F483111
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 841 | 670 | 332 | 589 |
Family's Representative Sequence
| Representative Sequence | 3300053140|Ga0500573_0024362|Ga0500573_0024362_893_2719 |
| Length | 608 |
| Sequence | MSSGFNSDGAGANPDDAVAKAEADLNDDALRTRAVIAARGDAPFDVLIAGGTLVDMVTGELRAADIGLIGPLIASVHAPGSRTDAAETIDATGSFVSPGLIDTHMHIESSMVTPATYAGAVLPRGVTTLVWDPHEFGNVHGIVGVRWAVDAVAKLPLRVIVLAPSCVPSAPGLELAGADFDADVLAELLSWPGIGGIAEVMTMRGVIDRDPRMSGILQAGLASRKLICGHARSLAGADLNAFIAAGVSSDHELTSGDDLMQKLRAGLTIELRGSHDHLLPEFVEVLNTLGHLPQTLTLCTDDVFPDDLVKGGGLDDVVRRLVRYGLKPQWALQAATLNAAVRLGRADLGLVATGRRADLVLFEDLSDFRARHVFADGVRIASDGTMQVALKDADPAPLHGSMKIAPLTTDDFRIPSTGTRAKLATIDRPRFTRWGEIEADVADGFVVPPQGVTMIAVAHRHGFSDSRPRVGFLTGWGDWRGAFATTISHDSHNLTVFGGNPQDMAVAANAVIAAGGGMAVASNGRVEALMPLPLSGLVSDRPMDEVATGFDRLRSAMDGVIDWQPPYLIFKACFGATLACNAGPHQTDRGIADVGTGRVLENPVLEVF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 2 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 3 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 4 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 5 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 6 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 7 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 8 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 9 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 10 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 11 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 12 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 13 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 14 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 15 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 16 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 17 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 18 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 19 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 20 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 21 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 22 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 23 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 24 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 25 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 26 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 27 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 28 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 29 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 30 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 31 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 32 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 33 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 34 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 35 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 36 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 37 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 38 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 39 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 40 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 41 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 42 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 43 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 44 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 45 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 46 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 47 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 48 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 49 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 50 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 51 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 52 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 53 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 54 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 55 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 56 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 57 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 58 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 59 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 60 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 61 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 62 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 63 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 64 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 65 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 66 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 67 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 68 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 69 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 70 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 71 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 72 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 73 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 74 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 75 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 76 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 77 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 78 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 79 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 80 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 81 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 82 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 83 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 84 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 85 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 86 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 87 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 88 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 89 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 90 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 91 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 92 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 93 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 94 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 95 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 96 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 97 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 98 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 99 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 100 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 101 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 102 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 103 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 104 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 105 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 106 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 107 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 108 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 109 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 110 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 111 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 112 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 113 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 114 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 115 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 116 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 117 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 118 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 119 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 120 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 121 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 122 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 123 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 124 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 125 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 126 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 127 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 128 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 129 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 130 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 131 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 132 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 133 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 134 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 135 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 136 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 137 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 138 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 139 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 140 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 141 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 142 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 143 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 144 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 145 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 146 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 147 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 148 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 149 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 150 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 151 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 152 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 153 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 154 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 155 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 156 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 157 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 158 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 159 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 160 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 161 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 162 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 163 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 164 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 165 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 166 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 167 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 168 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 169 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 170 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 171 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 172 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 173 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 174 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 175 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 176 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 177 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 178 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 179 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 180 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 181 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 182 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 183 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 184 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 185 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 186 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 187 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 188 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 189 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 190 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 191 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 192 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 193 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 194 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 195 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 196 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 197 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 198 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 199 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 200 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 201 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 202 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 203 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 204 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 205 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 206 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 207 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 208 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 209 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 210 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 211 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 212 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 213 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 214 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 215 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 216 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 217 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 218 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 219 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 220 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 221 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 222 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 223 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 224 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 225 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 226 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 227 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 228 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 229 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 230 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 231 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 232 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 233 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 234 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 235 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 236 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 237 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 238 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 239 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 240 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 241 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 242 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 243 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 244 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 245 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 246 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 247 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 248 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 249 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 250 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 251 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 252 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 253 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 254 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 255 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 256 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 257 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 258 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 259 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 260 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 261 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 262 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 263 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 264 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 265 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 266 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 267 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 268 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 269 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 270 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 271 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 272 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 273 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 274 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 275 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 276 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 277 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 278 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 279 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 280 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 281 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 282 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 283 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 284 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 285 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 286 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 287 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 288 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 289 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 290 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 291 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 292 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 293 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 294 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 295 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 296 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 297 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 298 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 299 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 300 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 301 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 302 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 303 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 304 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 305 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 306 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 307 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 308 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 309 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 310 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 311 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 312 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 313 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 314 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 315 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 316 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 317 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 318 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 319 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 320 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 321 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 322 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 323 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 324 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 325 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 326 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 327 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 328 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 329 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 330 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 331 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 332 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 333 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 334 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 335 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 336 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 337 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 338 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 339 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 340 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 341 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 342 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 343 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 344 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 345 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 346 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 347 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 348 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 349 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 350 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 351 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 352 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 353 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 354 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 355 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 356 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 357 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 358 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 359 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 360 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 361 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 362 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 363 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 364 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 365 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 366 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 367 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 368 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 369 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 370 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 371 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 372 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 373 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 374 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 375 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 376 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 377 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 378 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 379 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 380 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 381 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 382 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 383 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 384 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 385 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 386 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 387 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 388 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 389 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 390 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 391 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 392 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 393 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 394 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 395 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 396 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 397 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 398 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 399 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 400 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 401 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 402 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 403 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 404 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 405 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 406 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 407 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 408 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 409 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 410 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 411 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 412 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 413 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 414 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 415 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 416 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 417 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 418 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 419 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 420 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 421 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 422 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 423 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 424 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 425 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 426 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 427 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 428 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 429 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 430 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 431 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 432 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 433 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 434 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 435 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 436 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 437 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 438 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 439 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 440 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 441 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 442 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 443 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 444 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 445 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 446 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 447 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 448 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 449 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 450 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 451 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 452 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 453 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 454 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 455 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 456 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 457 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 458 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 459 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 460 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 461 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 462 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 463 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 464 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 465 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 466 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 467 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 468 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 469 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 470 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 471 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 472 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 473 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 474 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 475 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 476 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 477 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 478 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 479 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 480 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 481 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 482 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 483 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 484 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 485 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 486 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 487 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 488 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 489 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 490 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 491 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 492 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 493 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 494 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 495 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 496 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 497 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 498 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 499 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 500 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 501 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 502 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 503 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 504 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 505 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 506 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 507 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 508 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 509 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 510 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 511 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 512 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 513 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 514 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 515 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 516 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 517 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 518 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 519 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 520 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 521 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 522 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 523 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 524 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 525 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 526 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 527 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 528 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 529 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 530 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 531 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 532 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 533 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 534 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 535 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 536 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 537 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 538 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 539 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 540 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 541 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 542 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 543 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 544 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 545 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 546 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 547 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 548 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 549 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 550 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 551 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 552 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 553 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 576 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 577 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 578 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 579 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 580 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 581 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 582 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 583 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 584 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 585 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 586 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 587 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 588 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 589 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 590 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 591 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 592 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 593 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 594 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 595 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 596 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 597 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 598 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 599 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 600 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 601 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 602 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 603 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 606 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 607 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 608 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 609 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 610 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 611 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 612 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 613 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 614 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 615 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 616 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 617 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 618 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 619 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 620 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 621 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 622 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 623 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 624 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 625 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 626 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 627 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 628 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 629 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 630 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 631 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 632 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 633 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 634 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 635 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 636 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 637 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 638 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 639 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 640 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 641 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 642 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 643 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 644 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 645 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 646 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 647 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 648 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 649 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 650 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 651 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 652 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 653 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 654 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 655 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 656 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 657 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 658 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 659 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 660 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 661 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 662 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 663 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 664 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 665 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 666 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 667 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 668 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 669 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 670 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 39.48 |
| Metatranscriptomes | 0 |
| Isolates | 60.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.59 |
| Bulb | 0 |
| Endosphere | 17.84 |
| Nodule | 46.97 |
| Rhizoplane | 1.9 |
| Rhizosphere | 14.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000075 | 3300002704 | Bacteria | 62215 |
| 2 | JGI25156J39149_1000103 | 3300002705 | Bacteria | 62289 |
| 3 | JGI25154J39366_1000018 | 3300002738 | Bacteria | 251612 |
| 4 | JGI25158J39367_1000138 | 3300002739 | Bacteria | 17170 |
| 5 | JGI25157J39369_1000074 | 3300002741 | Bacteria | 88240 |
| 6 | JGI25152J39213_1002048 | 3300002773 | Bacteria | 7939 |
| 7 | JGI25152J39213_1002126 | 3300002773 | Bacteria | 7768 |
| 8 | JGI25152J39213_1003957 | 3300002773 | Bacteria | 4839 |
| 9 | JGI25152J39213_1004690 | 3300002773 | Bacteria | 4228 |
| 10 | JGI25150J39212_1000442 | 3300002774 | Bacteria | 18447 |
| 11 | JGI25150J39212_1002790 | 3300002774 | Bacteria | 4240 |
| 12 | JGI25159J45721_1000093 | 3300002987 | Bacteria | 42171 |
| 13 | JGI25159J45721_1000100 | 3300002987 | Bacteria | 41372 |
| 14 | JGI25159J45721_1000155 | 3300002987 | Bacteria | 32010 |
| 15 | JGI25159J45721_1000377 | 3300002987 | Bacteria | 20611 |
| 16 | JGI25151J46595_10001078 | 3300003187 | Bacteria | 20347 |
| 17 | JGI25151J46595_10001202 | 3300003187 | Bacteria | 18543 |
| 18 | JGI25151J46595_10005841 | 3300003187 | Bacteria | 6296 |
| 19 | JGI25153J46596_10000831 | 3300003215 | Bacteria | 18867 |
| 20 | JGI25153J46596_10002447 | 3300003215 | Bacteria | 10708 |
| 21 | JGI25153J46596_10003889 | 3300003215 | Bacteria | 8207 |
| 22 | JGI25153J46596_10020647 | 3300003215 | Bacteria | 2484 |
| 23 | rootH1_10021345 | 3300003316 | Bacteria | 5305 |
| 24 | rootH2_10045351 | 3300003320 | Bacteria | 5746 |
| 25 | rootH1_10045123 | 3300003323 | Bacteria | 8064 |
| 26 | JGI25160J50197_1000044 | 3300003354 | Bacteria | 145379 |
| 27 | JGI25160J50197_1000086 | 3300003354 | Bacteria | 94046 |
| 28 | JGI25160J50197_1003331 | 3300003354 | Bacteria | 7227 |
| 29 | JGI25160J50197_1007513 | 3300003354 | Bacteria | 4256 |
| 30 | JGI25161J50226_1000028 | 3300003374 | Bacteria | 145379 |
| 31 | JGI25161J50226_1000389 | 3300003374 | Bacteria | 22186 |
| 32 | JGI25161J50226_1000442 | 3300003374 | Bacteria | 19513 |
| 33 | JGI25161J50226_1003657 | 3300003374 | Bacteria | 3445 |
| 34 | Ga0055526_1000315 | 3300003771 | Bacteria | 40330 |
| 35 | Ga0055526_1000664 | 3300003771 | Bacteria | 26413 |
| 36 | Ga0055526_1000684 | 3300003771 | Bacteria | 25937 |
| 37 | Ga0055524_1001602 | 3300003775 | Bacteria | 12666 |
| 38 | Ga0055524_1002103 | 3300003775 | Bacteria | 10524 |
| 39 | Ga0055524_1006753 | 3300003775 | Bacteria | 4954 |
| 40 | Ga0055524_1010351 | 3300003775 | Bacteria | 3719 |
| 41 | Ga0055536_1009876 | 3300003781 | Bacteria | 3877 |
| 42 | Ga0055528_1000176 | 3300003790 | Bacteria | 54005 |
| 43 | Ga0055528_1000649 | 3300003790 | Bacteria | 25297 |
| 44 | Ga0055528_1002930 | 3300003790 | Bacteria | 8847 |
| 45 | Ga0055528_1003745 | 3300003790 | Bacteria | 7505 |
| 46 | Ga0055530_10008223 | 3300003791 | Bacteria | 4218 |
| 47 | Ga0055540_1000301 | 3300003792 | Bacteria | 43713 |
| 48 | Ga0055531_10003561 | 3300003794 | Bacteria | 9888 |
| 49 | Ga0058692_1002214 | 3300003856 | Bacteria | 6624 |
| 50 | Ga0055543_1000054 | 3300004625 | Bacteria | 104176 |
| 51 | Ga0055543_1000166 | 3300004625 | Bacteria | 55052 |
| 52 | Ga0055543_1000296 | 3300004625 | Bacteria | 35540 |
| 53 | Ga0065165_1000813 | 3300005262 | Bacteria | 41429 |
| 54 | Ga0065165_1002551 | 3300005262 | Bacteria | 15100 |
| 55 | Ga0065165_1007048 | 3300005262 | Bacteria | 5656 |
| 56 | Ga0065165_1009258 | 3300005262 | Bacteria | 4444 |
| 57 | Ga0070665_100036673 | 3300005548 | Bacteria | 4930 |
| 58 | Ga0068851_10026760 | 3300005834 | Bacteria | 2837 |
| 59 | Ga0075365_10000225 | 3300006038 | Bacteria | 19139 |
| 60 | Ga0075365_10000468 | 3300006038 | Bacteria | 15201 |
| 61 | Ga0075365_10000513 | 3300006038 | Bacteria | 14784 |
| 62 | Ga0075364_10010171 | 3300006051 | Bacteria | 5673 |
| 63 | Ga0075362_10000666 | 3300006177 | Bacteria | 10135 |
| 64 | Ga0075367_10001960 | 3300006178 | Bacteria | 9154 |
| 65 | Ga0075366_10001633 | 3300006195 | Bacteria | 11244 |
| 66 | Ga0075366_10002954 | 3300006195 | Bacteria | 8853 |
| 67 | Ga0075370_10001391 | 3300006353 | Bacteria | 10430 |
| 68 | Ga0079104_1000063 | 3300006946 | Bacteria | 159519 |
| 69 | Ga0099826_10000045 | 3300006948 | Bacteria | 75912 |
| 70 | Ga0099826_10001193 | 3300006948 | Bacteria | 15076 |
| 71 | Ga0105240_10000910 | 3300009093 | Bacteria | 52855 |
| 72 | Ga0105237_10001371 | 3300009545 | Bacteria | 32139 |
| 73 | Ga0123340_1033321 | 3300009763 | Bacteria | 2918 |
| 74 | Ga0123341_1000068 | 3300009765 | Bacteria | 44096 |
| 75 | Ga0123341_1036814 | 3300009765 | Bacteria | 3368 |
| 76 | Ga0123342_1007954 | 3300009766 | Bacteria | 13684 |
| 77 | Ga0123342_1018003 | 3300009766 | Bacteria | 5736 |
| 78 | Ga0157373_10002153 | 3300013100 | Bacteria | 14906 |
| 79 | Ga0157371_10000031 | 3300013102 | Bacteria | 230441 |
| 80 | Ga0157371_10008466 | 3300013102 | Bacteria | 8188 |
| 81 | Ga0157370_10000909 | 3300013104 | Bacteria | 37515 |
| 82 | Ga0171463_1010 | 3300013249 | Bacteria | 269975 |
| 83 | Ga0171462_1032 | 3300013250 | Bacteria | 98473 |
| 84 | Ga0182007_10009371 | 3300015262 | Bacteria | 3951 |
| 85 | Ga0183363_1036 | 3300015690 | Bacteria | 44926 |
| 86 | Ga0209435_100044 | 3300025206 | Bacteria | 99051 |
| 87 | Ga0209436_100023 | 3300025208 | Bacteria | 96401 |
| 88 | Ga0209436_100046 | 3300025208 | Bacteria | 68624 |
| 89 | Ga0209437_105282 | 3300025233 | Bacteria | 2207 |
| 90 | Ga0207425_1000058 | 3300025245 | Bacteria | 149214 |
| 91 | Ga0207425_1005226 | 3300025245 | Bacteria | 3732 |
| 92 | Ga0209646_1000151 | 3300025246 | Bacteria | 99050 |
| 93 | Ga0209026_1000170 | 3300025250 | Bacteria | 99050 |
| 94 | Ga0209677_101845 | 3300025253 | Bacteria | 8621 |
| 95 | Ga0209759_1000186 | 3300025256 | Bacteria | 100413 |
| 96 | Ga0209129_1000107 | 3300025258 | Bacteria | 154705 |
| 97 | Ga0209129_1000242 | 3300025258 | Bacteria | 58534 |
| 98 | Ga0209129_1000313 | 3300025258 | Bacteria | 43280 |
| 99 | Ga0209129_1002045 | 3300025258 | Bacteria | 10414 |
| 100 | Ga0209129_1007138 | 3300025258 | Bacteria | 3404 |
| 101 | Ga0209233_1000232 | 3300025261 | Bacteria | 96361 |
| 102 | Ga0209673_1000060 | 3300025273 | Bacteria | 263602 |
| 103 | Ga0209673_1000233 | 3300025273 | Bacteria | 108504 |
| 104 | Ga0209673_1000978 | 3300025273 | Bacteria | 35222 |
| 105 | Ga0209673_1000980 | 3300025273 | Bacteria | 35156 |
| 106 | Ga0209673_1002028 | 3300025273 | Bacteria | 15416 |
| 107 | Ga0209673_1003790 | 3300025273 | Bacteria | 8588 |
| 108 | Ga0209673_1008248 | 3300025273 | Bacteria | 4659 |
| 109 | Ga0209673_1013495 | 3300025273 | Bacteria | 3220 |
| 110 | Ga0209130_1000074 | 3300025284 | Bacteria | 173309 |
| 111 | Ga0209130_1000093 | 3300025284 | Bacteria | 145707 |
| 112 | Ga0209130_1000173 | 3300025284 | Bacteria | 92248 |
| 113 | Ga0209676_1002284 | 3300025292 | Bacteria | 14013 |
| 114 | Ga0209676_1014822 | 3300025292 | Bacteria | 2908 |
| 115 | Ga0209025_1000083 | 3300025294 | Bacteria | 265556 |
| 116 | Ga0209025_1000227 | 3300025294 | Bacteria | 132244 |
| 117 | Ga0209025_1000758 | 3300025294 | Bacteria | 53948 |
| 118 | Ga0209025_1001147 | 3300025294 | Bacteria | 37727 |
| 119 | Ga0209025_1001249 | 3300025294 | Bacteria | 35273 |
| 120 | Ga0209025_1002601 | 3300025294 | Bacteria | 18601 |
| 121 | Ga0209025_1003257 | 3300025294 | Bacteria | 15637 |
| 122 | Ga0209025_1009943 | 3300025294 | Bacteria | 6534 |
| 123 | Ga0209025_1024890 | 3300025294 | Bacteria | 3072 |
| 124 | Ga0209564_1000116 | 3300025295 | Bacteria | 207889 |
| 125 | Ga0209564_1000125 | 3300025295 | Bacteria | 201709 |
| 126 | Ga0209564_1000856 | 3300025295 | Bacteria | 40580 |
| 127 | Ga0209564_1001100 | 3300025295 | Bacteria | 32100 |
| 128 | Ga0209564_1003015 | 3300025295 | Bacteria | 12035 |
| 129 | Ga0209564_1004731 | 3300025295 | Bacteria | 8150 |
| 130 | Ga0209564_1018564 | 3300025295 | Bacteria | 2643 |
| 131 | Ga0209758_1000105 | 3300025297 | Bacteria | 221415 |
| 132 | Ga0209758_1001294 | 3300025297 | Bacteria | 30724 |
| 133 | Ga0209758_1002006 | 3300025297 | Bacteria | 21897 |
| 134 | Ga0209758_1002496 | 3300025297 | Bacteria | 18680 |
| 135 | Ga0209758_1012628 | 3300025297 | Bacteria | 4705 |
| 136 | Ga0209050_1002732 | 3300025298 | Bacteria | 14233 |
| 137 | Ga0209050_1007855 | 3300025298 | Bacteria | 5859 |
| 138 | Ga0209256_1000164 | 3300025299 | Bacteria | 135612 |
| 139 | Ga0209256_1000302 | 3300025299 | Bacteria | 86634 |
| 140 | Ga0209256_1000772 | 3300025299 | Bacteria | 41509 |
| 141 | Ga0209256_1001023 | 3300025299 | Bacteria | 32869 |
| 142 | Ga0209256_1003354 | 3300025299 | Bacteria | 11347 |
| 143 | Ga0209256_1003614 | 3300025299 | Bacteria | 10610 |
| 144 | Ga0209256_1004736 | 3300025299 | Bacteria | 8318 |
| 145 | Ga0209256_1008028 | 3300025299 | Bacteria | 5003 |
| 146 | Ga0209256_1015179 | 3300025299 | Bacteria | 2712 |
| 147 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 148 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 149 | Ga0207426_1000165 | 3300025302 | Bacteria | 170244 |
| 150 | Ga0207426_1000276 | 3300025302 | Bacteria | 106148 |
| 151 | Ga0207426_1000457 | 3300025302 | Bacteria | 64140 |
| 152 | Ga0209051_1000217 | 3300025303 | Bacteria | 97218 |
| 153 | Ga0209051_1001739 | 3300025303 | Bacteria | 17361 |
| 154 | Ga0209051_1002080 | 3300025303 | Bacteria | 15103 |
| 155 | Ga0209051_1003444 | 3300025303 | Bacteria | 10367 |
| 156 | Ga0209051_1003642 | 3300025303 | Bacteria | 9974 |
| 157 | Ga0209257_1002649 | 3300025304 | Bacteria | 17210 |
| 158 | Ga0209257_1007475 | 3300025304 | Bacteria | 6582 |
| 159 | Ga0209257_1012210 | 3300025304 | Bacteria | 4007 |
| 160 | Ga0207695_10000427 | 3300025913 | Bacteria | 93089 |
| 161 | Ga0207671_10000288 | 3300025914 | Bacteria | 74500 |
| 162 | Ga0209281_1000110 | 3300027111 | Bacteria | 215631 |
| 163 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 164 | Ga0209371_1000283 | 3300027312 | Bacteria | 58483 |
| 165 | Ga0209282_1000008 | 3300027666 | Bacteria | 248526 |
| 166 | Ga0209282_1000210 | 3300027666 | Bacteria | 31123 |
| 167 | Ga0209282_1019088 | 3300027666 | Bacteria | 4349 |
| 168 | Ga0268266_10040657 | 3300028379 | Bacteria | 3964 |
| 169 | Ga0307515_10002178 | 3300028794 | Bacteria | 43027 |
| 170 | Ga0307515_10006437 | 3300028794 | Bacteria | 23488 |
| 171 | Ga0307515_10024859 | 3300028794 | Bacteria | 10399 |
| 172 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 173 | Ga0307513_10005733 | 3300031456 | Bacteria | 16340 |
| 174 | Ga0307412_10000931 | 3300031911 | Bacteria | 16734 |
| 175 | Ga0315914_1000011 | 3300031967 | Bacteria | 170175 |
| 176 | Ga0315913_1008369 | 3300033430 | Bacteria | 12281 |
| 177 | Ga0315915_1000009 | 3300033464 | Bacteria | 252178 |
| 178 | Ga0439465_0011461 | 3300041413 | Bacteria | 2782 |
| 179 | Ga0451835_0088077 | 3300041492 | Bacteria | 4679 |
| 180 | Ga0451851_0179135 | 3300041507 | Bacteria | 4344 |
| 181 | Ga0451851_1079014 | 3300041507 | Bacteria | 5114 |
| 182 | Ga0451843_1290610 | 3300041509 | Bacteria | 3899 |
| 183 | Ga0451853_2456616 | 3300041512 | Bacteria | 3654 |
| 184 | Ga0466970_0072540 | 3300044765 | Bacteria | 1852 |
| 185 | Ga0451576_0145110 | 3300045051 | Bacteria | 2474 |
| 186 | Ga0495638_0000296 | 3300046460 | Bacteria | 64130 |
| 187 | Ga0495605_0010740 | 3300046474 | Bacteria | 5116 |
| 188 | Ga0495605_0016036 | 3300046474 | Bacteria | 4064 |
| 189 | Ga0495585_0008558 | 3300046492 | Bacteria | 6197 |
| 190 | Ga0495607_0099594 | 3300046501 | Bacteria | 1559 |
| 191 | Ga0495583_0005215 | 3300046506 | Bacteria | 8926 |
| 192 | Ga0495583_0014032 | 3300046506 | Bacteria | 4435 |
| 193 | Ga0495606_0007840 | 3300046507 | Bacteria | 9428 |
| 194 | Ga0495606_0047727 | 3300046507 | Bacteria | 2822 |
| 195 | Ga0495606_0060240 | 3300046507 | Bacteria | 2432 |
| 196 | Ga0495610_0001781 | 3300046512 | Bacteria | 18812 |
| 197 | Ga0495610_0006011 | 3300046512 | Bacteria | 8480 |
| 198 | Ga0495610_0028780 | 3300046512 | Bacteria | 2934 |
| 199 | Ga0495610_0034396 | 3300046512 | Bacteria | 2611 |
| 200 | Ga0495616_0027989 | 3300046513 | Bacteria | 2987 |
| 201 | Ga0495620_0016122 | 3300046515 | Bacteria | 3759 |
| 202 | Ga0495631_0006867 | 3300046518 | Bacteria | 5839 |
| 203 | Ga0495632_0002338 | 3300046519 | Bacteria | 14540 |
| 204 | Ga0495632_0007786 | 3300046519 | Bacteria | 6677 |
| 205 | Ga0495648_0004210 | 3300046524 | Bacteria | 12355 |
| 206 | Ga0495654_0000121 | 3300046530 | Bacteria | 86743 |
| 207 | Ga0495609_0018814 | 3300046538 | Bacteria | 3200 |
| 208 | Ga0495633_0033652 | 3300046558 | Bacteria | 2471 |
| 209 | Ga0495625_0004692 | 3300046660 | Bacteria | 12814 |
| 210 | Ga0495625_0012879 | 3300046660 | Bacteria | 6758 |
| 211 | Ga0495588_0000403 | 3300046674 | Bacteria | 24269 |
| 212 | Ga0495588_0014783 | 3300046674 | Bacteria | 3744 |
| 213 | Ga0495657_0025250 | 3300046675 | Bacteria | 4223 |
| 214 | Ga0495660_0004528 | 3300046810 | Bacteria | 8400 |
| 215 | Ga0495660_0021738 | 3300046810 | Bacteria | 3669 |
| 216 | Ga0495687_019733 | 3300047443 | Bacteria | 3299 |
| 217 | Ga0495681_0006325 | 3300047470 | Bacteria | 7796 |
| 218 | Ga0495686_0002724 | 3300047472 | Bacteria | 16159 |
| 219 | Ga0495686_0008537 | 3300047472 | Bacteria | 7510 |
| 220 | Ga0496100_0007860 | 3300048903 | Bacteria | 5920 |
| 221 | Ga0496102_0169990 | 3300048905 | Bacteria | 2052 |
| 222 | Ga0496103_0008885 | 3300048906 | Bacteria | 5960 |
| 223 | Ga0496105_0044780 | 3300048908 | Bacteria | 3650 |
| 224 | Ga0496106_0000245 | 3300048909 | Bacteria | 37807 |
| 225 | Ga0496111_0000967 | 3300048914 | Bacteria | 15693 |
| 226 | Ga0496113_0031171 | 3300048916 | Bacteria | 3867 |
| 227 | Ga0496113_0106764 | 3300048916 | Bacteria | 2175 |
| 228 | Ga0496114_0078711 | 3300048917 | Bacteria | 2781 |
| 229 | Ga0496116_0000135 | 3300048919 | Bacteria | 153165 |
| 230 | Ga0496116_0009606 | 3300048919 | Bacteria | 8231 |
| 231 | Ga0496116_0009916 | 3300048919 | Bacteria | 8054 |
| 232 | Ga0496116_0053210 | 3300048919 | Bacteria | 2675 |
| 233 | Ga0496116_0072012 | 3300048919 | Bacteria | 2186 |
| 234 | Ga0496117_0000030 | 3300048920 | Bacteria | 389141 |
| 235 | Ga0496117_0006452 | 3300048920 | Bacteria | 11866 |
| 236 | Ga0496118_0001480 | 3300048921 | Bacteria | 35175 |
| 237 | Ga0496118_0004045 | 3300048921 | Bacteria | 17813 |
| 238 | Ga0496118_0009207 | 3300048921 | Bacteria | 10030 |
| 239 | Ga0496118_0067372 | 3300048921 | Bacteria | 2607 |
| 240 | Ga0496119_0006282 | 3300048922 | Bacteria | 11079 |
| 241 | Ga0496119_0032496 | 3300048922 | Bacteria | 3477 |
| 242 | Ga0496120_0000047 | 3300048923 | Bacteria | 190569 |
| 243 | Ga0496120_0014119 | 3300048923 | Bacteria | 5335 |
| 244 | Ga0496120_0033491 | 3300048923 | Bacteria | 3087 |
| 245 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 246 | Ga0496121_0003334 | 3300048924 | Bacteria | 23044 |
| 247 | Ga0496121_0005225 | 3300048924 | Bacteria | 16807 |
| 248 | Ga0496121_0015003 | 3300048924 | Bacteria | 8157 |
| 249 | Ga0496121_0017187 | 3300048924 | Bacteria | 7408 |
| 250 | Ga0496121_0020201 | 3300048924 | Bacteria | 6609 |
| 251 | Ga0496121_0021842 | 3300048924 | Bacteria | 6249 |
| 252 | Ga0496121_0028791 | 3300048924 | Bacteria | 5161 |
| 253 | Ga0496121_0033603 | 3300048924 | Bacteria | 4637 |
| 254 | Ga0496121_0037981 | 3300048924 | Bacteria | 4271 |
| 255 | Ga0496121_0041506 | 3300048924 | Bacteria | 4019 |
| 256 | Ga0496121_0087345 | 3300048924 | Bacteria | 2448 |
| 257 | Ga0496121_0098308 | 3300048924 | Bacteria | 2265 |
| 258 | Ga0496121_0119752 | 3300048924 | Bacteria | 1990 |
| 259 | Ga0496122_0000076 | 3300048925 | Bacteria | 218690 |
| 260 | Ga0496122_0000107 | 3300048925 | Bacteria | 193163 |
| 261 | Ga0496122_0005592 | 3300048925 | Bacteria | 14877 |
| 262 | Ga0496122_0010818 | 3300048925 | Bacteria | 9345 |
| 263 | Ga0496122_0018249 | 3300048925 | Bacteria | 6495 |
| 264 | Ga0496122_0020654 | 3300048925 | Bacteria | 5934 |
| 265 | Ga0496122_0049201 | 3300048925 | Bacteria | 3232 |
| 266 | Ga0496122_0051781 | 3300048925 | Bacteria | 3115 |
| 267 | Ga0496122_0070137 | 3300048925 | Bacteria | 2506 |
| 268 | Ga0496123_0000023 | 3300048926 | Bacteria | 346894 |
| 269 | Ga0496123_0000063 | 3300048926 | Bacteria | 216072 |
| 270 | Ga0496123_0008844 | 3300048926 | Bacteria | 9175 |
| 271 | Ga0496123_0010369 | 3300048926 | Bacteria | 8248 |
| 272 | Ga0496123_0013766 | 3300048926 | Bacteria | 6759 |
| 273 | Ga0496123_0043085 | 3300048926 | Bacteria | 3105 |
| 274 | Ga0496123_0060489 | 3300048926 | Bacteria | 2442 |
| 275 | Ga0496123_0064194 | 3300048926 | Bacteria | 2341 |
| 276 | Ga0496124_0000239 | 3300048927 | Bacteria | 106633 |
| 277 | Ga0496124_0001919 | 3300048927 | Bacteria | 28475 |
| 278 | Ga0496124_0015352 | 3300048927 | Bacteria | 7348 |
| 279 | Ga0496124_0021457 | 3300048927 | Bacteria | 5949 |
| 280 | Ga0496124_0041525 | 3300048927 | Bacteria | 3968 |
| 281 | Ga0496124_0049203 | 3300048927 | Bacteria | 3597 |
| 282 | Ga0496124_0068124 | 3300048927 | Bacteria | 2959 |
| 283 | Ga0496125_0000200 | 3300048928 | Bacteria | 126369 |
| 284 | Ga0496125_0005933 | 3300048928 | Bacteria | 13384 |
| 285 | Ga0496125_0014144 | 3300048928 | Bacteria | 7787 |
| 286 | Ga0496125_0040483 | 3300048928 | Bacteria | 3997 |
| 287 | Ga0496125_0093971 | 3300048928 | Bacteria | 2236 |
| 288 | Ga0496126_0000129 | 3300048929 | Bacteria | 174059 |
| 289 | Ga0496126_0048201 | 3300048929 | Bacteria | 3895 |
| 290 | Ga0496126_0099224 | 3300048929 | Bacteria | 2551 |
| 291 | Ga0501031_0000005 | 3300049568 | Bacteria | 183960 |
| 292 | Ga0501032_0000337 | 3300049569 | Bacteria | 39238 |
| 293 | Ga0501033_0000631 | 3300049570 | Bacteria | 32526 |
| 294 | Ga0501034_0001953 | 3300049571 | Bacteria | 26109 |
| 295 | Ga0501036_0000014 | 3300049572 | Bacteria | 148705 |
| 296 | Ga0501037_0000517 | 3300049573 | Bacteria | 30998 |
| 297 | Ga0501038_0000024 | 3300049574 | Bacteria | 148705 |
| 298 | Ga0501039_0000122 | 3300049575 | Bacteria | 53871 |
| 299 | Ga0501040_0001738 | 3300049576 | Bacteria | 13985 |
| 300 | Ga0501043_0000987 | 3300049579 | Bacteria | 25068 |
| 301 | Ga0501043_0111150 | 3300049579 | Bacteria | 2151 |
| 302 | Ga0501047_0001328 | 3300049581 | Bacteria | 24254 |
| 303 | Ga0501070_0002802 | 3300049586 | Bacteria | 15213 |
| 304 | Ga0501070_0003222 | 3300049586 | Bacteria | 14197 |
| 305 | Ga0501073_0035804 | 3300049589 | Bacteria | 3527 |
| 306 | Ga0501083_0037163 | 3300049744 | Bacteria | 3317 |
| 307 | Ga0501035_0000045 | 3300049822 | Bacteria | 148705 |
| 308 | Ga0501044_0000044 | 3300049823 | Bacteria | 148705 |
| 309 | nmdc:mga00v17_440_c1 | 3300050491 | Bacteria | 22734 |
| 310 | nmdc:mga00v17_4_c1 | 3300050491 | Bacteria | 238758 |
| 311 | nmdc:mga0yw44_115_c1 | 3300050492 | Bacteria | 24900 |
| 312 | nmdc:mga0k408_3667_c1 | 3300050493 | Bacteria | 8124 |
| 313 | nmdc:mga0sz30_2179_c1 | 3300050516 | Bacteria | 7005 |
| 314 | Ga0500560_000988 | 3300053107 | Bacteria | 4549 |
| 315 | Ga0500560_003847 | 3300053107 | Bacteria | 3103 |
| 316 | Ga0500562_009003 | 3300053108 | Bacteria | 2522 |
| 317 | Ga0500572_001695 | 3300053111 | Bacteria | 5748 |
| 318 | Ga0500618_000171 | 3300053125 | Bacteria | 54421 |
| 319 | Ga0500618_002444 | 3300053125 | Bacteria | 6999 |
| 320 | Ga0500618_008100 | 3300053125 | Bacteria | 2954 |
| 321 | Ga0500658_0000185 | 3300053134 | Bacteria | 29770 |
| 322 | Ga0500561_0001003 | 3300053137 | Bacteria | 4525 |
| 323 | Ga0500568_0001930 | 3300053139 | Bacteria | 12712 |
| 324 | Ga0500568_0007386 | 3300053139 | Bacteria | 5393 |
| 325 | Ga0500568_0012695 | 3300053139 | Bacteria | 3865 |
| 326 | Ga0500573_0024362 | 3300053140 | Bacteria | 3479 |
| 327 | Ga0500616_0000402 | 3300053153 | Bacteria | 59210 |
| 328 | Ga0500616_0005862 | 3300053153 | Bacteria | 8225 |
| 329 | Ga0500633_0001006 | 3300053160 | Bacteria | 4998 |
| 330 | Ga0500636_0000039 | 3300053177 | Bacteria | 69891 |
| 331 | Ga0500636_0002338 | 3300053177 | Bacteria | 10526 |
| 332 | Ga0501082_0037735 | 3300060353 | Bacteria | 4167 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0072540 | Ga0466970_0072540_368_1837 | 488 |
| 2 | iso_pu_bacteria | 2510917026 | 2511174801 | 489 |
| 3 | 3300046501 | Ga0495607_0099594 | Ga0495607_0099594_11_1528 | 504 |
| 4 | 3300048924 | Ga0496121_0087345 | Ga0496121_0087345_40_1566 | 504 |
| 5 | 3300048926 | Ga0496123_0064194 | Ga0496123_0064194_11_1537 | 504 |
| 6 | 3300046519 | Ga0495632_0007786 | Ga0495632_0007786_4992_6662 | 543 |
| 7 | 3300003354 | JGI25160J50197_1007513 | JGI25160J50197_10075132 | 562 |
| 8 | 3300025294 | Ga0209025_1001147 | Ga0209025_100114718 | 562 |
| 9 | 3300002987 | JGI25159J45721_1000100 | JGI25159J45721_100010026 | 565 |
| 10 | 3300002987 | JGI25159J45721_1000155 | JGI25159J45721_10001558 | 565 |
| 11 | 3300003354 | JGI25160J50197_1000086 | JGI25160J50197_100008673 | 565 |
| 12 | 3300003374 | JGI25161J50226_1000442 | JGI25161J50226_100044216 | 565 |
| 13 | 3300003771 | Ga0055526_1000684 | Ga0055526_10006846 | 565 |
| 14 | 3300003794 | Ga0055531_10003561 | Ga0055531_100035618 | 565 |
| 15 | 3300004625 | Ga0055543_1000296 | Ga0055543_100029626 | 565 |
| 16 | 3300005262 | Ga0065165_1000813 | Ga0065165_100081326 | 565 |
| 17 | 3300025208 | Ga0209436_100046 | Ga0209436_10004667 | 565 |
| 18 | 3300025284 | Ga0209130_1000074 | Ga0209130_100007489 | 565 |
| 19 | 3300025292 | Ga0209676_1002284 | Ga0209676_10022847 | 565 |
| 20 | 3300025294 | Ga0209025_1000758 | Ga0209025_100075815 | 565 |
| 21 | 3300025295 | Ga0209564_1000856 | Ga0209564_100085626 | 565 |
| 22 | 3300025298 | Ga0209050_1002732 | Ga0209050_100273211 | 565 |
| 23 | 3300025299 | Ga0209256_1008028 | Ga0209256_10080282 | 565 |
| 24 | 3300025302 | Ga0207426_1000165 | Ga0207426_100016589 | 565 |
| 25 | 3300025303 | Ga0209051_1003642 | Ga0209051_10036429 | 565 |
| 26 | 3300025304 | Ga0209257_1002649 | Ga0209257_10026498 | 565 |
| 27 | 3300003775 | Ga0055524_1001602 | Ga0055524_10016028 | 570 |
| 28 | 3300048925 | Ga0496122_0049201 | Ga0496122_0049201_999_2789 | 574 |
| 29 | 3300048925 | Ga0496122_0070137 | Ga0496122_0070137_55_1845 | 574 |
| 30 | 3300013249 | Ga0171463_1010 | Ga0171463_101091 | 575 |
| 31 | 3300015690 | Ga0183363_1036 | Ga0183363_103622 | 575 |
| 32 | 3300013250 | Ga0171462_1032 | Ga0171462_103258 | 578 |
| 33 | 3300048925 | Ga0496122_0000107 | Ga0496122_0000107_168479_170269 | 578 |
| 34 | 3300048926 | Ga0496123_0000063 | Ga0496123_0000063_22840_24630 | 578 |
| 35 | 3300053125 | Ga0500618_008100 | Ga0500618_008100_59_1846 | 578 |
| 36 | 3300003792 | Ga0055540_1000301 | Ga0055540_100030130 | 579 |
| 37 | 3300005834 | Ga0068851_10026760 | Ga0068851_100267602 | 579 |
| 38 | 3300009093 | Ga0105240_10000910 | Ga0105240_1000091030 | 579 |
| 39 | 3300009545 | Ga0105237_10001371 | Ga0105237_1000137130 | 579 |
| 40 | 3300013104 | Ga0157370_10000909 | Ga0157370_1000090927 | 579 |
| 41 | 3300015262 | Ga0182007_10009371 | Ga0182007_100093712 | 579 |
| 42 | 3300025233 | Ga0209437_105282 | Ga0209437_1052822 | 579 |
| 43 | 3300025253 | Ga0209677_101845 | Ga0209677_1018456 | 579 |
| 44 | 3300025261 | Ga0209233_1000232 | Ga0209233_10002326 | 579 |
| 45 | 3300025273 | Ga0209673_1000980 | Ga0209673_100098015 | 579 |
| 46 | 3300025298 | Ga0209050_1007855 | Ga0209050_10078552 | 579 |
| 47 | 3300025299 | Ga0209256_1000164 | Ga0209256_100016429 | 579 |
| 48 | 3300025303 | Ga0209051_1000217 | Ga0209051_100021717 | 579 |
| 49 | 3300025304 | Ga0209257_1007475 | Ga0209257_10074753 | 579 |
| 50 | 3300025913 | Ga0207695_10000427 | Ga0207695_1000042730 | 579 |
| 51 | 3300025914 | Ga0207671_10000288 | Ga0207671_1000028843 | 579 |
| 52 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003359 | 579 |
| 53 | 3300028794 | Ga0307515_10006437 | Ga0307515_1000643722 | 579 |
| 54 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004692 | 579 |
| 55 | 3300048903 | Ga0496100_0007860 | Ga0496100_0007860_3985_5772 | 579 |
| 56 | 3300048906 | Ga0496103_0008885 | Ga0496103_0008885_560_2347 | 579 |
| 57 | 3300048916 | Ga0496113_0106764 | Ga0496113_0106764_352_2139 | 579 |
| 58 | 3300048920 | Ga0496117_0006452 | Ga0496117_0006452_5609_7396 | 579 |
| 59 | 3300048921 | Ga0496118_0004045 | Ga0496118_0004045_962_2749 | 579 |
| 60 | 3300048921 | Ga0496118_0009207 | Ga0496118_0009207_1446_3233 | 579 |
| 61 | 3300048922 | Ga0496119_0032496 | Ga0496119_0032496_563_2350 | 579 |
| 62 | 3300048924 | Ga0496121_0005225 | Ga0496121_0005225_5478_7265 | 579 |
| 63 | 3300048925 | Ga0496122_0010818 | Ga0496122_0010818_5113_6900 | 579 |
| 64 | 3300048926 | Ga0496123_0010369 | Ga0496123_0010369_4188_5975 | 579 |
| 65 | 3300048928 | Ga0496125_0014144 | Ga0496125_0014144_2188_3975 | 579 |
| 66 | iso_pu_bacteria | 2643221557 | 2643809046 | 579 |
| 67 | iso_pu_bacteria | 2643221610 | 2644069109 | 579 |
| 68 | iso_pu_bacteria | 2643221668 | 2644378639 | 579 |
| 69 | iso_pu_bacteria | 2643221675 | 2644420180 | 579 |
| 70 | iso_pu_bacteria | 2643221680 | 2644453587 | 579 |
| 71 | iso_pu_bacteria | 2643221726 | 2644692286 | 579 |
| 72 | 3300048914 | Ga0496111_0000967 | Ga0496111_0000967_991_2778 | 580 |
| 73 | 3300002739 | JGI25158J39367_1000138 | JGI25158J39367_10001383 | 581 |
| 74 | 3300002773 | JGI25152J39213_1004690 | JGI25152J39213_10046903 | 581 |
| 75 | 3300002774 | JGI25150J39212_1002790 | JGI25150J39212_10027903 | 581 |
| 76 | 3300003215 | JGI25153J46596_10000831 | JGI25153J46596_100008315 | 581 |
| 77 | 3300003215 | JGI25153J46596_10002447 | JGI25153J46596_100024472 | 581 |
| 78 | 3300003374 | JGI25161J50226_1000389 | JGI25161J50226_10003893 | 581 |
| 79 | 3300003771 | Ga0055526_1000664 | Ga0055526_10006648 | 581 |
| 80 | 3300003781 | Ga0055536_1009876 | Ga0055536_10098762 | 581 |
| 81 | 3300003790 | Ga0055528_1000649 | Ga0055528_100064924 | 581 |
| 82 | 3300003791 | Ga0055530_10008223 | Ga0055530_100082232 | 581 |
| 83 | 3300004625 | Ga0055543_1000166 | Ga0055543_100016617 | 581 |
| 84 | 3300005262 | Ga0065165_1009258 | Ga0065165_10092582 | 581 |
| 85 | 3300009765 | Ga0123341_1000068 | Ga0123341_100006828 | 581 |
| 86 | 3300009766 | Ga0123342_1007954 | Ga0123342_10079547 | 581 |
| 87 | 3300025208 | Ga0209436_100023 | Ga0209436_10002321 | 581 |
| 88 | 3300025245 | Ga0207425_1005226 | Ga0207425_10052262 | 581 |
| 89 | 3300025258 | Ga0209129_1000313 | Ga0209129_100031317 | 581 |
| 90 | 3300025273 | Ga0209673_1000060 | Ga0209673_100006017 | 581 |
| 91 | 3300025273 | Ga0209673_1008248 | Ga0209673_10082483 | 581 |
| 92 | 3300025273 | Ga0209673_1013495 | Ga0209673_10134952 | 581 |
| 93 | 3300025284 | Ga0209130_1000173 | Ga0209130_100017317 | 581 |
| 94 | 3300025292 | Ga0209676_1014822 | Ga0209676_10148222 | 581 |
| 95 | 3300025294 | Ga0209025_1024890 | Ga0209025_10248902 | 581 |
| 96 | 3300025295 | Ga0209564_1000116 | Ga0209564_100011617 | 581 |
| 97 | 3300025295 | Ga0209564_1001100 | Ga0209564_100110017 | 581 |
| 98 | 3300025297 | Ga0209758_1000105 | Ga0209758_100010591 | 581 |
| 99 | 3300025297 | Ga0209758_1002006 | Ga0209758_10020063 | 581 |
| 100 | 3300025297 | Ga0209758_1012628 | Ga0209758_10126282 | 581 |
| 101 | 3300025299 | Ga0209256_1000302 | Ga0209256_100030285 | 581 |
| 102 | 3300025299 | Ga0209256_1003614 | Ga0209256_10036148 | 581 |
| 103 | 3300025299 | Ga0209256_1015179 | Ga0209256_10151792 | 581 |
| 104 | 3300025302 | Ga0207426_1000047 | Ga0207426_100004717 | 581 |
| 105 | 3300025303 | Ga0209051_1001739 | Ga0209051_100173910 | 581 |
| 106 | 3300025303 | Ga0209051_1003444 | Ga0209051_10034444 | 581 |
| 107 | 3300025304 | Ga0209257_1012210 | Ga0209257_10122102 | 581 |
| 108 | 3300041413 | Ga0439465_0011461 | Ga0439465_0011461_918_2705 | 581 |
| 109 | 3300041507 | Ga0451851_1079014 | Ga0451851_1079014_1884_3671 | 581 |
| 110 | 3300041509 | Ga0451843_1290610 | Ga0451843_1290610_600_2387 | 581 |
| 111 | 3300046474 | Ga0495605_0010740 | Ga0495605_0010740_2127_3914 | 581 |
| 112 | 3300046512 | Ga0495610_0006011 | Ga0495610_0006011_1352_3139 | 581 |
| 113 | 3300046513 | Ga0495616_0027989 | Ga0495616_0027989_749_2536 | 581 |
| 114 | 3300046515 | Ga0495620_0016122 | Ga0495620_0016122_58_1845 | 581 |
| 115 | 3300046660 | Ga0495625_0012879 | Ga0495625_0012879_2046_3833 | 581 |
| 116 | 3300046810 | Ga0495660_0004528 | Ga0495660_0004528_5075_6862 | 581 |
| 117 | 3300048924 | Ga0496121_0020201 | Ga0496121_0020201_2174_3964 | 581 |
| 118 | 3300048924 | Ga0496121_0021842 | Ga0496121_0021842_544_2334 | 581 |
| 119 | 3300048927 | Ga0496124_0049203 | Ga0496124_0049203_954_2744 | 581 |
| 120 | 3300053134 | Ga0500658_0000185 | Ga0500658_0000185_23947_25734 | 581 |
| 121 | 3300003316 | rootH1_10021345 | rootH1_100213453 | 582 |
| 122 | 3300003320 | rootH2_10045351 | rootH2_100453513 | 582 |
| 123 | 3300003323 | rootH1_10045123 | rootH1_100451234 | 582 |
| 124 | 3300045051 | Ga0451576_0145110 | Ga0451576_0145110_191_1978 | 582 |
| 125 | 3300049568 | Ga0501031_0000005 | Ga0501031_0000005_173669_175468 | 582 |
| 126 | 3300049569 | Ga0501032_0000337 | Ga0501032_0000337_29661_31460 | 582 |
| 127 | 3300049570 | Ga0501033_0000631 | Ga0501033_0000631_22949_24748 | 582 |
| 128 | 3300049571 | Ga0501034_0001953 | Ga0501034_0001953_16532_18331 | 582 |
| 129 | 3300049572 | Ga0501036_0000014 | Ga0501036_0000014_7779_9578 | 582 |
| 130 | 3300049573 | Ga0501037_0000517 | Ga0501037_0000517_7779_9578 | 582 |
| 131 | 3300049574 | Ga0501038_0000024 | Ga0501038_0000024_7779_9578 | 582 |
| 132 | 3300049575 | Ga0501039_0000122 | Ga0501039_0000122_44294_46093 | 582 |
| 133 | 3300049576 | Ga0501040_0001738 | Ga0501040_0001738_5169_6968 | 582 |
| 134 | 3300049579 | Ga0501043_0000987 | Ga0501043_0000987_15514_17313 | 582 |
| 135 | 3300049581 | Ga0501047_0001328 | Ga0501047_0001328_5960_7759 | 582 |
| 136 | 3300049586 | Ga0501070_0002802 | Ga0501070_0002802_12345_14144 | 582 |
| 137 | 3300049822 | Ga0501035_0000045 | Ga0501035_0000045_139128_140927 | 582 |
| 138 | 3300049823 | Ga0501044_0000044 | Ga0501044_0000044_7779_9578 | 582 |
| 139 | iso_pu_bacteria | 2551306086 | 2551691252 | 582 |
| 140 | 3300002987 | JGI25159J45721_1000377 | JGI25159J45721_100037715 | 583 |
| 141 | iso_pu_bacteria | 2891048133 | 2891049877 | 583 |
| 142 | 3300046674 | Ga0495588_0014783 | Ga0495588_0014783_1311_3071 | 586 |
| 143 | 3300047443 | Ga0495687_019733 | Ga0495687_019733_902_2662 | 586 |
| 144 | 3300048919 | Ga0496116_0009606 | Ga0496116_0009606_5149_6909 | 586 |
| 145 | 3300048919 | Ga0496116_0009916 | Ga0496116_0009916_1118_2878 | 586 |
| 146 | 3300048919 | Ga0496116_0053210 | Ga0496116_0053210_809_2569 | 586 |
| 147 | 3300048924 | Ga0496121_0037981 | Ga0496121_0037981_1224_2984 | 586 |
| 148 | 3300048924 | Ga0496121_0119752 | Ga0496121_0119752_167_1927 | 586 |
| 149 | 3300048925 | Ga0496122_0005592 | Ga0496122_0005592_8642_10435 | 586 |
| 150 | 3300048925 | Ga0496122_0051781 | Ga0496122_0051781_441_2201 | 586 |
| 151 | 3300048926 | Ga0496123_0013766 | Ga0496123_0013766_4817_6577 | 586 |
| 152 | 3300048926 | Ga0496123_0043085 | Ga0496123_0043085_904_2664 | 586 |
| 153 | 3300048927 | Ga0496124_0001919 | Ga0496124_0001919_24705_26465 | 586 |
| 154 | 3300048927 | Ga0496124_0041525 | Ga0496124_0041525_981_2741 | 586 |
| 155 | 3300002773 | JGI25152J39213_1003957 | JGI25152J39213_10039571 | 587 |
| 156 | 3300003187 | JGI25151J46595_10005841 | JGI25151J46595_100058413 | 587 |
| 157 | 3300025258 | Ga0209129_1000242 | Ga0209129_100024251 | 587 |
| 158 | 3300025294 | Ga0209025_1002601 | Ga0209025_100260111 | 587 |
| 159 | 3300041512 | Ga0451853_2456616 | Ga0451853_2456616_64_1854 | 587 |
| 160 | iso_pu_bacteria | 2534681796 | 2535519632 | 587 |
| 161 | 3300003790 | Ga0055528_1000176 | Ga0055528_10001762 | 588 |
| 162 | 3300025273 | Ga0209673_1000978 | Ga0209673_100097817 | 588 |
| 163 | 3300025295 | Ga0209564_1018564 | Ga0209564_10185642 | 588 |
| 164 | 3300025299 | Ga0209256_1001023 | Ga0209256_100102310 | 588 |
| 165 | iso_pu_bacteria | 2510917028 | 2511186792 | 588 |
| 166 | iso_pu_bacteria | 2513237088 | 2513600568 | 588 |
| 167 | iso_pu_bacteria | 2513237138 | 2513867638 | 588 |
| 168 | iso_pu_bacteria | 2524023207 | 2524449644 | 588 |
| 169 | iso_pu_bacteria | 2582581294 | 2585204829 | 588 |
| 170 | iso_pu_bacteria | 2582581299 | 2585233816 | 588 |
| 171 | iso_pu_bacteria | 2582581304 | 2585257580 | 588 |
| 172 | iso_pu_bacteria | 2582581867 | 2585403440 | 588 |
| 173 | iso_pu_bacteria | 2585427590 | 2585823737 | 588 |
| 174 | iso_pu_bacteria | 2585427594 | 2585845132 | 588 |
| 175 | iso_pu_bacteria | 2643221599 | 2644006208 | 588 |
| 176 | iso_pu_bacteria | 2643221634 | 2644195779 | 588 |
| 177 | iso_pu_bacteria | 2643221643 | 2644241658 | 588 |
| 178 | iso_pu_bacteria | 2738541293 | 2738800651 | 588 |
| 179 | iso_pu_bacteria | 2923556063 | 2923562618 | 588 |
| 180 | iso_pu_bacteria | 2996887358 | 2996890037 | 588 |
| 181 | iso_pu_bacteria | 3005452660 | 3005455349 | 588 |
| 182 | iso_pu_bacteria | 8005258706 | 8005262224 | 588 |
| 183 | iso_pu_bacteria | 8005321885 | 8005324564 | 588 |
| 184 | iso_pu_bacteria | 8005542996 | 8005547334 | 588 |
| 185 | iso_pu_bacteria | 8005658619 | 8005661920 | 588 |
| 186 | iso_pu_bacteria | 2511231052 | 2511498146 | 589 |
| 187 | iso_pu_bacteria | 2512875026 | 2512969458 | 589 |
| 188 | iso_pu_bacteria | 2513237086 | 2513586001 | 589 |
| 189 | iso_pu_bacteria | 2513237089 | 2513606360 | 589 |
| 190 | iso_pu_bacteria | 2513237091 | 2513618184 | 589 |
| 191 | iso_pu_bacteria | 2513237140 | 2513885098 | 589 |
| 192 | iso_pu_bacteria | 2513237143 | 2513905600 | 589 |
| 193 | iso_pu_bacteria | 2513237156 | 2513988670 | 589 |
| 194 | iso_pu_bacteria | 2513237160 | 2514008072 | 589 |
| 195 | iso_pu_bacteria | 2515154107 | 2515610700 | 589 |
| 196 | iso_pu_bacteria | 2516653046 | 2516896210 | 589 |
| 197 | iso_pu_bacteria | 2517487022 | 2517565663 | 589 |
| 198 | iso_pu_bacteria | 2551306085 | 2551685000 | 589 |
| 199 | iso_pu_bacteria | 2551306089 | 2551710281 | 589 |
| 200 | iso_pu_bacteria | 2599185352 | 2600197506 | 589 |
| 201 | iso_pu_bacteria | 2643221558 | 2643813419 | 589 |
| 202 | iso_pu_bacteria | 2643221568 | 2643853655 | 589 |
| 203 | iso_pu_bacteria | 2643221618 | 2644104746 | 589 |
| 204 | iso_pu_bacteria | 2643221626 | 2644151177 | 589 |
| 205 | iso_pu_bacteria | 2643221637 | 2644207891 | 589 |
| 206 | iso_pu_bacteria | 2643221655 | 2644313165 | 589 |
| 207 | iso_pu_bacteria | 2643221659 | 2644336251 | 589 |
| 208 | iso_pu_bacteria | 2643221698 | 2644547088 | 589 |
| 209 | iso_pu_bacteria | 2643221712 | 2644612788 | 589 |
| 210 | iso_pu_bacteria | 2643221718 | 2644651166 | 589 |
| 211 | iso_pu_bacteria | 2643221723 | 2644674527 | 589 |
| 212 | iso_pu_bacteria | 2802428858 | 2802721321 | 589 |
| 213 | iso_pu_bacteria | 2802428859 | 2802728263 | 589 |
| 214 | iso_pu_bacteria | 2802428860 | 2802733921 | 589 |
| 215 | iso_pu_bacteria | 2802428861 | 2802740657 | 589 |
| 216 | iso_pu_bacteria | 2802428862 | 2802746942 | 589 |
| 217 | iso_pu_bacteria | 2802428863 | 2802748696 | 589 |
| 218 | iso_pu_bacteria | 2844163670 | 2844169704 | 589 |
| 219 | iso_pu_bacteria | 2855839649 | 2855844082 | 589 |
| 220 | iso_pu_bacteria | 2858800743 | 2858806668 | 589 |
| 221 | iso_pu_bacteria | 2915980308 | 2915985909 | 589 |
| 222 | iso_pu_bacteria | 2915986958 | 2915991666 | 589 |
| 223 | iso_pu_bacteria | 2915993759 | 2915998365 | 589 |
| 224 | iso_pu_bacteria | 2916000859 | 2916006705 | 589 |
| 225 | iso_pu_bacteria | 2916007675 | 2916009798 | 589 |
| 226 | iso_pu_bacteria | 2916014648 | 2916016708 | 589 |
| 227 | iso_pu_bacteria | 2916021584 | 2916024288 | 589 |
| 228 | iso_pu_bacteria | 2916028427 | 2916030369 | 589 |
| 229 | iso_pu_bacteria | 2916035215 | 2916039451 | 589 |
| 230 | iso_pu_bacteria | 2916041962 | 2916047588 | 589 |
| 231 | iso_pu_bacteria | 2916048683 | 2916049693 | 589 |
| 232 | iso_pu_bacteria | 2916055098 | 2916060954 | 589 |
| 233 | iso_pu_bacteria | 2916061851 | 2916063042 | 589 |
| 234 | iso_pu_bacteria | 2916068649 | 2916070056 | 589 |
| 235 | iso_pu_bacteria | 2916076590 | 2916081166 | 589 |
| 236 | iso_pu_bacteria | 2919166419 | 2919168084 | 589 |
| 237 | iso_pu_bacteria | 2920822456 | 2920826703 | 589 |
| 238 | iso_pu_bacteria | 2921201388 | 2921206952 | 589 |
| 239 | iso_pu_bacteria | 2921208531 | 2921213446 | 589 |
| 240 | iso_pu_bacteria | 2921237296 | 2921242899 | 589 |
| 241 | iso_pu_bacteria | 2921244191 | 2921248841 | 589 |
| 242 | iso_pu_bacteria | 2921250672 | 2921256566 | 589 |
| 243 | iso_pu_bacteria | 2921257292 | 2921262941 | 589 |
| 244 | iso_pu_bacteria | 2921263974 | 2921269057 | 589 |
| 245 | iso_pu_bacteria | 2921282425 | 2921288984 | 589 |
| 246 | iso_pu_bacteria | 2921289301 | 2921295577 | 589 |
| 247 | iso_pu_bacteria | 2924144063 | 2924145103 | 589 |
| 248 | iso_pu_bacteria | 2924150972 | 2924156831 | 589 |
| 249 | iso_pu_bacteria | 2924158325 | 2924162149 | 589 |
| 250 | iso_pu_bacteria | 2924165586 | 2924169215 | 589 |
| 251 | iso_pu_bacteria | 2924172951 | 2924173813 | 589 |
| 252 | iso_pu_bacteria | 2924179722 | 2924185693 | 589 |
| 253 | iso_pu_bacteria | 2924186466 | 2924192294 | 589 |
| 254 | iso_pu_bacteria | 2924193448 | 2924196197 | 589 |
| 255 | iso_pu_bacteria | 2924200457 | 2924203726 | 589 |
| 256 | iso_pu_bacteria | 2924207177 | 2924209601 | 589 |
| 257 | iso_pu_bacteria | 2924214083 | 2924221556 | 589 |
| 258 | iso_pu_bacteria | 2924221636 | 2924226615 | 589 |
| 259 | iso_pu_bacteria | 2924228884 | 2924231287 | 589 |
| 260 | iso_pu_bacteria | 2936996657 | 2937002314 | 589 |
| 261 | iso_pu_bacteria | 2937002841 | 2937003584 | 589 |
| 262 | iso_pu_bacteria | 2937009748 | 2937012096 | 589 |
| 263 | iso_pu_bacteria | 2937016420 | 2937017456 | 589 |
| 264 | iso_pu_bacteria | 2937023124 | 2937024964 | 589 |
| 265 | iso_pu_bacteria | 2937029754 | 2937033283 | 589 |
| 266 | iso_pu_bacteria | 2937036028 | 2937040605 | 589 |
| 267 | iso_pu_bacteria | 2937042894 | 2937043812 | 589 |
| 268 | iso_pu_bacteria | 2937056579 | 2937058242 | 589 |
| 269 | iso_pu_bacteria | 2937071275 | 2937074323 | 589 |
| 270 | iso_pu_bacteria | 2937078374 | 2937083739 | 589 |
| 271 | iso_pu_bacteria | 2937084907 | 2937086395 | 589 |
| 272 | iso_pu_bacteria | 2937091812 | 2937097556 | 589 |
| 273 | iso_pu_bacteria | 2937098957 | 2937102420 | 589 |
| 274 | iso_pu_bacteria | 2937106411 | 2937111083 | 589 |
| 275 | iso_pu_bacteria | 2937113482 | 2937114797 | 589 |
| 276 | iso_pu_bacteria | 2937119839 | 2937122884 | 589 |
| 277 | iso_pu_bacteria | 2937126314 | 2937126937 | 589 |
| 278 | iso_pu_bacteria | 2941499720 | 2941504382 | 589 |
| 279 | iso_pu_bacteria | 2957375807 | 2957379178 | 589 |
| 280 | iso_pu_bacteria | 2957382221 | 2957383235 | 589 |
| 281 | iso_pu_bacteria | 2957388812 | 2957390531 | 589 |
| 282 | iso_pu_bacteria | 2957395598 | 2957399423 | 589 |
| 283 | iso_pu_bacteria | 2957402308 | 2957403531 | 589 |
| 284 | iso_pu_bacteria | 2957408893 | 2957411294 | 589 |
| 285 | iso_pu_bacteria | 2957415311 | 2957417764 | 589 |
| 286 | iso_pu_bacteria | 2957422303 | 2957426880 | 589 |
| 287 | iso_pu_bacteria | 2957430029 | 2957432660 | 589 |
| 288 | iso_pu_bacteria | 2957450854 | 2957452540 | 589 |
| 289 | iso_pu_bacteria | 2957457609 | 2957458830 | 589 |
| 290 | iso_pu_bacteria | 2957464669 | 2957466800 | 589 |
| 291 | iso_pu_bacteria | 2957471148 | 2957472667 | 589 |
| 292 | iso_pu_bacteria | 2957478035 | 2957484191 | 589 |
| 293 | iso_pu_bacteria | 2957484790 | 2957490330 | 589 |
| 294 | iso_pu_bacteria | 2957491536 | 2957495487 | 589 |
| 295 | iso_pu_bacteria | 2957498199 | 2957500828 | 589 |
| 296 | iso_pu_bacteria | 2957505466 | 2957508511 | 589 |
| 297 | iso_pu_bacteria | 2960584000 | 2960590951 | 589 |
| 298 | iso_pu_bacteria | 2960591022 | 2960595032 | 589 |
| 299 | iso_pu_bacteria | 2960597568 | 2960601679 | 589 |
| 300 | iso_pu_bacteria | 2960603979 | 2960608944 | 589 |
| 301 | iso_pu_bacteria | 2960610863 | 2960613056 | 589 |
| 302 | iso_pu_bacteria | 2960617483 | 2960619884 | 589 |
| 303 | iso_pu_bacteria | 2960624210 | 2960628053 | 589 |
| 304 | iso_pu_bacteria | 2960631154 | 2960633063 | 589 |
| 305 | iso_pu_bacteria | 2960637947 | 2960641731 | 589 |
| 306 | iso_pu_bacteria | 2960645483 | 2960647844 | 589 |
| 307 | iso_pu_bacteria | 2960652885 | 2960658833 | 589 |
| 308 | iso_pu_bacteria | 2960660292 | 2960661845 | 589 |
| 309 | iso_pu_bacteria | 2960667422 | 2960668614 | 589 |
| 310 | iso_pu_bacteria | 2960674078 | 2960676683 | 589 |
| 311 | iso_pu_bacteria | 2960680706 | 2960684351 | 589 |
| 312 | iso_pu_bacteria | 2960687367 | 2960688409 | 589 |
| 313 | iso_pu_bacteria | 2960693952 | 2960700878 | 589 |
| 314 | iso_pu_bacteria | 2964607997 | 2964609900 | 589 |
| 315 | iso_pu_bacteria | 2964615318 | 2964618473 | 589 |
| 316 | iso_pu_bacteria | 2964621998 | 2964623385 | 589 |
| 317 | iso_pu_bacteria | 2964628898 | 2964629219 | 589 |
| 318 | iso_pu_bacteria | 2964636051 | 2964640850 | 589 |
| 319 | iso_pu_bacteria | 2964643177 | 2964646501 | 589 |
| 320 | iso_pu_bacteria | 2964649959 | 2964654271 | 589 |
| 321 | iso_pu_bacteria | 2964656573 | 2964661484 | 589 |
| 322 | iso_pu_bacteria | 2964663802 | 2964665492 | 589 |
| 323 | iso_pu_bacteria | 2964670856 | 2964676819 | 589 |
| 324 | iso_pu_bacteria | 2964678106 | 2964681875 | 589 |
| 325 | iso_pu_bacteria | 2964685014 | 2964688880 | 589 |
| 326 | iso_pu_bacteria | 2964691889 | 2964696456 | 589 |
| 327 | iso_pu_bacteria | 2964698721 | 2964704422 | 589 |
| 328 | iso_pu_bacteria | 2964705432 | 2964706664 | 589 |
| 329 | iso_pu_bacteria | 2964712639 | 2964715547 | 589 |
| 330 | iso_pu_bacteria | 2964719344 | 2964726339 | 589 |
| 331 | iso_pu_bacteria | 2967664464 | 2967665752 | 589 |
| 332 | iso_pu_bacteria | 2967671571 | 2967676178 | 589 |
| 333 | iso_pu_bacteria | 2967678726 | 2967684672 | 589 |
| 334 | iso_pu_bacteria | 2967686174 | 2967689183 | 589 |
| 335 | iso_pu_bacteria | 2967693043 | 2967694309 | 589 |
| 336 | iso_pu_bacteria | 2967699805 | 2967700939 | 589 |
| 337 | iso_pu_bacteria | 2967706974 | 2967708829 | 589 |
| 338 | iso_pu_bacteria | 2967714385 | 2967716199 | 589 |
| 339 | iso_pu_bacteria | 2967721400 | 2967724323 | 589 |
| 340 | iso_pu_bacteria | 2967728569 | 2967732076 | 589 |
| 341 | iso_pu_bacteria | 2967735183 | 2967736632 | 589 |
| 342 | iso_pu_bacteria | 2967742019 | 2967747901 | 589 |
| 343 | iso_pu_bacteria | 2967748971 | 2967752005 | 589 |
| 344 | iso_pu_bacteria | 2967755722 | 2967758519 | 589 |
| 345 | iso_pu_bacteria | 2967762386 | 2967765583 | 589 |
| 346 | iso_pu_bacteria | 2967769361 | 2967772547 | 589 |
| 347 | iso_pu_bacteria | 2967775926 | 2967781496 | 589 |
| 348 | iso_pu_bacteria | 2970019648 | 2970024499 | 589 |
| 349 | iso_pu_bacteria | 2970026789 | 2970030071 | 589 |
| 350 | iso_pu_bacteria | 2970033650 | 2970035422 | 589 |
| 351 | iso_pu_bacteria | 2970040964 | 2970047038 | 589 |
| 352 | iso_pu_bacteria | 2970047711 | 2970048659 | 589 |
| 353 | iso_pu_bacteria | 2970054988 | 2970057312 | 589 |
| 354 | iso_pu_bacteria | 2970061556 | 2970065869 | 589 |
| 355 | iso_pu_bacteria | 2970068827 | 2970071767 | 589 |
| 356 | iso_pu_bacteria | 2970076120 | 2970078656 | 589 |
| 357 | iso_pu_bacteria | 2970082768 | 2970087160 | 589 |
| 358 | iso_pu_bacteria | 2970088815 | 2970090680 | 589 |
| 359 | iso_pu_bacteria | 2970095765 | 2970097162 | 589 |
| 360 | iso_pu_bacteria | 2970102677 | 2970105246 | 589 |
| 361 | iso_pu_bacteria | 2970109326 | 2970110103 | 589 |
| 362 | iso_pu_bacteria | 2970116247 | 2970119727 | 589 |
| 363 | iso_pu_bacteria | 2970122695 | 2970127301 | 589 |
| 364 | iso_pu_bacteria | 2970129317 | 2970135645 | 589 |
| 365 | iso_pu_bacteria | 2970136068 | 2970136629 | 589 |
| 366 | iso_pu_bacteria | 2970143518 | 2970146790 | 589 |
| 367 | iso_pu_bacteria | 2970149975 | 2970155913 | 589 |
| 368 | iso_pu_bacteria | 2970156795 | 2970163287 | 589 |
| 369 | iso_pu_bacteria | 2970164137 | 2970166673 | 589 |
| 370 | iso_pu_bacteria | 2970170962 | 2970173158 | 589 |
| 371 | iso_pu_bacteria | 2970177841 | 2970180888 | 589 |
| 372 | iso_pu_bacteria | 2970184632 | 2970187504 | 589 |
| 373 | iso_pu_bacteria | 2970191845 | 2970194807 | 589 |
| 374 | iso_pu_bacteria | 2977516862 | 2977521833 | 589 |
| 375 | iso_pu_bacteria | 2977523885 | 2977525388 | 589 |
| 376 | iso_pu_bacteria | 2977530762 | 2977534733 | 589 |
| 377 | iso_pu_bacteria | 2977537788 | 2977539184 | 589 |
| 378 | iso_pu_bacteria | 2977544691 | 2977547492 | 589 |
| 379 | iso_pu_bacteria | 2977551784 | 2977555484 | 589 |
| 380 | iso_pu_bacteria | 2977558990 | 2977563913 | 589 |
| 381 | iso_pu_bacteria | 2977565890 | 2977568517 | 589 |
| 382 | iso_pu_bacteria | 2977572785 | 2977575240 | 589 |
| 383 | iso_pu_bacteria | 2977579622 | 2977581134 | 589 |
| 384 | iso_pu_bacteria | 2989349275 | 2989350206 | 589 |
| 385 | iso_pu_bacteria | 648276728 | 648738710 | 589 |
| 386 | iso_pu_bacteria | 8003992118 | 8003996662 | 589 |
| 387 | iso_pu_bacteria | 8003999396 | 8004004143 | 589 |
| 388 | iso_pu_bacteria | 8018150411 | 8018152288 | 589 |
| 389 | 3300046507 | Ga0495606_0007840 | Ga0495606_0007840_1705_3480 | 590 |
| 390 | 3300048924 | Ga0496121_0033603 | Ga0496121_0033603_853_2628 | 590 |
| 391 | iso_pu_bacteria | 2510461069 | 2510840664 | 590 |
| 392 | iso_pu_bacteria | 2510917022 | 2511137216 | 590 |
| 393 | iso_pu_bacteria | 2582581307 | 2585273394 | 590 |
| 394 | iso_pu_bacteria | 2585427531 | 2585564075 | 590 |
| 395 | iso_pu_bacteria | 2585427608 | 2585900245 | 590 |
| 396 | iso_pu_bacteria | 2585427609 | 2585909198 | 590 |
| 397 | iso_pu_bacteria | 2585427633 | 2585997283 | 590 |
| 398 | iso_pu_bacteria | 2585427634 | 2586001892 | 590 |
| 399 | iso_pu_bacteria | 2585428125 | 2587984700 | 590 |
| 400 | iso_pu_bacteria | 2599185156 | 2599335423 | 590 |
| 401 | iso_pu_bacteria | 2599185236 | 2599719975 | 590 |
| 402 | iso_pu_bacteria | 2818991448 | 2819612489 | 590 |
| 403 | iso_pu_bacteria | 2818991461 | 2819686567 | 590 |
| 404 | iso_pu_bacteria | 2821123053 | 2821126292 | 590 |
| 405 | iso_pu_bacteria | 2838736955 | 2838737232 | 590 |
| 406 | iso_pu_bacteria | 2841840854 | 2841842399 | 590 |
| 407 | iso_pu_bacteria | 2842140634 | 2842142179 | 590 |
| 408 | iso_pu_bacteria | 2854896431 | 2854897405 | 590 |
| 409 | iso_pu_bacteria | 2854916844 | 2854921461 | 590 |
| 410 | iso_pu_bacteria | 2857531043 | 2857532853 | 590 |
| 411 | iso_pu_bacteria | 2889790730 | 2889792490 | 590 |
| 412 | iso_pu_bacteria | 2889914905 | 2889919957 | 590 |
| 413 | iso_pu_bacteria | 2917699015 | 2917702132 | 590 |
| 414 | iso_pu_bacteria | 2919171160 | 2919173579 | 590 |
| 415 | iso_pu_bacteria | 8005484373 | 8005484399 | 590 |
| 416 | iso_pu_bacteria | 8005645114 | 8005647326 | 590 |
| 417 | iso_pu_bacteria | 8024486573 | 8024488643 | 590 |
| 418 | 3300013102 | Ga0157371_10008466 | Ga0157371_100084666 | 591 |
| 419 | 3300046507 | Ga0495606_0047727 | Ga0495606_0047727_792_2570 | 591 |
| 420 | 3300047472 | Ga0495686_0002724 | Ga0495686_0002724_3568_5346 | 591 |
| 421 | 3300048919 | Ga0496116_0000135 | Ga0496116_0000135_83397_85178 | 591 |
| 422 | 3300048921 | Ga0496118_0067372 | Ga0496118_0067372_394_2172 | 591 |
| 423 | 3300048926 | Ga0496123_0060489 | Ga0496123_0060489_25_1806 | 591 |
| 424 | 3300048929 | Ga0496126_0000129 | Ga0496126_0000129_29185_30966 | 591 |
| 425 | iso_pu_bacteria | 2509276021 | 2509390030 | 591 |
| 426 | iso_pu_bacteria | 2509276033 | 2509447717 | 591 |
| 427 | iso_pu_bacteria | 2510065019 | 2510134638 | 591 |
| 428 | iso_pu_bacteria | 2510461076 | 2510895991 | 591 |
| 429 | iso_pu_bacteria | 2510917030 | 2511200395 | 591 |
| 430 | iso_pu_bacteria | 2513237084 | 2513573311 | 591 |
| 431 | iso_pu_bacteria | 2513237085 | 2513578444 | 591 |
| 432 | iso_pu_bacteria | 2513237093 | 2513631525 | 591 |
| 433 | iso_pu_bacteria | 2513237103 | 2513710544 | 591 |
| 434 | iso_pu_bacteria | 2513237144 | 2513908431 | 591 |
| 435 | iso_pu_bacteria | 2513237146 | 2513926760 | 591 |
| 436 | iso_pu_bacteria | 2513237162 | 2514023472 | 591 |
| 437 | iso_pu_bacteria | 2515075009 | 2515113729 | 591 |
| 438 | iso_pu_bacteria | 2515154113 | 2515634595 | 591 |
| 439 | iso_pu_bacteria | 2515154114 | 2515645361 | 591 |
| 440 | iso_pu_bacteria | 2515154116 | 2515660833 | 591 |
| 441 | iso_pu_bacteria | 2515154134 | 2515743447 | 591 |
| 442 | iso_pu_bacteria | 2516653077 | 2517037340 | 591 |
| 443 | iso_pu_bacteria | 2516653085 | 2517077646 | 591 |
| 444 | iso_pu_bacteria | 2517093000 | 2517096439 | 591 |
| 445 | iso_pu_bacteria | 2517287029 | 2517410532 | 591 |
| 446 | iso_pu_bacteria | 2524023209 | 2524461929 | 591 |
| 447 | iso_pu_bacteria | 2529292951 | 2530646764 | 591 |
| 448 | iso_pu_bacteria | 2582581283 | 2585169389 | 591 |
| 449 | iso_pu_bacteria | 2582581298 | 2585224997 | 591 |
| 450 | iso_pu_bacteria | 2582581306 | 2585264436 | 591 |
| 451 | iso_pu_bacteria | 2582581308 | 2585283484 | 591 |
| 452 | iso_pu_bacteria | 2582581315 | 2585328269 | 591 |
| 453 | iso_pu_bacteria | 2582581316 | 2585330679 | 591 |
| 454 | iso_pu_bacteria | 2582581865 | 2585389800 | 591 |
| 455 | iso_pu_bacteria | 2585427526 | 2585529554 | 591 |
| 456 | iso_pu_bacteria | 2585427527 | 2585535947 | 591 |
| 457 | iso_pu_bacteria | 2585427528 | 2585541207 | 591 |
| 458 | iso_pu_bacteria | 2585427529 | 2585547553 | 591 |
| 459 | iso_pu_bacteria | 2585427530 | 2585556706 | 591 |
| 460 | iso_pu_bacteria | 2585427593 | 2585839970 | 591 |
| 461 | iso_pu_bacteria | 2599185170 | 2599420748 | 591 |
| 462 | iso_pu_bacteria | 2615840624 | 2616295370 | 591 |
| 463 | iso_pu_bacteria | 2615840626 | 2616312867 | 591 |
| 464 | iso_pu_bacteria | 2643221607 | 2644048484 | 591 |
| 465 | iso_pu_bacteria | 2643221636 | 2644201845 | 591 |
| 466 | iso_pu_bacteria | 2643221686 | 2644481286 | 591 |
| 467 | iso_pu_bacteria | 2718217882 | 2719182411 | 591 |
| 468 | iso_pu_bacteria | 2718217927 | 2719386986 | 591 |
| 469 | iso_pu_bacteria | 2718217997 | 2719666719 | 591 |
| 470 | iso_pu_bacteria | 2718218009 | 2719733130 | 591 |
| 471 | iso_pu_bacteria | 2718218199 | 2720493139 | 591 |
| 472 | iso_pu_bacteria | 2718218232 | 2720614617 | 591 |
| 473 | iso_pu_bacteria | 2718218233 | 2720621391 | 591 |
| 474 | iso_pu_bacteria | 2718218235 | 2720632717 | 591 |
| 475 | iso_pu_bacteria | 2718218269 | 2720776441 | 591 |
| 476 | iso_pu_bacteria | 2718218363 | 2721148524 | 591 |
| 477 | iso_pu_bacteria | 2718218365 | 2721159909 | 591 |
| 478 | iso_pu_bacteria | 2718218366 | 2721165338 | 591 |
| 479 | iso_pu_bacteria | 2718218423 | 2721400709 | 591 |
| 480 | iso_pu_bacteria | 2721755514 | 2722841508 | 591 |
| 481 | iso_pu_bacteria | 2721755556 | 2723028030 | 591 |
| 482 | iso_pu_bacteria | 2721755684 | 2723561660 | 591 |
| 483 | iso_pu_bacteria | 2721755685 | 2723568289 | 591 |
| 484 | iso_pu_bacteria | 2721755809 | 2724039522 | 591 |
| 485 | iso_pu_bacteria | 2721755810 | 2724045886 | 591 |
| 486 | iso_pu_bacteria | 2721755819 | 2724091048 | 591 |
| 487 | iso_pu_bacteria | 2721755822 | 2724105554 | 591 |
| 488 | iso_pu_bacteria | 2721755823 | 2724111380 | 591 |
| 489 | iso_pu_bacteria | 2724679232 | 2725949757 | 591 |
| 490 | iso_pu_bacteria | 2728369352 | 2730108966 | 591 |
| 491 | iso_pu_bacteria | 2728369365 | 2730165646 | 591 |
| 492 | iso_pu_bacteria | 2728369397 | 2730299541 | 591 |
| 493 | iso_pu_bacteria | 2738541333 | 2739035760 | 591 |
| 494 | iso_pu_bacteria | 2765235942 | 2766065529 | 591 |
| 495 | iso_pu_bacteria | 2791355256 | 2793293830 | 591 |
| 496 | iso_pu_bacteria | 2791355259 | 2793313261 | 591 |
| 497 | iso_pu_bacteria | 2791355260 | 2793319917 | 591 |
| 498 | iso_pu_bacteria | 2791355261 | 2793328072 | 591 |
| 499 | iso_pu_bacteria | 2791355262 | 2793333185 | 591 |
| 500 | iso_pu_bacteria | 2791355263 | 2793344947 | 591 |
| 501 | iso_pu_bacteria | 2791355264 | 2793347179 | 591 |
| 502 | iso_pu_bacteria | 2791355265 | 2793356675 | 591 |
| 503 | iso_pu_bacteria | 2791355266 | 2793362863 | 591 |
| 504 | iso_pu_bacteria | 2791355267 | 2793370110 | 591 |
| 505 | iso_pu_bacteria | 2802429605 | 2805931934 | 591 |
| 506 | iso_pu_bacteria | 2802429606 | 2805938179 | 591 |
| 507 | iso_pu_bacteria | 2802429633 | 2806044748 | 591 |
| 508 | iso_pu_bacteria | 2802429634 | 2806056616 | 591 |
| 509 | iso_pu_bacteria | 2802429635 | 2806063870 | 591 |
| 510 | iso_pu_bacteria | 2802429636 | 2806068089 | 591 |
| 511 | iso_pu_bacteria | 2802429637 | 2806074210 | 591 |
| 512 | iso_pu_bacteria | 2818991453 | 2819643358 | 591 |
| 513 | iso_pu_bacteria | 2838016132 | 2838018915 | 591 |
| 514 | iso_pu_bacteria | 2838022645 | 2838024493 | 591 |
| 515 | iso_pu_bacteria | 2838035591 | 2838040577 | 591 |
| 516 | iso_pu_bacteria | 2838042994 | 2838046437 | 591 |
| 517 | iso_pu_bacteria | 2838048938 | 2838051369 | 591 |
| 518 | iso_pu_bacteria | 2838061910 | 2838063649 | 591 |
| 519 | iso_pu_bacteria | 2838068647 | 2838074224 | 591 |
| 520 | iso_pu_bacteria | 2838661181 | 2838668622 | 591 |
| 521 | iso_pu_bacteria | 2838668709 | 2838671370 | 591 |
| 522 | iso_pu_bacteria | 2838680041 | 2838685153 | 591 |
| 523 | iso_pu_bacteria | 2838686498 | 2838691521 | 591 |
| 524 | iso_pu_bacteria | 2838694306 | 2838699010 | 591 |
| 525 | iso_pu_bacteria | 2838701080 | 2838703449 | 591 |
| 526 | iso_pu_bacteria | 2838707686 | 2838712491 | 591 |
| 527 | iso_pu_bacteria | 2838729681 | 2838733480 | 591 |
| 528 | iso_pu_bacteria | 2838742623 | 2838745948 | 591 |
| 529 | iso_pu_bacteria | 2841851746 | 2841853660 | 591 |
| 530 | iso_pu_bacteria | 2841864319 | 2841868376 | 591 |
| 531 | iso_pu_bacteria | 2842077413 | 2842081968 | 591 |
| 532 | iso_pu_bacteria | 2842110456 | 2842113648 | 591 |
| 533 | iso_pu_bacteria | 2842118031 | 2842122890 | 591 |
| 534 | iso_pu_bacteria | 2842146304 | 2842149549 | 591 |
| 535 | iso_pu_bacteria | 2842156927 | 2842162333 | 591 |
| 536 | iso_pu_bacteria | 2842163707 | 2842169892 | 591 |
| 537 | iso_pu_bacteria | 2842180545 | 2842185259 | 591 |
| 538 | iso_pu_bacteria | 2842192696 | 2842197692 | 591 |
| 539 | iso_pu_bacteria | 2842198810 | 2842200036 | 591 |
| 540 | iso_pu_bacteria | 2842205361 | 2842208113 | 591 |
| 541 | iso_pu_bacteria | 2842217011 | 2842220282 | 591 |
| 542 | iso_pu_bacteria | 2842229732 | 2842233746 | 591 |
| 543 | iso_pu_bacteria | 2842237096 | 2842242207 | 591 |
| 544 | iso_pu_bacteria | 2842243621 | 2842247790 | 591 |
| 545 | iso_pu_bacteria | 2842250916 | 2842253813 | 591 |
| 546 | iso_pu_bacteria | 2842257432 | 2842261942 | 591 |
| 547 | iso_pu_bacteria | 2842264693 | 2842266421 | 591 |
| 548 | iso_pu_bacteria | 2842271015 | 2842275995 | 591 |
| 549 | iso_pu_bacteria | 2842278818 | 2842281878 | 591 |
| 550 | iso_pu_bacteria | 2842285085 | 2842288983 | 591 |
| 551 | iso_pu_bacteria | 2842291075 | 2842295968 | 591 |
| 552 | iso_pu_bacteria | 2842298080 | 2842299997 | 591 |
| 553 | iso_pu_bacteria | 2842304105 | 2842308021 | 591 |
| 554 | iso_pu_bacteria | 2842311132 | 2842316115 | 591 |
| 555 | iso_pu_bacteria | 2842317721 | 2842321623 | 591 |
| 556 | iso_pu_bacteria | 2842341865 | 2842344803 | 591 |
| 557 | iso_pu_bacteria | 2842357229 | 2842362609 | 591 |
| 558 | iso_pu_bacteria | 2842363717 | 2842369418 | 591 |
| 559 | iso_pu_bacteria | 2842370503 | 2842377220 | 591 |
| 560 | iso_pu_bacteria | 2842377471 | 2842382367 | 591 |
| 561 | iso_pu_bacteria | 2842384541 | 2842389768 | 591 |
| 562 | iso_pu_bacteria | 2842395702 | 2842401738 | 591 |
| 563 | iso_pu_bacteria | 2842402390 | 2842406350 | 591 |
| 564 | iso_pu_bacteria | 2842409023 | 2842413223 | 591 |
| 565 | iso_pu_bacteria | 2842415677 | 2842419866 | 591 |
| 566 | iso_pu_bacteria | 2842422224 | 2842427848 | 591 |
| 567 | iso_pu_bacteria | 2842428310 | 2842429740 | 591 |
| 568 | iso_pu_bacteria | 2842434925 | 2842436600 | 591 |
| 569 | iso_pu_bacteria | 2842441272 | 2842446763 | 591 |
| 570 | iso_pu_bacteria | 2842447887 | 2842450830 | 591 |
| 571 | iso_pu_bacteria | 2842462802 | 2842464161 | 591 |
| 572 | iso_pu_bacteria | 2842469257 | 2842470929 | 591 |
| 573 | iso_pu_bacteria | 2842489311 | 2842493042 | 591 |
| 574 | iso_pu_bacteria | 2842495871 | 2842499390 | 591 |
| 575 | iso_pu_bacteria | 2842509118 | 2842514592 | 591 |
| 576 | iso_pu_bacteria | 2844454524 | 2844457774 | 591 |
| 577 | iso_pu_bacteria | 2852387548 | 2852387797 | 591 |
| 578 | iso_pu_bacteria | 2857516855 | 2857519112 | 591 |
| 579 | iso_pu_bacteria | 2899803654 | 2899808777 | 591 |
| 580 | iso_pu_bacteria | 2919100787 | 2919104347 | 591 |
| 581 | iso_pu_bacteria | 2933016740 | 2933019556 | 591 |
| 582 | iso_pu_bacteria | 2933570622 | 2933574471 | 591 |
| 583 | iso_pu_bacteria | 2933586486 | 2933589062 | 591 |
| 584 | iso_pu_bacteria | 2933599457 | 2933604680 | 591 |
| 585 | iso_pu_bacteria | 2935894831 | 2935899927 | 591 |
| 586 | iso_pu_bacteria | 2935901341 | 2935907112 | 591 |
| 587 | iso_pu_bacteria | 2936367885 | 2936375084 | 591 |
| 588 | iso_pu_bacteria | 2936375103 | 2936380760 | 591 |
| 589 | iso_pu_bacteria | 2936381700 | 2936382074 | 591 |
| 590 | iso_pu_bacteria | 2996893221 | 2996895850 | 591 |
| 591 | iso_pu_bacteria | 3005409236 | 3005415694 | 591 |
| 592 | iso_pu_bacteria | 3005445848 | 3005449069 | 591 |
| 593 | iso_pu_bacteria | 639633055 | 639649763 | 591 |
| 594 | iso_pu_bacteria | 8005275841 | 8005281800 | 591 |
| 595 | iso_pu_bacteria | 8005282627 | 8005288794 | 591 |
| 596 | iso_pu_bacteria | 8005289223 | 8005294484 | 591 |
| 597 | iso_pu_bacteria | 8005301065 | 8005306882 | 591 |
| 598 | iso_pu_bacteria | 8005307578 | 8005310749 | 591 |
| 599 | iso_pu_bacteria | 8005376324 | 8005378384 | 591 |
| 600 | iso_pu_bacteria | 8005382845 | 8005385644 | 591 |
| 601 | iso_pu_bacteria | 8005395548 | 8005401381 | 591 |
| 602 | iso_pu_bacteria | 8005430974 | 8005434315 | 591 |
| 603 | iso_pu_bacteria | 8005460587 | 8005464416 | 591 |
| 604 | iso_pu_bacteria | 8005497431 | 8005501465 | 591 |
| 605 | iso_pu_bacteria | 8005556819 | 8005560897 | 591 |
| 606 | iso_pu_bacteria | 8005563573 | 8005566568 | 591 |
| 607 | iso_pu_bacteria | 8005570704 | 8005575134 | 591 |
| 608 | iso_pu_bacteria | 8005619151 | 8005622827 | 591 |
| 609 | iso_pu_bacteria | 8005626139 | 8005631873 | 591 |
| 610 | iso_pu_bacteria | 8005668836 | 8005672886 | 591 |
| 611 | iso_pu_bacteria | 8005688590 | 8005693371 | 591 |
| 612 | iso_pu_bacteria | 8005695170 | 8005700654 | 591 |
| 613 | iso_pu_bacteria | 8018127388 | 8018133806 | 591 |
| 614 | iso_pu_bacteria | 8018163183 | 8018170012 | 591 |
| 615 | iso_pu_bacteria | 8018176218 | 8018178706 | 591 |
| 616 | iso_pu_bacteria | 8023680758 | 8023687753 | 591 |
| 617 | iso_pu_bacteria | 8024479707 | 8024481578 | 591 |
| 618 | iso_pu_bacteria | 8024501048 | 8024506175 | 591 |
| 619 | iso_pu_bacteria | 8046767195 | 8046768745 | 591 |
| 620 | iso_pu_bacteria | 8056375014 | 8056381390 | 591 |
| 621 | iso_pu_bacteria | 8056382006 | 8056386835 | 591 |
| 622 | iso_pu_bacteria | 8057575449 | 8057582531 | 591 |
| 623 | iso_pu_bacteria | 8057874678 | 8057876614 | 591 |
| 624 | 3300002773 | JGI25152J39213_1002048 | JGI25152J39213_10020488 | 592 |
| 625 | 3300002773 | JGI25152J39213_1002126 | JGI25152J39213_10021265 | 592 |
| 626 | 3300002774 | JGI25150J39212_1000442 | JGI25150J39212_100044213 | 592 |
| 627 | 3300003187 | JGI25151J46595_10001202 | JGI25151J46595_1000120214 | 592 |
| 628 | 3300003215 | JGI25153J46596_10003889 | JGI25153J46596_100038898 | 592 |
| 629 | 3300003775 | Ga0055524_1006753 | Ga0055524_10067534 | 592 |
| 630 | 3300003775 | Ga0055524_1010351 | Ga0055524_10103512 | 592 |
| 631 | 3300003790 | Ga0055528_1002930 | Ga0055528_10029307 | 592 |
| 632 | 3300006038 | Ga0075365_10000468 | Ga0075365_100004684 | 592 |
| 633 | 3300009763 | Ga0123340_1033321 | Ga0123340_10333212 | 592 |
| 634 | 3300009765 | Ga0123341_1036814 | Ga0123341_10368142 | 592 |
| 635 | 3300009766 | Ga0123342_1018003 | Ga0123342_10180035 | 592 |
| 636 | 3300025245 | Ga0207425_1000058 | Ga0207425_10000588 | 592 |
| 637 | 3300025258 | Ga0209129_1000107 | Ga0209129_10001078 | 592 |
| 638 | 3300025258 | Ga0209129_1007138 | Ga0209129_10071383 | 592 |
| 639 | 3300025273 | Ga0209673_1002028 | Ga0209673_10020287 | 592 |
| 640 | 3300025273 | Ga0209673_1003790 | Ga0209673_10037906 | 592 |
| 641 | 3300025294 | Ga0209025_1000083 | Ga0209025_10000838 | 592 |
| 642 | 3300025294 | Ga0209025_1009943 | Ga0209025_10099436 | 592 |
| 643 | 3300025295 | Ga0209564_1003015 | Ga0209564_10030156 | 592 |
| 644 | 3300025295 | Ga0209564_1004731 | Ga0209564_10047314 | 592 |
| 645 | 3300025297 | Ga0209758_1002496 | Ga0209758_10024968 | 592 |
| 646 | 3300025299 | Ga0209256_1003354 | Ga0209256_10033544 | 592 |
| 647 | 3300025299 | Ga0209256_1004736 | Ga0209256_10047364 | 592 |
| 648 | 3300025302 | Ga0207426_1000457 | Ga0207426_100045751 | 592 |
| 649 | 3300027666 | Ga0209282_1000008 | Ga0209282_1000008166 | 592 |
| 650 | 3300031911 | Ga0307412_10000931 | Ga0307412_100009315 | 592 |
| 651 | 3300031967 | Ga0315914_1000011 | Ga0315914_10000118 | 592 |
| 652 | 3300033430 | Ga0315913_1008369 | Ga0315913_10083697 | 592 |
| 653 | 3300033464 | Ga0315915_1000009 | Ga0315915_100000951 | 592 |
| 654 | 3300046506 | Ga0495583_0005215 | Ga0495583_0005215_1152_2930 | 592 |
| 655 | 3300046512 | Ga0495610_0001781 | Ga0495610_0001781_6153_7931 | 592 |
| 656 | 3300046519 | Ga0495632_0002338 | Ga0495632_0002338_11698_13482 | 592 |
| 657 | 3300047472 | Ga0495686_0008537 | Ga0495686_0008537_805_2583 | 592 |
| 658 | 3300048905 | Ga0496102_0169990 | Ga0496102_0169990_149_1939 | 592 |
| 659 | 3300048908 | Ga0496105_0044780 | Ga0496105_0044780_1489_3279 | 592 |
| 660 | 3300048917 | Ga0496114_0078711 | Ga0496114_0078711_810_2600 | 592 |
| 661 | 3300048919 | Ga0496116_0072012 | Ga0496116_0072012_285_2075 | 592 |
| 662 | 3300048923 | Ga0496120_0014119 | Ga0496120_0014119_896_2686 | 592 |
| 663 | 3300048924 | Ga0496121_0015003 | Ga0496121_0015003_5293_7071 | 592 |
| 664 | 3300048925 | Ga0496122_0020654 | Ga0496122_0020654_1179_2957 | 592 |
| 665 | 3300048926 | Ga0496123_0008844 | Ga0496123_0008844_6431_8209 | 592 |
| 666 | 3300048927 | Ga0496124_0021457 | Ga0496124_0021457_1180_2958 | 592 |
| 667 | 3300048927 | Ga0496124_0068124 | Ga0496124_0068124_1096_2874 | 592 |
| 668 | 3300048928 | Ga0496125_0005933 | Ga0496125_0005933_5589_7367 | 592 |
| 669 | 3300049586 | Ga0501070_0003222 | Ga0501070_0003222_10202_11986 | 592 |
| 670 | iso_pu_bacteria | 2537561587 | 2537874248 | 592 |
| 671 | iso_pu_bacteria | 2554235003 | 2554244590 | 592 |
| 672 | iso_pu_bacteria | 2558860242 | 2559297570 | 592 |
| 673 | iso_pu_bacteria | 2599185210 | 2599604877 | 592 |
| 674 | iso_pu_bacteria | 2600255279 | 2601612871 | 592 |
| 675 | iso_pu_bacteria | 2600255308 | 2601749600 | 592 |
| 676 | iso_pu_bacteria | 2643221582 | 2643922162 | 592 |
| 677 | iso_pu_bacteria | 2643221693 | 2644523212 | 592 |
| 678 | iso_pu_bacteria | 2738541317 | 2738944677 | 592 |
| 679 | iso_pu_bacteria | 2808606387 | 2808989926 | 592 |
| 680 | iso_pu_bacteria | 2818991439 | 2819557613 | 592 |
| 681 | iso_pu_bacteria | 2838675328 | 2838678853 | 592 |
| 682 | iso_pu_bacteria | 2838714209 | 2838717804 | 592 |
| 683 | iso_pu_bacteria | 2838719591 | 2838723150 | 592 |
| 684 | iso_pu_bacteria | 2838724970 | 2838728521 | 592 |
| 685 | iso_pu_bacteria | 2841846520 | 2841849916 | 592 |
| 686 | iso_pu_bacteria | 2841859092 | 2841863719 | 592 |
| 687 | iso_pu_bacteria | 2842124991 | 2842128388 | 592 |
| 688 | iso_pu_bacteria | 2842130223 | 2842133996 | 592 |
| 689 | iso_pu_bacteria | 2842152218 | 2842155740 | 592 |
| 690 | iso_pu_bacteria | 2842170452 | 2842174050 | 592 |
| 691 | iso_pu_bacteria | 2842175837 | 2842179610 | 592 |
| 692 | iso_pu_bacteria | 2842187318 | 2842191131 | 592 |
| 693 | iso_pu_bacteria | 2842211629 | 2842215446 | 592 |
| 694 | iso_pu_bacteria | 2842224351 | 2842227915 | 592 |
| 695 | iso_pu_bacteria | 2842515876 | 2842520501 | 592 |
| 696 | iso_pu_bacteria | 2899792073 | 2899793784 | 592 |
| 697 | iso_pu_bacteria | 2899845264 | 2899847616 | 592 |
| 698 | iso_pu_bacteria | 2913308742 | 2913309298 | 592 |
| 699 | iso_pu_bacteria | 2919114240 | 2919118084 | 592 |
| 700 | iso_pu_bacteria | 2926754445 | 2926757849 | 592 |
| 701 | iso_pu_bacteria | 2926760298 | 2926764528 | 592 |
| 702 | iso_pu_bacteria | 2929138655 | 2929141460 | 592 |
| 703 | iso_pu_bacteria | 2933006813 | 2933006829 | 592 |
| 704 | iso_pu_bacteria | 2933011516 | 2933012072 | 592 |
| 705 | iso_pu_bacteria | 2933594066 | 2933597331 | 592 |
| 706 | iso_pu_bacteria | 2978969890 | 2978970753 | 592 |
| 707 | iso_pu_bacteria | 2979089926 | 2979090366 | 592 |
| 708 | iso_pu_bacteria | 2979095461 | 2979095892 | 592 |
| 709 | iso_pu_bacteria | 2979100975 | 2979102655 | 592 |
| 710 | iso_pu_bacteria | 2984509177 | 2984509459 | 592 |
| 711 | iso_pu_bacteria | 2984518228 | 2984519841 | 592 |
| 712 | iso_pu_bacteria | 2984537506 | 2984537793 | 592 |
| 713 | iso_pu_bacteria | 2984587000 | 2984587862 | 592 |
| 714 | iso_pu_bacteria | 2984601300 | 2984604536 | 592 |
| 715 | iso_pu_bacteria | 650716007 | 650844009 | 592 |
| 716 | iso_pu_bacteria | 8003570095 | 8003574471 | 592 |
| 717 | iso_pu_bacteria | 8054460903 | 8054463557 | 592 |
| 718 | 3300005262 | Ga0065165_1007048 | Ga0065165_10070482 | 593 |
| 719 | 3300006038 | Ga0075365_10000225 | Ga0075365_100002255 | 593 |
| 720 | 3300006051 | Ga0075364_10010171 | Ga0075364_100101714 | 593 |
| 721 | 3300006353 | Ga0075370_10001391 | Ga0075370_100013916 | 593 |
| 722 | 3300006946 | Ga0079104_1000063 | Ga0079104_100006340 | 593 |
| 723 | 3300027111 | Ga0209281_1000110 | Ga0209281_100011041 | 593 |
| 724 | 3300028794 | Ga0307515_10002178 | Ga0307515_1000217825 | 593 |
| 725 | 3300031456 | Ga0307513_10005733 | Ga0307513_100057338 | 593 |
| 726 | 3300046530 | Ga0495654_0000121 | Ga0495654_0000121_15452_17239 | 593 |
| 727 | 3300048924 | Ga0496121_0003334 | Ga0496121_0003334_17104_18891 | 593 |
| 728 | 3300048924 | Ga0496121_0017187 | Ga0496121_0017187_3490_5277 | 593 |
| 729 | 3300048929 | Ga0496126_0099224 | Ga0496126_0099224_86_1873 | 593 |
| 730 | 3300050491 | nmdc:mga00v17_440_c1 | nmdc:mga00v17_440_c1_1750_3537 | 593 |
| 731 | 3300050492 | nmdc:mga0yw44_115_c1 | nmdc:mga0yw44_115_c1_16940_18727 | 593 |
| 732 | 3300053125 | Ga0500618_000171 | Ga0500618_000171_36963_38750 | 593 |
| 733 | 3300053125 | Ga0500618_002444 | Ga0500618_002444_1561_3348 | 593 |
| 734 | 3300053153 | Ga0500616_0000402 | Ga0500616_0000402_12202_13989 | 593 |
| 735 | iso_pu_bacteria | 2600254933 | 2600373528 | 593 |
| 736 | 3300002704 | JGI25155J39150_1000075 | JGI25155J39150_100007519 | 594 |
| 737 | 3300002705 | JGI25156J39149_1000103 | JGI25156J39149_100010340 | 594 |
| 738 | 3300002738 | JGI25154J39366_1000018 | JGI25154J39366_1000018194 | 594 |
| 739 | 3300002741 | JGI25157J39369_1000074 | JGI25157J39369_100007420 | 594 |
| 740 | 3300002987 | JGI25159J45721_1000093 | JGI25159J45721_100009333 | 594 |
| 741 | 3300003187 | JGI25151J46595_10001078 | JGI25151J46595_100010786 | 594 |
| 742 | 3300003215 | JGI25153J46596_10020647 | JGI25153J46596_100206472 | 594 |
| 743 | 3300003354 | JGI25160J50197_1000044 | JGI25160J50197_100004440 | 594 |
| 744 | 3300003354 | JGI25160J50197_1003331 | JGI25160J50197_10033315 | 594 |
| 745 | 3300003374 | JGI25161J50226_1000028 | JGI25161J50226_100002899 | 594 |
| 746 | 3300003374 | JGI25161J50226_1003657 | JGI25161J50226_10036572 | 594 |
| 747 | 3300003771 | Ga0055526_1000315 | Ga0055526_10003155 | 594 |
| 748 | 3300003775 | Ga0055524_1002103 | Ga0055524_10021033 | 594 |
| 749 | 3300003790 | Ga0055528_1003745 | Ga0055528_10037453 | 594 |
| 750 | 3300003856 | Ga0058692_1002214 | Ga0058692_10022144 | 594 |
| 751 | 3300004625 | Ga0055543_1000054 | Ga0055543_100005494 | 594 |
| 752 | 3300005262 | Ga0065165_1002551 | Ga0065165_10025513 | 594 |
| 753 | 3300005548 | Ga0070665_100036673 | Ga0070665_1000366733 | 594 |
| 754 | 3300006038 | Ga0075365_10000513 | Ga0075365_1000051313 | 594 |
| 755 | 3300006177 | Ga0075362_10000666 | Ga0075362_100006667 | 594 |
| 756 | 3300006178 | Ga0075367_10001960 | Ga0075367_100019607 | 594 |
| 757 | 3300006195 | Ga0075366_10001633 | Ga0075366_100016338 | 594 |
| 758 | 3300006195 | Ga0075366_10002954 | Ga0075366_100029545 | 594 |
| 759 | 3300006948 | Ga0099826_10000045 | Ga0099826_1000004545 | 594 |
| 760 | 3300006948 | Ga0099826_10001193 | Ga0099826_100011937 | 594 |
| 761 | 3300013100 | Ga0157373_10002153 | Ga0157373_100021537 | 594 |
| 762 | 3300013102 | Ga0157371_10000031 | Ga0157371_10000031178 | 594 |
| 763 | 3300025206 | Ga0209435_100044 | Ga0209435_10004430 | 594 |
| 764 | 3300025246 | Ga0209646_1000151 | Ga0209646_100015130 | 594 |
| 765 | 3300025250 | Ga0209026_1000170 | Ga0209026_100017030 | 594 |
| 766 | 3300025256 | Ga0209759_1000186 | Ga0209759_100018632 | 594 |
| 767 | 3300025258 | Ga0209129_1002045 | Ga0209129_10020457 | 594 |
| 768 | 3300025273 | Ga0209673_1000233 | Ga0209673_100023392 | 594 |
| 769 | 3300025284 | Ga0209130_1000093 | Ga0209130_100009340 | 594 |
| 770 | 3300025294 | Ga0209025_1000227 | Ga0209025_100022768 | 594 |
| 771 | 3300025294 | Ga0209025_1001249 | Ga0209025_100124932 | 594 |
| 772 | 3300025294 | Ga0209025_1003257 | Ga0209025_10032572 | 594 |
| 773 | 3300025295 | Ga0209564_1000125 | Ga0209564_1000125178 | 594 |
| 774 | 3300025297 | Ga0209758_1001294 | Ga0209758_100129417 | 594 |
| 775 | 3300025299 | Ga0209256_1000772 | Ga0209256_100077214 | 594 |
| 776 | 3300025302 | Ga0207426_1000012 | Ga0207426_1000012677 | 594 |
| 777 | 3300025302 | Ga0207426_1000276 | Ga0207426_100027690 | 594 |
| 778 | 3300025303 | Ga0209051_1002080 | Ga0209051_10020803 | 594 |
| 779 | 3300027312 | Ga0209371_1000283 | Ga0209371_100028316 | 594 |
| 780 | 3300027666 | Ga0209282_1000210 | Ga0209282_100021027 | 594 |
| 781 | 3300027666 | Ga0209282_1019088 | Ga0209282_10190881 | 594 |
| 782 | 3300028379 | Ga0268266_10040657 | Ga0268266_100406573 | 594 |
| 783 | 3300028794 | Ga0307515_10024859 | Ga0307515_100248595 | 594 |
| 784 | 3300041492 | Ga0451835_0088077 | Ga0451835_0088077_84_1871 | 594 |
| 785 | 3300041507 | Ga0451851_0179135 | Ga0451851_0179135_13_1800 | 594 |
| 786 | 3300046460 | Ga0495638_0000296 | Ga0495638_0000296_6011_7798 | 594 |
| 787 | 3300046474 | Ga0495605_0016036 | Ga0495605_0016036_87_1874 | 594 |
| 788 | 3300046492 | Ga0495585_0008558 | Ga0495585_0008558_1460_3247 | 594 |
| 789 | 3300046506 | Ga0495583_0014032 | Ga0495583_0014032_2148_3935 | 594 |
| 790 | 3300046507 | Ga0495606_0060240 | Ga0495606_0060240_383_2173 | 594 |
| 791 | 3300046512 | Ga0495610_0028780 | Ga0495610_0028780_1069_2856 | 594 |
| 792 | 3300046512 | Ga0495610_0034396 | Ga0495610_0034396_622_2409 | 594 |
| 793 | 3300046518 | Ga0495631_0006867 | Ga0495631_0006867_2031_3818 | 594 |
| 794 | 3300046524 | Ga0495648_0004210 | Ga0495648_0004210_5489_7276 | 594 |
| 795 | 3300046538 | Ga0495609_0018814 | Ga0495609_0018814_1284_3071 | 594 |
| 796 | 3300046558 | Ga0495633_0033652 | Ga0495633_0033652_379_2172 | 594 |
| 797 | 3300046660 | Ga0495625_0004692 | Ga0495625_0004692_1789_3576 | 594 |
| 798 | 3300046674 | Ga0495588_0000403 | Ga0495588_0000403_19358_21151 | 594 |
| 799 | 3300046675 | Ga0495657_0025250 | Ga0495657_0025250_68_1855 | 594 |
| 800 | 3300046810 | Ga0495660_0021738 | Ga0495660_0021738_1354_3141 | 594 |
| 801 | 3300047470 | Ga0495681_0006325 | Ga0495681_0006325_1312_3105 | 594 |
| 802 | 3300048909 | Ga0496106_0000245 | Ga0496106_0000245_18282_20069 | 594 |
| 803 | 3300048916 | Ga0496113_0031171 | Ga0496113_0031171_2008_3801 | 594 |
| 804 | 3300048920 | Ga0496117_0000030 | Ga0496117_0000030_187650_189443 | 594 |
| 805 | 3300048921 | Ga0496118_0001480 | Ga0496118_0001480_12064_13857 | 594 |
| 806 | 3300048922 | Ga0496119_0006282 | Ga0496119_0006282_3340_5133 | 594 |
| 807 | 3300048923 | Ga0496120_0000047 | Ga0496120_0000047_160902_162695 | 594 |
| 808 | 3300048923 | Ga0496120_0033491 | Ga0496120_0033491_748_2535 | 594 |
| 809 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_1089052_1090845 | 594 |
| 810 | 3300048924 | Ga0496121_0028791 | Ga0496121_0028791_2400_4187 | 594 |
| 811 | 3300048924 | Ga0496121_0041506 | Ga0496121_0041506_1151_2941 | 594 |
| 812 | 3300048924 | Ga0496121_0098308 | Ga0496121_0098308_382_2172 | 594 |
| 813 | 3300048925 | Ga0496122_0000076 | Ga0496122_0000076_199559_201352 | 594 |
| 814 | 3300048925 | Ga0496122_0018249 | Ga0496122_0018249_3800_5593 | 594 |
| 815 | 3300048926 | Ga0496123_0000023 | Ga0496123_0000023_145543_147336 | 594 |
| 816 | 3300048927 | Ga0496124_0000239 | Ga0496124_0000239_24837_26630 | 594 |
| 817 | 3300048927 | Ga0496124_0015352 | Ga0496124_0015352_897_2690 | 594 |
| 818 | 3300048928 | Ga0496125_0000200 | Ga0496125_0000200_99321_101114 | 594 |
| 819 | 3300048928 | Ga0496125_0040483 | Ga0496125_0040483_1704_3491 | 594 |
| 820 | 3300048928 | Ga0496125_0093971 | Ga0496125_0093971_100_1887 | 594 |
| 821 | 3300048929 | Ga0496126_0048201 | Ga0496126_0048201_522_2312 | 594 |
| 822 | 3300049579 | Ga0501043_0111150 | Ga0501043_0111150_342_2129 | 594 |
| 823 | 3300049589 | Ga0501073_0035804 | Ga0501073_0035804_1259_3046 | 594 |
| 824 | 3300049744 | Ga0501083_0037163 | Ga0501083_0037163_846_2633 | 594 |
| 825 | 3300050491 | nmdc:mga00v17_4_c1 | nmdc:mga00v17_4_c1_44941_46734 | 594 |
| 826 | 3300050493 | nmdc:mga0k408_3667_c1 | nmdc:mga0k408_3667_c1_226_2013 | 594 |
| 827 | 3300050516 | nmdc:mga0sz30_2179_c1 | nmdc:mga0sz30_2179_c1_1719_3512 | 594 |
| 828 | 3300053107 | Ga0500560_000988 | Ga0500560_000988_582_2375 | 594 |
| 829 | 3300053107 | Ga0500560_003847 | Ga0500560_003847_311_2104 | 594 |
| 830 | 3300053108 | Ga0500562_009003 | Ga0500562_009003_236_2023 | 594 |
| 831 | 3300053111 | Ga0500572_001695 | Ga0500572_001695_3470_5263 | 594 |
| 832 | 3300053137 | Ga0500561_0001003 | Ga0500561_0001003_1367_3160 | 594 |
| 833 | 3300053139 | Ga0500568_0001930 | Ga0500568_0001930_4063_5850 | 594 |
| 834 | 3300053139 | Ga0500568_0007386 | Ga0500568_0007386_1978_3765 | 594 |
| 835 | 3300053139 | Ga0500568_0012695 | Ga0500568_0012695_844_2631 | 594 |
| 836 | 3300053140 | Ga0500573_0024362 | Ga0500573_0024362_893_2719 | 594 |
| 837 | 3300053153 | Ga0500616_0005862 | Ga0500616_0005862_1060_2847 | 594 |
| 838 | 3300053160 | Ga0500633_0001006 | Ga0500633_0001006_2460_4247 | 594 |
| 839 | 3300053177 | Ga0500636_0000039 | Ga0500636_0000039_5061_6854 | 594 |
| 840 | 3300053177 | Ga0500636_0002338 | Ga0500636_0002338_1146_2939 | 594 |
| 841 | 3300060353 | Ga0501082_0037735 | Ga0501082_0037735_1357_3144 | 594 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3t8l-assembly1.cif.gz_A | crystal structure of adenine deaminase with mn/fe | 0.9927 | 7 | 592 |
| 3t81-assembly1.cif.gz_B | crystal structure of diiron adenine deaminase | 0.992 | 7 | 592 |
| 3t8l-assembly1.cif.gz_A | crystal structure of adenine deaminase with mn/fe | 0.9893 | 7 | 592 |
| 3t81-assembly1.cif.gz_B | crystal structure of diiron adenine deaminase | 0.9886 | 7 | 592 |
| 2p50-assembly1.cif.gz_B | crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn | 0.7642 | 32 | 368 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3t8lA01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9957 | 7 | 84 | 2.30.40.10 |
| 3nqbB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9945 | 85 | 330 | 3.20.20.140 |
| 3nqbB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9904 | 85 | 330 | 3.20.20.140 |
| af_Q58854_63_300_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9364 | 87 | 330 | 3.20.20.140 |
| af_Q58854_63_300_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9288 | 87 | 330 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G1WIE8-F1-model_v4 | Adenine deaminase (Adenase) (Adenine aminase) (EC 3.5.4.2) | 0.9948 | 9 | 594 |
GO:0000034
GO:0006146 |
| AF-J4TA19-F1-model_v4 | Adenine deaminase (Adenase) (Adenine aminase) (EC 3.5.4.2) | 0.9946 | 5 | 594 |
GO:0000034
GO:0006146 |
| AF-A0A7H4NFQ7-F1-model_v4 | deleted | 0.9943 | 15 | 347 |
|
| AF-A0A7Y7J206-F1-model_v4 | Adenine deaminase | 0.9938 | 164 | 336 |
GO:0016787
|
| AF-F7UET7-F1-model_v4 | deleted | 0.9937 | 7 | 594 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar