209025_100114718 562
9 3300002987 JGI25159J45721_1000100 JGI25159J45721_100010026 565
10 3300002987 JGI25159J45721_1000155 JGI25159J45721_10001558 565
11 3300003354 JGI25160J50197_1000086 JGI25160J50197_100008673 565
12 3300003374 JGI25161J50226_1000442 JGI25161J50226_100044216 565
13 3300003771 Ga0055526_1000684 Ga0055526_10006846 565
14 3300003794 Ga0055531_10003561 Ga0055531_100035618 565
15 3300004625 Ga0055543_1000296 Ga0055543_100029626 565
16 3300005262 Ga0065165_1000813 Ga0065165_100081326 565
17 3300025208 Ga0209436_100046 Ga0209436_10004667 565
18 3300025284 Ga0209130_1000074 Ga0209130_100007489 565
19 3300025292 Ga0209676_1002284 Ga0209676_10022847 565
20 3300025294 Ga0209025_1000758 Ga0209025_100075815 565
21 3300025295 Ga0209564_1000856 Ga0209564_100085626 565
22 3300025298 Ga0209050_1002732 Ga0209050_100273211 565
23 3300025299 Ga0209256_1008028 Ga0209256_10080282 565
24 3300025302 Ga0207426_1000165 Ga0207426_100016589 565
25 3300025303 Ga0209051_1003642 Ga0209051_10036429 565
26 3300025304 Ga0209257_1002649 Ga0209257_10026498 565
27 3300003775 Ga0055524_1001602 Ga0055524_10016028 570
28 3300048925 Ga0496122_0049201 Ga0496122_0049201_999_2789 574
29 3300048925 Ga0496122_0070137 Ga0496122_0070137_55_1845 574
30 3300013249 Ga0171463_1010 Ga0171463_101091 575
31 3300015690 Ga0183363_1036 Ga0183363_103622 575
32 3300013250 Ga0171462_1032 Ga0171462_103258 578
33 3300048925 Ga0496122_0000107 Ga0496122_0000107_168479_170269 578
34 3300048926 Ga0496123_0000063 Ga0496123_0000063_22840_24630 578
35 3300053125 Ga0500618_008100 Ga0500618_008100_59_1846 578
36 3300003792 Ga0055540_1000301 Ga0055540_100030130 579
37 3300005834 Ga0068851_10026760 Ga0068851_100267602 579
38 3300009093 Ga0105240_10000910 Ga0105240_1000091030 579
39 3300009545 Ga0105237_10001371 Ga0105237_1000137130 579
40 3300013104 Ga0157370_10000909 Ga0157370_1000090927 579
41 3300015262 Ga0182007_10009371 Ga0182007_100093712 579
42 3300025233 Ga0209437_105282 Ga0209437_1052822 579
43 3300025253 Ga0209677_101845 Ga0209677_1018456 579
44 3300025261 Ga0209233_1000232 Ga0209233_10002326 579
45 3300025273 Ga0209673_1000980 Ga0209673_100098015 579
46 3300025298 Ga0209050_1007855 Ga0209050_10078552 579
47 3300025299 Ga0209256_1000164 Ga0209256_100016429 579
48 3300025303 Ga0209051_1000217 Ga0209051_100021717 579
49 3300025304 Ga0209257_1007475 Ga0209257_10074753 579
50 3300025913 Ga0207695_10000427 Ga0207695_1000042730 579
51 3300025914 Ga0207671_10000288 Ga0207671_1000028843 579
52 3300027312 Ga0209371_1000003 Ga0209371_1000003359 579
53 3300028794 Ga0307515_10006437 Ga0307515_1000643722 579
54 3300030500 Ga0268256_1000004 Ga0268256_1000004692 579
55 3300048903 Ga0496100_0007860 Ga0496100_0007860_3985_5772 579
56 3300048906 Ga0496103_0008885 Ga0496103_0008885_560_2347 579
57 3300048916 Ga0496113_0106764 Ga0496113_0106764_352_2139 579
58 3300048920 Ga0496117_0006452 Ga0496117_0006452_5609_7396 579
59 3300048921 Ga0496118_0004045 Ga0496118_0004045_962_2749 579
60 3300048921 Ga0496118_0009207 Ga0496118_0009207_1446_3233 579
61 3300048922 Ga0496119_0032496 Ga0496119_0032496_563_2350 579
62 3300048924 Ga0496121_0005225 Ga0496121_0005225_5478_7265 579
63 3300048925 Ga0496122_0010818 Ga0496122_0010818_5113_6900 579
64 3300048926 Ga0496123_0010369 Ga0496123_0010369_4188_5975 579
65 3300048928 Ga0496125_0014144 Ga0496125_0014144_2188_3975 579
66 iso_pu_bacteria 2643221557 2643809046 579
67 iso_pu_bacteria 2643221610 2644069109 579
68 iso_pu_bacteria 2643221668 2644378639 579
69 iso_pu_bacteria 2643221675 2644420180 579
70 iso_pu_bacteria 2643221680 2644453587 579
71 iso_pu_bacteria 2643221726 2644692286 579
72 3300048914 Ga0496111_0000967 Ga0496111_0000967_991_2778 580
73 3300002739 JGI25158J39367_1000138 JGI25158J39367_10001383 581
74 3300002773 JGI25152J39213_1004690 JGI25152J39213_10046903 581
75 3300002774 JGI25150J39212_1002790 JGI25150J39212_10027903 581
76 3300003215 JGI25153J46596_10000831 JGI25153J46596_100008315 581
77 3300003215 JGI25153J46596_10002447 JGI25153J46596_100024472 581
78 3300003374 JGI25161J50226_1000389 JGI25161J50226_10003893 581
79 3300003771 Ga0055526_1000664 Ga0055526_10006648 581
80 3300003781 Ga0055536_1009876 Ga0055536_10098762 581
81 3300003790 Ga0055528_1000649 Ga0055528_100064924 581
82 3300003791 Ga0055530_10008223 Ga0055530_100082232 581
83 3300004625 Ga0055543_1000166 Ga0055543_100016617 581
84 3300005262 Ga0065165_1009258 Ga0065165_10092582 581
85 3300009765 Ga0123341_1000068 Ga0123341_100006828 581
86 3300009766 Ga0123342_1007954 Ga0123342_10079547 581
87 3300025208 Ga0209436_100023 Ga0209436_10002321 581
88 3300025245 Ga0207425_1005226 Ga0207425_10052262 581
89 3300025258 Ga0209129_1000313 Ga0209129_100031317 581
90 3300025273 Ga0209673_1000060 Ga0209673_100006017 581
91 3300025273 Ga0209673_1008248 Ga0209673_10082483 581
92 3300025273 Ga0209673_1013495 Ga0209673_10134952 581
93 3300025284 Ga0209130_1000173 Ga0209130_100017317 581
94 3300025292 Ga0209676_1014822 Ga0209676_10148222 581
95 3300025294 Ga0209025_1024890 Ga0209025_10248902 581
96 3300025295 Ga0209564_1000116 Ga0209564_100011617 581
97 3300025295 Ga0209564_1001100 Ga0209564_100110017 581
98 3300025297 Ga0209758_1000105 Ga0209758_100010591 581
99 3300025297 Ga0209758_1002006 Ga0209758_10020063 581
100 3300025297 Ga0209758_1012628 Ga0209758_10126282 581
101 3300025299 Ga0209256_1000302 Ga0209256_100030285 581
102 3300025299 Ga0209256_1003614 Ga0209256_10036148 581
103 3300025299 Ga0209256_1015179 Ga0209256_10151792 581
104 3300025302 Ga0207426_1000047 Ga0207426_100004717 581
105 3300025303 Ga0209051_1001739 Ga0209051_100173910 581
106 3300025303 Ga0209051_1003444 Ga0209051_10034444 581
107 3300025304 Ga0209257_1012210 Ga0209257_10122102 581
108 3300041413 Ga0439465_0011461 Ga0439465_0011461_918_2705 581
109 3300041507 Ga0451851_1079014 Ga0451851_1079014_1884_3671 581
110 3300041509 Ga0451843_1290610 Ga0451843_1290610_600_2387 581
111 3300046474 Ga0495605_0010740 Ga0495605_0010740_2127_3914 581
112 3300046512 Ga0495610_0006011 Ga0495610_0006011_1352_3139 581
113 3300046513 Ga0495616_0027989 Ga0495616_0027989_749_2536 581
114 3300046515 Ga0495620_0016122 Ga0495620_0016122_58_1845 581
115 3300046660 Ga0495625_0012879 Ga0495625_0012879_2046_3833 581
116 3300046810 Ga0495660_0004528 Ga0495660_0004528_5075_6862 581
117 3300048924 Ga0496121_0020201 Ga0496121_0020201_2174_3964 581
118 3300048924 Ga0496121_0021842 Ga0496121_0021842_544_2334 581
119 3300048927 Ga0496124_0049203 Ga0496124_0049203_954_2744 581
120 3300053134 Ga0500658_0000185 Ga0500658_0000185_23947_25734 581
121 3300003316 rootH1_10021345 rootH1_100213453 582
122 3300003320 rootH2_10045351 rootH2_100453513 582
123 3300003323 rootH1_10045123 rootH1_100451234 582
124 3300045051 Ga0451576_0145110 Ga0451576_0145110_191_1978 582
125 3300049568 Ga0501031_0000005 Ga0501031_0000005_173669_175468 582
126 3300049569 Ga0501032_0000337 Ga0501032_0000337_29661_31460 582
127 3300049570 Ga0501033_0000631 Ga0501033_0000631_22949_24748 582
128 3300049571 Ga0501034_0001953 Ga0501034_0001953_16532_18331 582
129 3300049572 Ga0501036_0000014 Ga0501036_0000014_7779_9578 582
130 3300049573 Ga0501037_0000517 Ga0501037_0000517_7779_9578 582
131 3300049574 Ga0501038_0000024 Ga0501038_0000024_7779_9578 582
132 3300049575 Ga0501039_0000122 Ga0501039_0000122_44294_46093 582
133 3300049576 Ga0501040_0001738 Ga0501040_0001738_5169_6968 582
134 3300049579 Ga0501043_0000987 Ga0501043_0000987_15514_17313 582
135 3300049581 Ga0501047_0001328 Ga0501047_0001328_5960_7759 582
136 3300049586 Ga0501070_0002802 Ga0501070_0002802_12345_14144 582
137 3300049822 Ga0501035_0000045 Ga0501035_0000045_139128_140927 582
138 3300049823 Ga0501044_0000044 Ga0501044_0000044_7779_9578 582
139 iso_pu_bacteria 2551306086 2551691252 582
140 3300002987 JGI25159J45721_1000377 JGI25159J45721_100037715 583
141 iso_pu_bacteria 2891048133 2891049877 583
142 3300046674 Ga0495588_0014783 Ga0495588_0014783_1311_3071 586
143 3300047443 Ga0495687_019733 Ga0495687_019733_902_2662 586
144 3300048919 Ga0496116_0009606 Ga0496116_0009606_5149_6909 586
145 3300048919 Ga0496116_0009916 Ga0496116_0009916_1118_2878 586
146 3300048919 Ga0496116_0053210 Ga0496116_0053210_809_2569 586
147 3300048924 Ga0496121_0037981 Ga0496121_0037981_1224_2984 586
148 3300048924 Ga0496121_0119752 Ga0496121_0119752_167_1927 586
149 3300048925 Ga0496122_0005592 Ga0496122_0005592_8642_10435 586
150 3300048925 Ga0496122_0051781 Ga0496122_0051781_441_2201 586
151 3300048926 Ga0496123_0013766 Ga0496123_0013766_4817_6577 586
152 3300048926 Ga0496123_0043085 Ga0496123_0043085_904_2664 586
153 3300048927 Ga0496124_0001919 Ga0496124_0001919_24705_26465 586
154 3300048927 Ga0496124_0041525 Ga0496124_0041525_981_2741 586
155 3300002773 JGI25152J39213_1003957 JGI25152J39213_10039571 587
156 3300003187 JGI25151J46595_10005841 JGI25151J46595_100058413 587
157 3300025258 Ga0209129_1000242 Ga0209129_100024251 587
158 3300025294 Ga0209025_1002601 Ga0209025_100260111 587
159 3300041512 Ga0451853_2456616 Ga0451853_2456616_64_1854 587
160 iso_pu_bacteria 2534681796 2535519632 587
161 3300003790 Ga0055528_1000176 Ga0055528_10001762 588
162 3300025273 Ga0209673_1000978 Ga0209673_100097817 588
163 3300025295 Ga0209564_1018564 Ga0209564_10185642 588
164 3300025299 Ga0209256_1001023 Ga0209256_100102310 588
165 iso_pu_bacteria 2510917028 2511186792 588
166 iso_pu_bacteria 2513237088 2513600568 588
167 iso_pu_bacteria 2513237138 2513867638 588
168 iso_pu_bacteria 2524023207 2524449644 588
169 iso_pu_bacteria 2582581294 2585204829 588
170 iso_pu_bacteria 2582581299 2585233816 588
171 iso_pu_bacteria 2582581304 2585257580 588
172 iso_pu_bacteria 2582581867 2585403440 588
173 iso_pu_bacteria 2585427590 2585823737 588
174 iso_pu_bacteria 2585427594 2585845132 588
175 iso_pu_bacteria 2643221599 2644006208 588
176 iso_pu_bacteria 2643221634 2644195779 588
177 iso_pu_bacteria 2643221643 2644241658 588
178 iso_pu_bacteria 2738541293 2738800651 588
179 iso_pu_bacteria 2923556063 2923562618 588
180 iso_pu_bacteria 2996887358 2996890037 588
181 iso_pu_bacteria 3005452660 3005455349 588
182 iso_pu_bacteria 8005258706 8005262224 588
183 iso_pu_bacteria 8005321885 8005324564 588
184 iso_pu_bacteria 8005542996 8005547334 588
185 iso_pu_bacteria 8005658619 8005661920 588
186 iso_pu_bacteria 2511231052 2511498146 589
187 iso_pu_bacteria 2512875026 2512969458 589
188 iso_pu_bacteria 2513237086 2513586001 589
189 iso_pu_bacteria 2513237089 2513606360 589
190 iso_pu_bacteria 2513237091 2513618184 589
191 iso_pu_bacteria 2513237140 2513885098 589
192 iso_pu_bacteria 2513237143 2513905600 589
193 iso_pu_bacteria 2513237156 2513988670 589
194 iso_pu_bacteria 2513237160 2514008072 589
195 iso_pu_bacteria 2515154107 2515610700 589
196 iso_pu_bacteria 2516653046 2516896210 589
197 iso_pu_bacteria 2517487022 2517565663 589
198 iso_pu_bacteria 2551306085 2551685000 589
199 iso_pu_bacteria 2551306089 2551710281 589
200 iso_pu_bacteria 2599185352 2600197506 589
201 iso_pu_bacteria 2643221558 2643813419 589
202 iso_pu_bacteria 2643221568 2643853655 589
203 iso_pu_bacteria 2643221618 2644104746 589
204 iso_pu_bacteria 2643221626 2644151177 589
205 iso_pu_bacteria 2643221637 2644207891 589
206 iso_pu_bacteria 2643221655 2644313165 589
207 iso_pu_bacteria 2643221659 2644336251 589
208 iso_pu_bacteria 2643221698 2644547088 589
209 iso_pu_bacteria 2643221712 2644612788 589
210 iso_pu_bacteria 2643221718 2644651166 589
211 iso_pu_bacteria 2643221723 2644674527 589
212 iso_pu_bacteria 2802428858 2802721321 589
213 iso_pu_bacteria 2802428859 2802728263 589
214 iso_pu_bacteria 2802428860 2802733921 589
215 iso_pu_bacteria 2802428861 2802740657 589
216 iso_pu_bacteria 2802428862 2802746942 589
217 iso_pu_bacteria 2802428863 2802748696 589
218 iso_pu_bacteria 2844163670 2844169704 589
219 iso_pu_bacteria 2855839649 2855844082 589
220 iso_pu_bacteria 2858800743 2858806668 589
221 iso_pu_bacteria 2915980308 2915985909 589
222 iso_pu_bacteria 2915986958 2915991666 589
223 iso_pu_bacteria 2915993759 2915998365 589
224 iso_pu_bacteria 2916000859 2916006705 589
225 iso_pu_bacteria 2916007675 2916009798 589
226 iso_pu_bacteria 2916014648 2916016708 589
227 iso_pu_bacteria 2916021584 2916024288 589
228 iso_pu_bacteria 2916028427 2916030369 589
229 iso_pu_bacteria 2916035215 2916039451 589
230 iso_pu_bacteria 2916041962 2916047588 589
231 iso_pu_bacteria 2916048683 2916049693 589
232 iso_pu_bacteria 2916055098 2916060954 589
233 iso_pu_bacteria 2916061851 2916063042 589
234 iso_pu_bacteria 2916068649 2916070056 589
235 iso_pu_bacteria 2916076590 2916081166 589
236 iso_pu_bacteria 2919166419 2919168084 589
237 iso_pu_bacteria 2920822456 2920826703 589
238 iso_pu_bacteria 2921201388 2921206952 589
239 iso_pu_bacteria 2921208531 2921213446 589
240 iso_pu_bacteria 2921237296 2921242899 589
241 iso_pu_bacteria 2921244191 2921248841 589
242 iso_pu_bacteria 2921250672 2921256566 589
243 iso_pu_bacteria 2921257292 2921262941 589
244 iso_pu_bacteria 2921263974 2921269057 589
245 iso_pu_bacteria 2921282425 2921288984 589
246 iso_pu_bacteria 2921289301 2921295577 589
247 iso_pu_bacteria 2924144063 2924145103 589
248 iso_pu_bacteria 2924150972 2924156831 589
249 iso_pu_bacteria 2924158325 2924162149 589
250 iso_pu_bacteria 2924165586 2924169215 589
251 iso_pu_bacteria 2924172951 2924173813 589
252 iso_pu_bacteria 2924179722 2924185693 589
253 iso_pu_bacteria 2924186466 2924192294 589
254 iso_pu_bacteria 2924193448 2924196197 589
255 iso_pu_bacteria 2924200457 2924203726 589
256 iso_pu_bacteria 2924207177 2924209601 589
257 iso_pu_bacteria 2924214083 2924221556 589
258 iso_pu_bacteria 2924221636 2924226615 589
259 iso_pu_bacteria 2924228884 2924231287 589
260 iso_pu_bacteria 2936996657 2937002314 589
261 iso_pu_bacteria 2937002841 2937003584 589
262 iso_pu_bacteria 2937009748 2937012096 589
263 iso_pu_bacteria 2937016420 2937017456 589
264 iso_pu_bacteria 2937023124 2937024964 589
265 iso_pu_bacteria 2937029754 2937033283 589
266 iso_pu_bacteria 2937036028 2937040605 589
267 iso_pu_bacteria 2937042894 2937043812 589
268 iso_pu_bacteria 2937056579 2937058242 589
269 iso_pu_bacteria 2937071275 2937074323 589
270 iso_pu_bacteria 2937078374 2937083739 589
271 iso_pu_bacteria 2937084907 2937086395 589
272 iso_pu_bacteria 2937091812 2937097556 589
273 iso_pu_bacteria 2937098957 2937102420 589
274 iso_pu_bacteria 2937106411 2937111083 589
275 iso_pu_bacteria 2937113482 2937114797 589
276 iso_pu_bacteria 2937119839 2937122884 589
277 iso_pu_bacteria 2937126314 2937126937 589
278 iso_pu_bacteria 2941499720 2941504382 589
279 iso_pu_bacteria 2957375807 2957379178 589
280 iso_pu_bacteria 2957382221 2957383235 589
281 iso_pu_bacteria 2957388812 2957390531 589
282 iso_pu_bacteria 2957395598 2957399423 589
283 iso_pu_bacteria 2957402308 2957403531 589
284 iso_pu_bacteria 2957408893 2957411294 589
285 iso_pu_bacteria 2957415311 2957417764 589
286 iso_pu_bacteria 2957422303 2957426880 589
287 iso_pu_bacteria 2957430029 2957432660 589
288 iso_pu_bacteria 2957450854 2957452540 589
289 iso_pu_bacteria 2957457609 2957458830 589
290 iso_pu_bacteria 2957464669 2957466800 589
291 iso_pu_bacteria 2957471148 2957472667 589
292 iso_pu_bacteria 2957478035 2957484191 589
293 iso_pu_bacteria 2957484790 2957490330 589
294 iso_pu_bacteria 2957491536 2957495487 589
295 iso_pu_bacteria 2957498199 2957500828 589
296 iso_pu_bacteria 2957505466 2957508511 589
297 iso_pu_bacteria 2960584000 2960590951 589
298 iso_pu_bacteria 2960591022 2960595032 589
299 iso_pu_bacteria 2960597568 2960601679 589
300 iso_pu_bacteria 2960603979 2960608944 589
301 iso_pu_bacteria 2960610863 2960613056 589
302 iso_pu_bacteria 2960617483 2960619884 589
303 iso_pu_bacteria 2960624210 2960628053 589
304 iso_pu_bacteria 2960631154 2960633063 589
305 iso_pu_bacteria 2960637947 2960641731 589
306 iso_pu_bacteria 2960645483 2960647844 589
307 iso_pu_bacteria 2960652885 2960658833 589
308 iso_pu_bacteria 2960660292 2960661845 589
309 iso_pu_bacteria 2960667422 2960668614 589
310 iso_pu_bacteria 2960674078 2960676683 589
311 iso_pu_bacteria 2960680706 2960684351 589
312 iso_pu_bacteria 2960687367 2960688409 589
313 iso_pu_bacteria 2960693952 2960700878 589
314 iso_pu_bacteria 2964607997 2964609900 589
315 iso_pu_bacteria 2964615318 2964618473 589
316 iso_pu_bacteria 2964621998 2964623385 589
317 iso_pu_bacteria 2964628898 2964629219 589
318 iso_pu_bacteria 2964636051 2964640850 589
319 iso_pu_bacteria 2964643177 2964646501 589
320 iso_pu_bacteria 2964649959 2964654271 589
321 iso_pu_bacteria 2964656573 2964661484 589
322 iso_pu_bacteria 2964663802 2964665492 589
323 iso_pu_bacteria 2964670856 2964676819 589
324 iso_pu_bacteria 2964678106 2964681875 589
325 iso_pu_bacteria 2964685014 2964688880 589
326 iso_pu_bacteria 2964691889 2964696456 589
327 iso_pu_bacteria 2964698721 2964704422 589
328 iso_pu_bacteria 2964705432 2964706664 589
329 iso_pu_bacteria 2964712639 2964715547 589
330 iso_pu_bacteria 2964719344 2964726339 589
331 iso_pu_bacteria 2967664464 2967665752 589
332 iso_pu_bacteria 2967671571 2967676178 589
333 iso_pu_bacteria 2967678726 2967684672 589
334 iso_pu_bacteria 2967686174 2967689183 589
335 iso_pu_bacteria 2967693043 2967694309 589
336 iso_pu_bacteria 2967699805 2967700939 589
337 iso_pu_bacteria 2967706974 2967708829 589
338 iso_pu_bacteria 2967714385 2967716199 589
339 iso_pu_bacteria 2967721400 2967724323 589
340 iso_pu_bacteria 2967728569 2967732076 589
341 iso_pu_bacteria 2967735183 2967736632 589
342 iso_pu_bacteria 2967742019 2967747901 589
343 iso_pu_bacteria 2967748971 2967752005 589
344 iso_pu_bacteria 2967755722 2967758519 589
345 iso_pu_bacteria 2967762386 2967765583 589
346 iso_pu_bacteria 2967769361 2967772547 589
347 iso_pu_bacteria 2967775926 2967781496 589
348 iso_pu_bacteria 2970019648 2970024499 589
349 iso_pu_bacteria 2970026789 2970030071 589
350 iso_pu_bacteria 2970033650 2970035422 589
351 iso_pu_bacteria 2970040964 2970047038 589
352 iso_pu_bacteria 2970047711 2970048659 589
353 iso_pu_bacteria 2970054988 2970057312 589
354 iso_pu_bacteria 2970061556 2970065869 589
355 iso_pu_bacteria 2970068827 2970071767 589
356 iso_pu_bacteria 2970076120 2970078656 589
357 iso_pu_bacteria 2970082768 2970087160 589
358 iso_pu_bacteria 2970088815 2970090680 589
359 iso_pu_bacteria 2970095765 2970097162 589
360 iso_pu_bacteria 2970102677 2970105246 589
361 iso_pu_bacteria 2970109326 2970110103 589
362 iso_pu_bacteria 2970116247 2970119727 589
363 iso_pu_bacteria 2970122695 2970127301 589
364 iso_pu_bacteria 2970129317 2970135645 589
365 iso_pu_bacteria 2970136068 2970136629 589
366 iso_pu_bacteria 2970143518 2970146790 589
367 iso_pu_bacteria 2970149975 2970155913 589
368 iso_pu_bacteria 2970156795 2970163287 589
369 iso_pu_bacteria 2970164137 2970166673 589
370 iso_pu_bacteria 2970170962 2970173158 589
371 iso_pu_bacteria 2970177841 2970180888 589
372 iso_pu_bacteria 2970184632 2970187504 589
373 iso_pu_bacteria 2970191845 2970194807 589
374 iso_pu_bacteria 2977516862 2977521833 589
375 iso_pu_bacteria 2977523885 2977525388 589
376 iso_pu_bacteria 2977530762 2977534733 589
377 iso_pu_bacteria 2977537788 2977539184 589
378 iso_pu_bacteria 2977544691 2977547492 589
379 iso_pu_bacteria 2977551784 2977555484 589
380 iso_pu_bacteria 2977558990 2977563913 589
381 iso_pu_bacteria 2977565890 2977568517 589
382 iso_pu_bacteria 2977572785 2977575240 589
383 iso_pu_bacteria 2977579622 2977581134 589
384 iso_pu_bacteria 2989349275 2989350206 589
385 iso_pu_bacteria 648276728 648738710 589
386 iso_pu_bacteria 8003992118 8003996662 589
387 iso_pu_bacteria 8003999396 8004004143 589
388 iso_pu_bacteria 8018150411 8018152288 589
389 3300046507 Ga0495606_0007840 Ga0495606_0007840_1705_3480 590
390 3300048924 Ga0496121_0033603 Ga0496121_0033603_853_2628 590
391 iso_pu_bacteria 2510461069 2510840664 590
392 iso_pu_bacteria 2510917022 2511137216 590
393 iso_pu_bacteria 2582581307 2585273394 590
394 iso_pu_bacteria 2585427531 2585564075 590
395 iso_pu_bacteria 2585427608 2585900245 590
396 iso_pu_bacteria 2585427609 2585909198 590
397 iso_pu_bacteria 2585427633 2585997283 590
398 iso_pu_bacteria 2585427634 2586001892 590
399 iso_pu_bacteria 2585428125 2587984700 590
400 iso_pu_bacteria 2599185156 2599335423 590
401 iso_pu_bacteria 2599185236 2599719975 590
402 iso_pu_bacteria 2818991448 2819612489 590
403 iso_pu_bacteria 2818991461 2819686567 590
404 iso_pu_bacteria 2821123053 2821126292 590
405 iso_pu_bacteria 2838736955 2838737232 590
406 iso_pu_bacteria 2841840854 2841842399 590
407 iso_pu_bacteria 2842140634 2842142179 590
408 iso_pu_bacteria 2854896431 2854897405 590
409 iso_pu_bacteria 2854916844 2854921461 590
410 iso_pu_bacteria 2857531043 2857532853 590
411 iso_pu_bacteria 2889790730 2889792490 590
412 iso_pu_bacteria 2889914905 2889919957 590
413 iso_pu_bacteria 2917699015 2917702132 590
414 iso_pu_bacteria 2919171160 2919173579 590
415 iso_pu_bacteria 8005484373 8005484399 590
416 iso_pu_bacteria 8005645114 8005647326 590
417 iso_pu_bacteria 8024486573 8024488643 590
418 3300013102 Ga0157371_10008466 Ga0157371_100084666 591
419 3300046507 Ga0495606_0047727 Ga0495606_0047727_792_2570 591
420 3300047472 Ga0495686_0002724 Ga0495686_0002724_3568_5346 591
421 3300048919 Ga0496116_0000135 Ga0496116_0000135_83397_85178 591
422 3300048921 Ga0496118_0067372 Ga0496118_0067372_394_2172 591
423 3300048926 Ga0496123_0060489 Ga0496123_0060489_25_1806 591
424 3300048929 Ga0496126_0000129 Ga0496126_0000129_29185_30966 591
425 iso_pu_bacteria 2509276021 2509390030 591
426 iso_pu_bacteria 2509276033 2509447717 591
427 iso_pu_bacteria 2510065019 2510134638 591
428 iso_pu_bacteria 2510461076 2510895991 591
429 iso_pu_bacteria 2510917030 2511200395 591
430 iso_pu_bacteria 2513237084 2513573311 591
431 iso_pu_bacteria 2513237085 2513578444 591
432 iso_pu_bacteria 2513237093 2513631525 591
433 iso_pu_bacteria 2513237103 2513710544 591
434 iso_pu_bacteria 2513237144 2513908431 591
435 iso_pu_bacteria 2513237146 2513926760 591
436 iso_pu_bacteria 2513237162 2514023472 591
437 iso_pu_bacteria 2515075009 2515113729 591
438 iso_pu_bacteria 2515154113 2515634595 591
439 iso_pu_bacteria 2515154114 2515645361 591
440 iso_pu_bacteria 2515154116 2515660833 591
441 iso_pu_bacteria 2515154134 2515743447 591
442 iso_pu_bacteria 2516653077 2517037340 591
443 iso_pu_bacteria 2516653085 2517077646 591
444 iso_pu_bacteria 2517093000 2517096439 591
445 iso_pu_bacteria 2517287029 2517410532 591
446 iso_pu_bacteria 2524023209 2524461929 591
447 iso_pu_bacteria 2529292951 2530646764 591
448 iso_pu_bacteria 2582581283 2585169389 591
449 iso_pu_bacteria 2582581298 2585224997 591
450 iso_pu_bacteria 2582581306 2585264436 591
451 iso_pu_bacteria 2582581308 2585283484 591
452 iso_pu_bacteria 2582581315 2585328269 591
453 iso_pu_bacteria 2582581316 2585330679 591
454 iso_pu_bacteria 2582581865 2585389800 591
455 iso_pu_bacteria 2585427526 2585529554 591
456 iso_pu_bacteria 2585427527 2585535947 591
457 iso_pu_bacteria 2585427528 2585541207 591
458 iso_pu_bacteria 2585427529 2585547553 591
459 iso_pu_bacteria 2585427530 2585556706 591
460 iso_pu_bacteria 2585427593 2585839970 591
461 iso_pu_bacteria 2599185170 2599420748 591
462 iso_pu_bacteria 2615840624 2616295370 591
463 iso_pu_bacteria 2615840626 2616312867 591
464 iso_pu_bacteria 2643221607 2644048484 591
465 iso_pu_bacteria 2643221636 2644201845 591
466 iso_pu_bacteria 2643221686 2644481286 591
467 iso_pu_bacteria 2718217882 2719182411 591
468 iso_pu_bacteria 2718217927 2719386986 591
469 iso_pu_bacteria 2718217997 2719666719 591
470 iso_pu_bacteria 2718218009 2719733130 591
471 iso_pu_bacteria 2718218199 2720493139 591
472 iso_pu_bacteria 2718218232 2720614617 591
473 iso_pu_bacteria 2718218233 2720621391 591
474 iso_pu_bacteria 2718218235 2720632717 591
475 iso_pu_bacteria 2718218269 2720776441 591
476 iso_pu_bacteria 2718218363 2721148524 591
477 iso_pu_bacteria 2718218365 2721159909 591
478 iso_pu_bacteria 2718218366 2721165338 591
479 iso_pu_bacteria 2718218423 2721400709 591
480 iso_pu_bacteria 2721755514 2722841508 591
481 iso_pu_bacteria 2721755556 2723028030 591
482 iso_pu_bacteria 2721755684 2723561660 591
483 iso_pu_bacteria 2721755685 2723568289 591
484 iso_pu_bacteria 2721755809 2724039522 591
485 iso_pu_bacteria 2721755810 2724045886 591
486 iso_pu_bacteria 2721755819 2724091048 591
487 iso_pu_bacteria 2721755822 2724105554 591
488 iso_pu_bacteria 2721755823 2724111380 591
489 iso_pu_bacteria 2724679232 2725949757 591
490 iso_pu_bacteria 2728369352 2730108966 591
491 iso_pu_bacteria 2728369365 2730165646 591
492 iso_pu_bacteria 2728369397 2730299541 591
493 iso_pu_bacteria 2738541333 2739035760 591
494 iso_pu_bacteria 2765235942 2766065529 591
495 iso_pu_bacteria 2791355256 2793293830 591
496 iso_pu_bacteria 2791355259 2793313261 591
497 iso_pu_bacteria 2791355260 2793319917 591
498 iso_pu_bacteria 2791355261 2793328072 591
499 iso_pu_bacteria 2791355262 2793333185 591
500 iso_pu_bacteria 2791355263 2793344947 591
501 iso_pu_bacteria 2791355264 2793347179 591
502 iso_pu_bacteria 2791355265 2793356675 591
503 iso_pu_bacteria 2791355266 2793362863 591
504 iso_pu_bacteria 2791355267 2793370110 591
505 iso_pu_bacteria 2802429605 2805931934 591
506 iso_pu_bacteria 2802429606 2805938179 591
507 iso_pu_bacteria 2802429633 2806044748 591
508 iso_pu_bacteria 2802429634 2806056616 591
509 iso_pu_bacteria 2802429635 2806063870 591
510 iso_pu_bacteria 2802429636 2806068089 591
511 iso_pu_bacteria 2802429637 2806074210 591
512 iso_pu_bacteria 2818991453 2819643358 591
513 iso_pu_bacteria 2838016132 2838018915 591
514 iso_pu_bacteria 2838022645 2838024493 591
515 iso_pu_bacteria 2838035591 2838040577 591
516 iso_pu_bacteria 2838042994 2838046437 591
517 iso_pu_bacteria 2838048938 2838051369 591
518 iso_pu_bacteria 2838061910 2838063649 591
519 iso_pu_bacteria 2838068647 2838074224 591
520 iso_pu_bacteria 2838661181 2838668622 591
521 iso_pu_bacteria 2838668709 2838671370 591
522 iso_pu_bacteria 2838680041 2838685153 591
523 iso_pu_bacteria 2838686498 2838691521 591
524 iso_pu_bacteria 2838694306 2838699010 591
525 iso_pu_bacteria 2838701080 2838703449 591
526 iso_pu_bacteria 2838707686 2838712491 591
527 iso_pu_bacteria 2838729681 2838733480 591
528 iso_pu_bacteria 2838742623 2838745948 591
529 iso_pu_bacteria 2841851746 2841853660 591
530 iso_pu_bacteria 2841864319 2841868376 591
531 iso_pu_bacteria 2842077413 2842081968 591
532 iso_pu_bacteria 2842110456 2842113648 591
533 iso_pu_bacteria 2842118031 2842122890 591
534 iso_pu_bacteria 2842146304 2842149549 591
535 iso_pu_bacteria 2842156927 2842162333 591
536 iso_pu_bacteria 2842163707 2842169892 591
537 iso_pu_bacteria 2842180545 2842185259 591
538 iso_pu_bacteria 2842192696 2842197692 591
539 iso_pu_bacteria 2842198810 2842200036 591
540 iso_pu_bacteria 2842205361 2842208113 591
541 iso_pu_bacteria 2842217011 2842220282 591
542 iso_pu_bacteria 2842229732 2842233746 591
543 iso_pu_bacteria 2842237096 2842242207 591
544 iso_pu_bacteria 2842243621 2842247790 591
545 iso_pu_bacteria 2842250916 2842253813 591
546 iso_pu_bacteria 2842257432 2842261942 591
547 iso_pu_bacteria 2842264693 2842266421 591
548 iso_pu_bacteria 2842271015 2842275995 591
549 iso_pu_bacteria 2842278818 2842281878 591
550 iso_pu_bacteria 2842285085 2842288983 591
551 iso_pu_bacteria 2842291075 2842295968 591
552 iso_pu_bacteria 2842298080 2842299997 591
553 iso_pu_bacteria 2842304105 2842308021 591
554 iso_pu_bacteria 2842311132 2842316115 591
555 iso_pu_bacteria 2842317721 2842321623 591
556 iso_pu_bacteria 2842341865 2842344803 591
557 iso_pu_bacteria 2842357229 2842362609 591
558 iso_pu_bacteria 2842363717 2842369418 591
559 iso_pu_bacteria 2842370503 2842377220 591
560 iso_pu_bacteria 2842377471 2842382367 591
561 iso_pu_bacteria 2842384541 2842389768 591
562 iso_pu_bacteria 2842395702 2842401738 591
563 iso_pu_bacteria 2842402390 2842406350 591
564 iso_pu_bacteria 2842409023 2842413223 591
565 iso_pu_bacteria 2842415677 2842419866 591
566 iso_pu_bacteria 2842422224 2842427848 591
567 iso_pu_bacteria 2842428310 2842429740 591
568 iso_pu_bacteria 2842434925 2842436600 591
569 iso_pu_bacteria 2842441272 2842446763 591
570 iso_pu_bacteria 2842447887 2842450830 591
571 iso_pu_bacteria 2842462802 2842464161 591
572 iso_pu_bacteria 2842469257 2842470929 591
573 iso_pu_bacteria 2842489311 2842493042 591
574 iso_pu_bacteria 2842495871 2842499390 591
575 iso_pu_bacteria 2842509118 2842514592 591
576 iso_pu_bacteria 2844454524 2844457774 591
577 iso_pu_bacteria 2852387548 2852387797 591
578 iso_pu_bacteria 2857516855 2857519112 591
579 iso_pu_bacteria 2899803654 2899808777 591
580 iso_pu_bacteria 2919100787 2919104347 591
581 iso_pu_bacteria 2933016740 2933019556 591
582 iso_pu_bacteria 2933570622 2933574471 591
583 iso_pu_bacteria 2933586486 2933589062 591
584 iso_pu_bacteria 2933599457 2933604680 591
585 iso_pu_bacteria 2935894831 2935899927 591
586 iso_pu_bacteria 2935901341 2935907112 591
587 iso_pu_bacteria 2936367885 2936375084 591
588 iso_pu_bacteria 2936375103 2936380760 591
589 iso_pu_bacteria 2936381700 2936382074 591
590 iso_pu_bacteria 2996893221 2996895850 591
591 iso_pu_bacteria 3005409236 3005415694 591
592 iso_pu_bacteria 3005445848 3005449069 591
593 iso_pu_bacteria 639633055 639649763 591
594 iso_pu_bacteria 8005275841 8005281800 591
595 iso_pu_bacteria 8005282627 8005288794 591
596 iso_pu_bacteria 8005289223 8005294484 591
597 iso_pu_bacteria 8005301065 8005306882 591
598 iso_pu_bacteria 8005307578 8005310749 591
599 iso_pu_bacteria 8005376324 8005378384 591
600 iso_pu_bacteria 8005382845 8005385644 591
601 iso_pu_bacteria 8005395548 8005401381 591
602 iso_pu_bacteria 8005430974 8005434315 591
603 iso_pu_bacteria 8005460587 8005464416 591
604 iso_pu_bacteria 8005497431 8005501465 591
605 iso_pu_bacteria 8005556819 8005560897 591
606 iso_pu_bacteria 8005563573 8005566568 591
607 iso_pu_bacteria 8005570704 8005575134 591
608 iso_pu_bacteria 8005619151 8005622827 591
609 iso_pu_bacteria 8005626139 8005631873 591
610 iso_pu_bacteria 8005668836 8005672886 591
611 iso_pu_bacteria 8005688590 8005693371 591
612 iso_pu_bacteria 8005695170 8005700654 591
613 iso_pu_bacteria 8018127388 8018133806 591
614 iso_pu_bacteria 8018163183 8018170012 591
615 iso_pu_bacteria 8018176218 8018178706 591
616 iso_pu_bacteria 8023680758 8023687753 591
617 iso_pu_bacteria 8024479707 8024481578 591
618 iso_pu_bacteria 8024501048 8024506175 591
619 iso_pu_bacteria 8046767195 8046768745 591
620 iso_pu_bacteria 8056375014 8056381390 591
621 iso_pu_bacteria 8056382006 8056386835 591
622 iso_pu_bacteria 8057575449 8057582531 591
623 iso_pu_bacteria 8057874678 8057876614 591
624 3300002773 JGI25152J39213_1002048 JGI25152J39213_10020488 592
625 3300002773 JGI25152J39213_1002126 JGI25152J39213_10021265 592
626 3300002774 JGI25150J39212_1000442 JGI25150J39212_100044213 592
627 3300003187 JGI25151J46595_10001202 JGI25151J46595_1000120214 592
628 3300003215 JGI25153J46596_10003889 JGI25153J46596_100038898 592
629 3300003775 Ga0055524_1006753 Ga0055524_10067534 592
630 3300003775 Ga0055524_1010351 Ga0055524_10103512 592
631 3300003790 Ga0055528_1002930 Ga0055528_10029307 592
632 3300006038 Ga0075365_10000468 Ga0075365_100004684 592
633 3300009763 Ga0123340_1033321 Ga0123340_10333212 592
634 3300009765 Ga0123341_1036814 Ga0123341_10368142 592
635 3300009766 Ga0123342_1018003 Ga0123342_10180035 592
636 3300025245 Ga0207425_1000058 Ga0207425_10000588 592
637 3300025258 Ga0209129_1000107 Ga0209129_10001078 592
638 3300025258 Ga0209129_1007138 Ga0209129_10071383 592
639 3300025273 Ga0209673_1002028 Ga0209673_10020287 592
640 3300025273 Ga0209673_1003790 Ga0209673_10037906 592
641 3300025294 Ga0209025_1000083 Ga0209025_10000838 592
642 3300025294 Ga0209025_1009943 Ga0209025_10099436 592
643 3300025295 Ga0209564_1003015 Ga0209564_10030156 592
644 3300025295 Ga0209564_1004731 Ga0209564_10047314 592
645 3300025297 Ga0209758_1002496 Ga0209758_10024968 592
646 3300025299 Ga0209256_1003354 Ga0209256_10033544 592
647 3300025299 Ga0209256_1004736 Ga0209256_10047364 592
648 3300025302 Ga0207426_1000457 Ga0207426_100045751 592
649 3300027666 Ga0209282_1000008 Ga0209282_1000008166 592
650 3300031911 Ga0307412_10000931 Ga0307412_100009315 592
651 3300031967 Ga0315914_1000011 Ga0315914_10000118 592
652 3300033430 Ga0315913_1008369 Ga0315913_10083697 592
653 3300033464 Ga0315915_1000009 Ga0315915_100000951 592
654 3300046506 Ga0495583_0005215 Ga0495583_0005215_1152_2930 592
655 3300046512 Ga0495610_0001781 Ga0495610_0001781_6153_7931 592
656 3300046519 Ga0495632_0002338 Ga0495632_0002338_11698_13482 592
657 3300047472 Ga0495686_0008537 Ga0495686_0008537_805_2583 592
658 3300048905 Ga0496102_0169990 Ga0496102_0169990_149_1939 592
659 3300048908 Ga0496105_0044780 Ga0496105_0044780_1489_3279 592
660 3300048917 Ga0496114_0078711 Ga0496114_0078711_810_2600 592
661 3300048919 Ga0496116_0072012 Ga0496116_0072012_285_2075 592
662 3300048923 Ga0496120_0014119 Ga0496120_0014119_896_2686 592
663 3300048924 Ga0496121_0015003 Ga0496121_0015003_5293_7071 592
664 3300048925 Ga0496122_0020654 Ga0496122_0020654_1179_2957 592
665 3300048926 Ga0496123_0008844 Ga0496123_0008844_6431_8209 592
666 3300048927 Ga0496124_0021457 Ga0496124_0021457_1180_2958 592
667 3300048927 Ga0496124_0068124 Ga0496124_0068124_1096_2874 592
668 3300048928 Ga0496125_0005933 Ga0496125_0005933_5589_7367 592
669 3300049586 Ga0501070_0003222 Ga0501070_0003222_10202_11986 592
670 iso_pu_bacteria 2537561587 2537874248 592
671 iso_pu_bacteria 2554235003 2554244590 592
672 iso_pu_bacteria 2558860242 2559297570 592
673 iso_pu_bacteria 2599185210 2599604877 592
674 iso_pu_bacteria 2600255279 2601612871 592
675 iso_pu_bacteria 2600255308 2601749600 592
676 iso_pu_bacteria 2643221582 2643922162 592
677 iso_pu_bacteria 2643221693 2644523212 592
678 iso_pu_bacteria 2738541317 2738944677 592
679 iso_pu_bacteria 2808606387 2808989926 592
680 iso_pu_bacteria 2818991439 2819557613 592
681 iso_pu_bacteria 2838675328 2838678853 592
682 iso_pu_bacteria 2838714209 2838717804 592
683 iso_pu_bacteria 2838719591 2838723150 592
684 iso_pu_bacteria 2838724970 2838728521 592
685 iso_pu_bacteria 2841846520 2841849916 592
686 iso_pu_bacteria 2841859092 2841863719 592
687 iso_pu_bacteria 2842124991 2842128388 592
688 iso_pu_bacteria 2842130223 2842133996 592
689 iso_pu_bacteria 2842152218 2842155740 592
690 iso_pu_bacteria 2842170452 2842174050 592
691 iso_pu_bacteria 2842175837 2842179610 592
692 iso_pu_bacteria 2842187318 2842191131 592
693 iso_pu_bacteria 2842211629 2842215446 592
694 iso_pu_bacteria 2842224351 2842227915 592
695 iso_pu_bacteria 2842515876 2842520501 592
696 iso_pu_bacteria 2899792073 2899793784 592
697 iso_pu_bacteria 2899845264 2899847616 592
698 iso_pu_bacteria 2913308742 2913309298 592
699 iso_pu_bacteria 2919114240 2919118084 592
700 iso_pu_bacteria 2926754445 2926757849 592
701 iso_pu_bacteria 2926760298 2926764528 592
702 iso_pu_bacteria 2929138655 2929141460 592
703 iso_pu_bacteria 2933006813 2933006829 592
704 iso_pu_bacteria 2933011516 2933012072 592
705 iso_pu_bacteria 2933594066 2933597331 592
706 iso_pu_bacteria 2978969890 2978970753 592
707 iso_pu_bacteria 2979089926 2979090366 592
708 iso_pu_bacteria 2979095461 2979095892 592
709 iso_pu_bacteria 2979100975 2979102655 592
710 iso_pu_bacteria 2984509177 2984509459 592
711 iso_pu_bacteria 2984518228 2984519841 592
712 iso_pu_bacteria 2984537506 2984537793 592
713 iso_pu_bacteria 2984587000 2984587862 592
714 iso_pu_bacteria 2984601300 2984604536 592
715 iso_pu_bacteria 650716007 650844009 592
716 iso_pu_bacteria 8003570095 8003574471 592
717 iso_pu_bacteria 8054460903 8054463557 592
718 3300005262 Ga0065165_1007048 Ga0065165_10070482 593
719 3300006038 Ga0075365_10000225 Ga0075365_100002255 593
720 3300006051 Ga0075364_10010171 Ga0075364_100101714 593
721 3300006353 Ga0075370_10001391 Ga0075370_100013916 593
722 3300006946 Ga0079104_1000063 Ga0079104_100006340 593
723 3300027111 Ga0209281_1000110 Ga0209281_100011041 593
724 3300028794 Ga0307515_10002178 Ga0307515_1000217825 593
725 3300031456 Ga0307513_10005733 Ga0307513_100057338 593
726 3300046530 Ga0495654_0000121 Ga0495654_0000121_15452_17239 593
727 3300048924 Ga0496121_0003334 Ga0496121_0003334_17104_18891 593
728 3300048924 Ga0496121_0017187 Ga0496121_0017187_3490_5277 593
729 3300048929 Ga0496126_0099224 Ga0496126_0099224_86_1873 593
730 3300050491 nmdc:mga00v17_440_c1 nmdc:mga00v17_440_c1_1750_3537 593
731 3300050492 nmdc:mga0yw44_115_c1 nmdc:mga0yw44_115_c1_16940_18727 593
732 3300053125 Ga0500618_000171 Ga0500618_000171_36963_38750 593
733 3300053125 Ga0500618_002444 Ga0500618_002444_1561_3348 593
734 3300053153 Ga0500616_0000402 Ga0500616_0000402_12202_13989 593
735 iso_pu_bacteria 2600254933 2600373528 593
736 3300002704 JGI25155J39150_1000075 JGI25155J39150_100007519 594
737 3300002705 JGI25156J39149_1000103 JGI25156J39149_100010340 594
738 3300002738 JGI25154J39366_1000018 JGI25154J39366_1000018194 594
739 3300002741 JGI25157J39369_1000074 JGI25157J39369_100007420 594
740 3300002987 JGI25159J45721_1000093 JGI25159J45721_100009333 594
741 3300003187 JGI25151J46595_10001078 JGI25151J46595_100010786 594
742 3300003215 JGI25153J46596_10020647 JGI25153J46596_100206472 594
743 3300003354 JGI25160J50197_1000044 JGI25160J50197_100004440 594
744 3300003354 JGI25160J50197_1003331 JGI25160J50197_10033315 594
745 3300003374 JGI25161J50226_1000028 JGI25161J50226_100002899 594
746 3300003374 JGI25161J50226_1003657 JGI25161J50226_10036572 594
747 3300003771 Ga0055526_1000315 Ga0055526_10003155 594
748 3300003775 Ga0055524_1002103 Ga0055524_10021033 594
749 3300003790 Ga0055528_1003745 Ga0055528_10037453 594
750 3300003856 Ga0058692_1002214 Ga0058692_10022144 594
751 3300004625 Ga0055543_1000054 Ga0055543_100005494 594
752 3300005262 Ga0065165_1002551 Ga0065165_10025513 594
753 3300005548 Ga0070665_100036673 Ga0070665_1000366733 594
754 3300006038 Ga0075365_10000513 Ga0075365_1000051313 594
755 3300006177 Ga0075362_10000666 Ga0075362_100006667 594
756 3300006178 Ga0075367_10001960 Ga0075367_100019607 594
757 3300006195 Ga0075366_10001633 Ga0075366_100016338 594
758 3300006195 Ga0075366_10002954 Ga0075366_100029545 594
759 3300006948 Ga0099826_10000045 Ga0099826_1000004545 594
760 3300006948 Ga0099826_10001193 Ga0099826_100011937 594
761 3300013100 Ga0157373_10002153 Ga0157373_100021537 594
762 3300013102 Ga0157371_10000031 Ga0157371_10000031178 594
763 3300025206 Ga0209435_100044 Ga0209435_10004430 594
764 3300025246 Ga0209646_1000151 Ga0209646_100015130 594
765 3300025250 Ga0209026_1000170 Ga0209026_100017030 594
766 3300025256 Ga0209759_1000186 Ga0209759_100018632 594
767 3300025258 Ga0209129_1002045 Ga0209129_10020457 594
768 3300025273 Ga0209673_1000233 Ga0209673_100023392 594
769 3300025284 Ga0209130_1000093 Ga0209130_100009340 594
770 3300025294 Ga0209025_1000227 Ga0209025_100022768 594
771 3300025294 Ga0209025_1001249 Ga0209025_100124932 594
772 3300025294 Ga0209025_1003257 Ga0209025_10032572 594
773 3300025295 Ga0209564_1000125 Ga0209564_1000125178 594
774 3300025297 Ga0209758_1001294 Ga0209758_100129417 594
775 3300025299 Ga0209256_1000772 Ga0209256_100077214 594
776 3300025302 Ga0207426_1000012 Ga0207426_1000012677 594
777 3300025302 Ga0207426_1000276 Ga0207426_100027690 594
778 3300025303 Ga0209051_1002080 Ga0209051_10020803 594
779 3300027312 Ga0209371_1000283 Ga0209371_100028316 594
780 3300027666 Ga0209282_1000210 Ga0209282_100021027 594
781 3300027666 Ga0209282_1019088 Ga0209282_10190881 594
782 3300028379 Ga0268266_10040657 Ga0268266_100406573 594
783 3300028794 Ga0307515_10024859 Ga0307515_100248595 594
784 3300041492 Ga0451835_0088077 Ga0451835_0088077_84_1871 594
785 3300041507 Ga0451851_0179135 Ga0451851_0179135_13_1800 594
786 3300046460 Ga0495638_0000296 Ga0495638_0000296_6011_7798 594
787 3300046474 Ga0495605_0016036 Ga0495605_0016036_87_1874 594
788 3300046492 Ga0495585_0008558 Ga0495585_0008558_1460_3247 594
789 3300046506 Ga0495583_0014032 Ga0495583_0014032_2148_3935 594
790 3300046507 Ga0495606_0060240 Ga0495606_0060240_383_2173 594
791 3300046512 Ga0495610_0028780 Ga0495610_0028780_1069_2856 594
792 3300046512 Ga0495610_0034396 Ga0495610_0034396_622_2409 594
793 3300046518 Ga0495631_0006867 Ga0495631_0006867_2031_3818 594
794 3300046524 Ga0495648_0004210 Ga0495648_0004210_5489_7276 594
795 3300046538 Ga0495609_0018814 Ga0495609_0018814_1284_3071 594
796 3300046558 Ga0495633_0033652 Ga0495633_0033652_379_2172 594
797 3300046660 Ga0495625_0004692 Ga0495625_0004692_1789_3576 594
798 3300046674 Ga0495588_0000403 Ga0495588_0000403_19358_21151 594
799 3300046675 Ga0495657_0025250 Ga0495657_0025250_68_1855 594
800 3300046810 Ga0495660_0021738 Ga0495660_0021738_1354_3141 594
801 3300047470 Ga0495681_0006325 Ga0495681_0006325_1312_3105 594
802 3300048909 Ga0496106_0000245 Ga0496106_0000245_18282_20069 594
803 3300048916 Ga0496113_0031171 Ga0496113_0031171_2008_3801 594
804 3300048920 Ga0496117_0000030 Ga0496117_0000030_187650_189443 594
805 3300048921 Ga0496118_0001480 Ga0496118_0001480_12064_13857 594
806 3300048922 Ga0496119_0006282 Ga0496119_0006282_3340_5133 594
807 3300048923 Ga0496120_0000047 Ga0496120_0000047_160902_162695 594
808 3300048923 Ga0496120_0033491 Ga0496120_0033491_748_2535 594
809 3300048924 Ga0496121_0000003 Ga0496121_0000003_1089052_1090845 594
810 3300048924 Ga0496121_0028791 Ga0496121_0028791_2400_4187 594
811 3300048924 Ga0496121_0041506 Ga0496121_0041506_1151_2941 594
812 3300048924 Ga0496121_0098308 Ga0496121_0098308_382_2172 594
813 3300048925 Ga0496122_0000076 Ga0496122_0000076_199559_201352 594
814 3300048925 Ga0496122_0018249 Ga0496122_0018249_3800_5593 594
815 3300048926 Ga0496123_0000023 Ga0496123_0000023_145543_147336 594
816 3300048927 Ga0496124_0000239 Ga0496124_0000239_24837_26630 594
817 3300048927 Ga0496124_0015352 Ga0496124_0015352_897_2690 594
818 3300048928 Ga0496125_0000200 Ga0496125_0000200_99321_101114 594
819 3300048928 Ga0496125_0040483 Ga0496125_0040483_1704_3491 594
820 3300048928 Ga0496125_0093971 Ga0496125_0093971_100_1887 594
821 3300048929 Ga0496126_0048201 Ga0496126_0048201_522_2312 594
822 3300049579 Ga0501043_0111150 Ga0501043_0111150_342_2129 594
823 3300049589 Ga0501073_0035804 Ga0501073_0035804_1259_3046 594
824 3300049744 Ga0501083_0037163 Ga0501083_0037163_846_2633 594
825 3300050491 nmdc:mga00v17_4_c1 nmdc:mga00v17_4_c1_44941_46734 594
826 3300050493 nmdc:mga0k408_3667_c1 nmdc:mga0k408_3667_c1_226_2013 594
827 3300050516 nmdc:mga0sz30_2179_c1 nmdc:mga0sz30_2179_c1_1719_3512 594
828 3300053107 Ga0500560_000988 Ga0500560_000988_582_2375 594
829 3300053107 Ga0500560_003847 Ga0500560_003847_311_2104 594
830 3300053108 Ga0500562_009003 Ga0500562_009003_236_2023 594
831 3300053111 Ga0500572_001695 Ga0500572_001695_3470_5263 594
832 3300053137 Ga0500561_0001003 Ga0500561_0001003_1367_3160 594
833 3300053139 Ga0500568_0001930 Ga0500568_0001930_4063_5850 594
834 3300053139 Ga0500568_0007386 Ga0500568_0007386_1978_3765 594
835 3300053139 Ga0500568_0012695 Ga0500568_0012695_844_2631 594
836 3300053140 Ga0500573_0024362 Ga0500573_0024362_893_2719 594
837 3300053153 Ga0500616_0005862 Ga0500616_0005862_1060_2847 594
838 3300053160 Ga0500633_0001006 Ga0500633_0001006_2460_4247 594
839 3300053177 Ga0500636_0000039 Ga0500636_0000039_5061_6854 594
840 3300053177 Ga0500636_0002338 Ga0500636_0002338_1146_2939 594
841 3300060353 Ga0501082_0037735 Ga0501082_0037735_1357_3144 594

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13382

Adenine_deam_C

Adenine deaminase C-terminal domain

429

598

0.9

PF01979

Amidohydro_1

Amidohydrolase family

95

380

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t8l-assembly1.cif.gz_A crystal structure of adenine deaminase with mn/fe 0.9927 7 592
3t81-assembly1.cif.gz_B crystal structure of diiron adenine deaminase 0.992 7 592
3t8l-assembly1.cif.gz_A crystal structure of adenine deaminase with mn/fe 0.9893 7 592
3t81-assembly1.cif.gz_B crystal structure of diiron adenine deaminase 0.9886 7 592
2p50-assembly1.cif.gz_B crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn 0.7642 32 368
ID Description Score Start End Superfamily
3t8lA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9957 7 84 2.30.40.10
3nqbB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9945 85 330 3.20.20.140
3nqbB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9904 85 330 3.20.20.140
af_Q58854_63_300_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9364 87 330 3.20.20.140
af_Q58854_63_300_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9288 87 330 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A6G1WIE8-F1-model_v4 Adenine deaminase (Adenase) (Adenine aminase) (EC 3.5.4.2) 0.9948 9 594 GO:0000034
GO:0006146
AF-J4TA19-F1-model_v4 Adenine deaminase (Adenase) (Adenine aminase) (EC 3.5.4.2) 0.9946 5 594 GO:0000034
GO:0006146
AF-A0A7H4NFQ7-F1-model_v4 deleted 0.9943 15 347
AF-A0A7Y7J206-F1-model_v4 Adenine deaminase 0.9938 164 336 GO:0016787
AF-F7UET7-F1-model_v4 deleted 0.9937 7 594

Feature Viewer

pLDDT pTM Quality
92.64 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map