F483052

General Info

Members Datasets Scaffolds Average Seq Length
840 270 1680 333

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10034777|Ga0105248_100347774
Length 349
Sequence MARRLPFSYLPEHQRLYEEVPMPNKFKAYRTFEENGVVSSHFVDETIDELDPGDVIIRTKYSTINYKDALSHNGTGKIMRKFPTNAGIDMAGTVETSGDARFKPGDKVIVHGYDLGVAHDGGYAERVRVPADWVVRRPESMTAFDAMTLGTAGYSAALAIELMQHNGLTPESGPVAVTGAIEILAKLGYHVVAITGKGEEASYLKGIGAKEVVLRQSLDLTKVRPLDRATWAGAIDNLGGDILAWLLSTAKVGGTIASVGLAAGFKLHTTVMPFILRGVHLLGVNSAETPMAVRQRIWNKLAVEWRPDRVHDQVRTIDFNELPTHFDPYLKGLARGRTVVRVAPDTHGG

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.21
Rhizosphere 96.79
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10034777 3300009177 Bacteria 5638
2 JGI24743J22301_10005969 3300001991 Bacteria 2056
3 JGI24034J26672_10011558 3300002239 Bacteria 1324
4 Ga0065712_10138683 3300005290 Bacteria 1471
5 Ga0065715_10165010 3300005293 Bacteria 1593
6 Ga0070658_10049863 3300005327 Bacteria 3392
7 Ga0070658_10103315 3300005327 Bacteria 2357
8 Ga0070676_10000779 3300005328 Bacteria 15716
9 Ga0070676_10003237 3300005328 Bacteria 8446
10 Ga0070676_10011177 3300005328 Bacteria 4878
11 Ga0070676_10020943 3300005328 Bacteria 3657
12 Ga0070676_10031243 3300005328 Bacteria 3043
13 Ga0070676_10078883 3300005328 Bacteria 1993
14 Ga0070676_10119220 3300005328 Bacteria 1654
15 Ga0070683_100014846 3300005329 Bacteria 6829
16 Ga0070683_100029948 3300005329 Bacteria 4935
17 Ga0070690_100006980 3300005330 Bacteria 6436
18 Ga0070690_100059133 3300005330 Bacteria 2463
19 Ga0070690_100069161 3300005330 Bacteria 2291
20 Ga0070690_100136383 3300005330 Bacteria 1662
21 Ga0070670_100013167 3300005331 Bacteria 7083
22 Ga0070670_100016557 3300005331 Bacteria 6328
23 Ga0070670_100017737 3300005331 Bacteria 6108
24 Ga0070670_100033875 3300005331 Bacteria 4398
25 Ga0070670_100037145 3300005331 Bacteria 4191
26 Ga0070670_100037395 3300005331 Bacteria 4177
27 Ga0070670_100039851 3300005331 Bacteria 4039
28 Ga0070670_100040783 3300005331 Bacteria 3990
29 Ga0070670_100068384 3300005331 Bacteria 3048
30 Ga0070670_100170142 3300005331 Bacteria 1890
31 Ga0070670_100176264 3300005331 Bacteria 1855
32 Ga0070677_10012971 3300005333 Bacteria 2904
33 Ga0070677_10025924 3300005333 Bacteria 2194
34 Ga0068869_100002085 3300005334 Bacteria 12019
35 Ga0068869_100003184 3300005334 Bacteria 10025
36 Ga0068869_100008807 3300005334 Bacteria 6528
37 Ga0068869_100011401 3300005334 Bacteria 5828
38 Ga0068869_100171508 3300005334 Bacteria 1695
39 Ga0068869_100172334 3300005334 Bacteria 1691
40 Ga0070666_10000817 3300005335 Bacteria 18876
41 Ga0070666_10042059 3300005335 Bacteria 3056
42 Ga0070680_100016703 3300005336 Bacteria 5778
43 Ga0070680_100030975 3300005336 Bacteria 4298
44 Ga0070680_100051733 3300005336 Bacteria 3352
45 Ga0070680_100122866 3300005336 Bacteria 2168
46 Ga0070680_100214522 3300005336 Bacteria 1624
47 Ga0070682_100045442 3300005337 Bacteria 2722
48 Ga0068868_100001366 3300005338 Bacteria 16818
49 Ga0068868_100014613 3300005338 Bacteria 5791
50 Ga0068868_100015750 3300005338 Bacteria 5600
51 Ga0068868_100236078 3300005338 Bacteria 1535
52 Ga0070660_100010357 3300005339 Bacteria 6587
53 Ga0070660_100014120 3300005339 Bacteria 5750
54 Ga0070660_100033882 3300005339 Bacteria 3853
55 Ga0070660_100109093 3300005339 Bacteria 2200
56 Ga0070660_100284864 3300005339 Bacteria 1352
57 Ga0070689_100003189 3300005340 Bacteria 10852
58 Ga0070689_100007507 3300005340 Bacteria 7632
59 Ga0070689_100111513 3300005340 Bacteria 2176
60 Ga0070689_100150301 3300005340 Bacteria 1878
61 Ga0070687_100015147 3300005343 Bacteria 3478
62 Ga0070661_100000684 3300005344 Bacteria 24880
63 Ga0070661_100002959 3300005344 Bacteria 11722
64 Ga0070661_100006137 3300005344 Bacteria 8275
65 Ga0070661_100008574 3300005344 Bacteria 7069
66 Ga0070661_100020674 3300005344 Bacteria 4695
67 Ga0070661_100102909 3300005344 Bacteria 2126
68 Ga0070668_100002423 3300005347 Bacteria 13727
69 Ga0070668_100005268 3300005347 Bacteria 9594
70 Ga0070668_100007450 3300005347 Bacteria 8120
71 Ga0070668_100042457 3300005347 Bacteria 3486
72 Ga0070668_100097028 3300005347 Bacteria 2331
73 Ga0070668_100215581 3300005347 Bacteria 1581
74 Ga0070669_100006437 3300005353 Bacteria 8454
75 Ga0070669_100009280 3300005353 Bacteria 7005
76 Ga0070669_100018199 3300005353 Bacteria 5018
77 Ga0070669_100018404 3300005353 Bacteria 4993
78 Ga0070669_100028240 3300005353 Bacteria 4040
79 Ga0070669_100071437 3300005353 Bacteria 2568
80 Ga0070669_100077962 3300005353 Bacteria 2462
81 Ga0070675_100000627 3300005354 Bacteria 24410
82 Ga0070675_100007720 3300005354 Bacteria 8329
83 Ga0070675_100008870 3300005354 Bacteria 7818
84 Ga0070675_100011059 3300005354 Bacteria 7064
85 Ga0070675_100042791 3300005354 Bacteria 3701
86 Ga0070671_100003273 3300005355 Bacteria 12634
87 Ga0070671_100012618 3300005355 Bacteria 6809
88 Ga0070671_100031922 3300005355 Bacteria 4353
89 Ga0070671_100089585 3300005355 Bacteria 2576
90 Ga0070671_100091027 3300005355 Bacteria 2554
91 Ga0070671_100138136 3300005355 Bacteria 2055
92 Ga0070671_100158077 3300005355 Bacteria 1915
93 Ga0070671_100178216 3300005355 Bacteria 1799
94 Ga0070674_100008824 3300005356 Bacteria 6019
95 Ga0070674_100034125 3300005356 Bacteria 3395
96 Ga0070674_100150506 3300005356 Bacteria 1756
97 Ga0070674_100338091 3300005356 Bacteria 1212
98 Ga0070673_100000185 3300005364 Bacteria 30432
99 Ga0070673_100000201 3300005364 Bacteria 29461
100 Ga0070673_100006002 3300005364 Bacteria 7861
101 Ga0070673_100014251 3300005364 Bacteria 5529
102 Ga0070673_100066387 3300005364 Bacteria 2882
103 Ga0070673_100087622 3300005364 Bacteria 2538
104 Ga0070688_100001590 3300005365 Bacteria 11358
105 Ga0070688_100086373 3300005365 Bacteria 2041
106 Ga0070659_100001168 3300005366 Bacteria 19178
107 Ga0070659_100003774 3300005366 Bacteria 10810
108 Ga0070659_100025701 3300005366 Bacteria 4526
109 Ga0070659_100051078 3300005366 Bacteria 3250
110 Ga0070659_100095892 3300005366 Bacteria 2382
111 Ga0070659_100121459 3300005366 Bacteria 2116
112 Ga0070667_100001167 3300005367 Bacteria 23878
113 Ga0070667_100013594 3300005367 Bacteria 6727
114 Ga0070667_100019677 3300005367 Bacteria 5600
115 Ga0070667_100043390 3300005367 Bacteria 3774
116 Ga0070667_100044192 3300005367 Bacteria 3740
117 Ga0070667_100051551 3300005367 Bacteria 3470
118 Ga0070667_100165395 3300005367 Bacteria 1951
119 Ga0070667_100175836 3300005367 Bacteria 1892
120 Ga0070667_100313141 3300005367 Bacteria 1415
121 Ga0070703_10051977 3300005406 Bacteria 1313
122 Ga0070709_10001351 3300005434 Bacteria 13384
123 Ga0070714_100007989 3300005435 Bacteria 8244
124 Ga0070714_100008833 3300005435 Bacteria 7880
125 Ga0070714_100018561 3300005435 Bacteria 5653
126 Ga0070714_100046592 3300005435 Bacteria 3679
127 Ga0070713_100000030 3300005436 Bacteria 88948
128 Ga0070713_100001543 3300005436 Bacteria 14718
129 Ga0070713_100021192 3300005436 Bacteria 4994
130 Ga0070710_10012652 3300005437 Bacteria 4198
131 Ga0070710_10027778 3300005437 Bacteria 3021
132 Ga0070710_10236864 3300005437 Bacteria 1168
133 Ga0070711_100006114 3300005439 Bacteria 7239
134 Ga0070705_100009717 3300005440 Bacteria 4792
135 Ga0070700_100072053 3300005441 Bacteria 2207
136 Ga0070700_100099655 3300005441 Bacteria 1912
137 Ga0070700_100291228 3300005441 Unclassified 1188
138 Ga0070708_100001043 3300005445 Bacteria 21086
139 Ga0070708_100082825 3300005445 Bacteria 2907
140 Ga0070663_100006132 3300005455 Bacteria 7197
141 Ga0070663_100089464 3300005455 Bacteria 2278
142 Ga0070663_100229534 3300005455 Bacteria 1461
143 Ga0070678_100001834 3300005456 Bacteria 11465
144 Ga0070678_100001855 3300005456 Bacteria 11394
145 Ga0070678_100005715 3300005456 Bacteria 7226
146 Ga0070678_100054152 3300005456 Bacteria 2921
147 Ga0070678_100284531 3300005456 Bacteria 1399
148 Ga0070662_100000231 3300005457 Bacteria 32882
149 Ga0070662_100010816 3300005457 Bacteria 6008
150 Ga0070662_100019356 3300005457 Bacteria 4621
151 Ga0070662_100021178 3300005457 Bacteria 4437
152 Ga0070662_100065493 3300005457 Bacteria 2664
153 Ga0070681_10001167 3300005458 Bacteria 22682
154 Ga0070681_10015054 3300005458 Bacteria 7694
155 Ga0070681_10031044 3300005458 Bacteria 5362
156 Ga0068867_100001434 3300005459 Bacteria 16501
157 Ga0068867_100004915 3300005459 Bacteria 9413
158 Ga0068867_100005761 3300005459 Bacteria 8790
159 Ga0068867_100039560 3300005459 Bacteria 3438
160 Ga0068867_100143272 3300005459 Unclassified 1870
161 Ga0068867_100305192 3300005459 Bacteria 1314
162 Ga0070685_10006489 3300005466 Bacteria 5966
163 Ga0070685_10010063 3300005466 Bacteria 4906
164 Ga0070685_10092292 3300005466 Bacteria 1835
165 Ga0070706_100037659 3300005467 Bacteria 4466
166 Ga0070707_100005798 3300005468 Bacteria 11522
167 Ga0070707_100035942 3300005468 Bacteria 4727
168 Ga0070698_100212340 3300005471 Bacteria 1870
169 Ga0070698_100375961 3300005471 Bacteria 1353
170 Ga0070699_100019721 3300005518 Bacteria 5811
171 Ga0070699_100057335 3300005518 Bacteria 3374
172 Ga0070699_100103043 3300005518 Bacteria 2502
173 Ga0070679_100054397 3300005530 Bacteria 3985
174 Ga0070679_100526120 3300005530 Bacteria 1126
175 Ga0070684_100009731 3300005535 Bacteria 7586
176 Ga0070684_100068345 3300005535 Bacteria 3122
177 Ga0070684_100076289 3300005535 Bacteria 2958
178 Ga0070697_100028064 3300005536 Bacteria 4506
179 Ga0070697_100045017 3300005536 Bacteria 3575
180 Ga0068853_100003933 3300005539 Bacteria 11409
181 Ga0068853_100018206 3300005539 Bacteria 5811
182 Ga0068853_100025331 3300005539 Bacteria 4977
183 Ga0068853_100070055 3300005539 Bacteria 3052
184 Ga0068853_100078618 3300005539 Bacteria 2883
185 Ga0068853_100196022 3300005539 Bacteria 1837
186 Ga0068853_100306097 3300005539 Bacteria 1470
187 Ga0070672_100000223 3300005543 Bacteria 31541
188 Ga0070672_100000824 3300005543 Bacteria 18534
189 Ga0070672_100050782 3300005543 Bacteria 3232
190 Ga0070672_100072401 3300005543 Bacteria 2744
191 Ga0070672_100114670 3300005543 Bacteria 2200
192 Ga0070672_100129707 3300005543 Bacteria 2071
193 Ga0070672_100143913 3300005543 Bacteria 1969
194 Ga0070686_100040395 3300005544 Bacteria 2910
195 Ga0070695_100031213 3300005545 Bacteria 3321
196 Ga0070695_100344319 3300005545 Bacteria 1115
197 Ga0070696_100002770 3300005546 Bacteria 11631
198 Ga0070693_100001116 3300005547 Bacteria 12049
199 Ga0070693_100024979 3300005547 Bacteria 3210
200 Ga0070665_100005859 3300005548 Bacteria 12601
201 Ga0070665_100015989 3300005548 Bacteria 7532
202 Ga0070665_100072109 3300005548 Bacteria 3461
203 Ga0070665_100075700 3300005548 Bacteria 3373
204 Ga0070665_100147453 3300005548 Bacteria 2356
205 Ga0070665_100237172 3300005548 Bacteria 1824
206 Ga0068855_100004445 3300005563 Bacteria 17126
207 Ga0068855_100020149 3300005563 Bacteria 8008
208 Ga0068855_100101207 3300005563 Bacteria 3317
209 Ga0068855_100160086 3300005563 Bacteria 2556
210 Ga0070664_100000449 3300005564 Bacteria 31120
211 Ga0070664_100007761 3300005564 Bacteria 8662
212 Ga0070664_100010738 3300005564 Bacteria 7424
213 Ga0070664_100106136 3300005564 Bacteria 2447
214 Ga0070664_100108210 3300005564 Bacteria 2424
215 Ga0070664_100110906 3300005564 Bacteria 2394
216 Ga0070664_100475366 3300005564 Bacteria 1150
217 Ga0068857_100003297 3300005577 Bacteria 13409
218 Ga0068857_100003665 3300005577 Bacteria 12869
219 Ga0068854_100002982 3300005578 Bacteria 10496
220 Ga0068854_100013868 3300005578 Bacteria 5300
221 Ga0068854_100022152 3300005578 Bacteria 4323
222 Ga0068854_100354459 3300005578 Bacteria 1202
223 Ga0068856_100000352 3300005614 Bacteria 50157
224 Ga0068856_100002500 3300005614 Bacteria 18912
225 Ga0068856_100004315 3300005614 Bacteria 14193
226 Ga0068856_100026370 3300005614 Bacteria 5667
227 Ga0068856_100044660 3300005614 Bacteria 4362
228 Ga0068856_100051442 3300005614 Bacteria 4061
229 Ga0070702_100003532 3300005615 Bacteria 7004
230 Ga0070702_100004271 3300005615 Bacteria 6508
231 Ga0070702_100229225 3300005615 Bacteria 1247
232 Ga0068852_100001151 3300005616 Bacteria 17500
233 Ga0068852_100003970 3300005616 Bacteria 10390
234 Ga0068852_100005558 3300005616 Bacteria 9040
235 Ga0068852_100029358 3300005616 Bacteria 4517
236 Ga0068852_100102990 3300005616 Bacteria 2581
237 Ga0068859_100006727 3300005617 Bacteria 11678
238 Ga0068859_100022950 3300005617 Bacteria 6257
239 Ga0068859_100043557 3300005617 Bacteria 4511
240 Ga0068859_100227862 3300005617 Bacteria 1951
241 Ga0068859_100358587 3300005617 Bacteria 1553
242 Ga0068864_100003433 3300005618 Bacteria 13103
243 Ga0068864_100011081 3300005618 Bacteria 7450
244 Ga0068864_100031238 3300005618 Bacteria 4518
245 Ga0068864_100033514 3300005618 Bacteria 4366
246 Ga0068864_100033762 3300005618 Bacteria 4351
247 Ga0068864_100095908 3300005618 Bacteria 2624
248 Ga0068866_10004798 3300005718 Bacteria 5547
249 Ga0068861_100007478 3300005719 Bacteria 7489
250 Ga0068861_100053620 3300005719 Bacteria 3069
251 Ga0068861_100077480 3300005719 Bacteria 2593
252 Ga0068861_100088153 3300005719 Bacteria 2443
253 Ga0068861_100103713 3300005719 Bacteria 2267
254 Ga0068861_100122720 3300005719 Bacteria 2098
255 Ga0068861_100369837 3300005719 Bacteria 1263
256 Ga0068851_10001834 3300005834 Bacteria 9307
257 Ga0068851_10008775 3300005834 Bacteria 4683
258 Ga0068851_10035807 3300005834 Bacteria 2483
259 Ga0068851_10053865 3300005834 Bacteria 2049
260 Ga0068851_10104182 3300005834 Bacteria 1508
261 Ga0068870_10002095 3300005840 Bacteria 8269
262 Ga0068870_10010318 3300005840 Bacteria 4288
263 Ga0068870_10052348 3300005840 Bacteria 2164
264 Ga0068870_10217704 3300005840 Bacteria 1167
265 Ga0068863_100002012 3300005841 Bacteria 20158
266 Ga0068863_100006361 3300005841 Bacteria 11583
267 Ga0068863_100026272 3300005841 Bacteria 5555
268 Ga0068863_100043713 3300005841 Bacteria 4252
269 Ga0068863_100048646 3300005841 Bacteria 4020
270 Ga0068863_100093703 3300005841 Bacteria 2850
271 Ga0068863_100141630 3300005841 Bacteria 2298
272 Ga0068858_100002297 3300005842 Bacteria 19353
273 Ga0068858_100009487 3300005842 Bacteria 9284
274 Ga0068858_100010526 3300005842 Bacteria 8758
275 Ga0068858_100026007 3300005842 Bacteria 5443
276 Ga0068858_100247419 3300005842 Bacteria 1693
277 Ga0068858_100473163 3300005842 Bacteria 1209
278 Ga0068860_100003704 3300005843 Bacteria 15729
279 Ga0068860_100005698 3300005843 Bacteria 12578
280 Ga0068860_100037392 3300005843 Bacteria 4647
281 Ga0068862_100007504 3300005844 Bacteria 9035
282 Ga0068862_100009794 3300005844 Bacteria 7919
283 Ga0068862_100015852 3300005844 Bacteria 6261
284 Ga0068862_100086560 3300005844 Bacteria 2724
285 Ga0068862_100126495 3300005844 Bacteria 2257
286 Ga0068862_100141259 3300005844 Bacteria 2137
287 Ga0081539_10050070 3300005985 Bacteria 2366
288 Ga0070715_10026607 3300006163 Bacteria 2303
289 Ga0070712_100005225 3300006175 Bacteria 8033
290 Ga0097621_100006614 3300006237 Bacteria 8233
291 Ga0097621_100024307 3300006237 Bacteria 4730
292 Ga0097621_100027316 3300006237 Bacteria 4487
293 Ga0097621_100089203 3300006237 Bacteria 2578
294 Ga0097621_100270884 3300006237 Bacteria 1492
295 Ga0068871_100001509 3300006358 Bacteria 15611
296 Ga0068871_100007421 3300006358 Bacteria 7832
297 Ga0068871_100045492 3300006358 Bacteria 3533
298 Ga0068871_100063693 3300006358 Bacteria 3016
299 Ga0068871_100172183 3300006358 Bacteria 1857
300 Ga0068871_100402857 3300006358 Bacteria 1219
301 Ga0075428_100233157 3300006844 Bacteria 1986
302 Ga0075433_10003436 3300006852 Bacteria 12220
303 Ga0075434_100210396 3300006871 Bacteria 1965
304 Ga0068865_100001092 3300006881 Bacteria 15639
305 Ga0068865_100009925 3300006881 Bacteria 5916
306 Ga0068865_100018534 3300006881 Bacteria 4493
307 Ga0068865_100070784 3300006881 Bacteria 2472
308 Ga0068865_100115479 3300006881 Bacteria 1987
309 Ga0097620_100006727 3300006931 Bacteria 11678
310 Ga0097620_100022951 3300006931 Bacteria 6257
311 Ga0097620_100043557 3300006931 Bacteria 4511
312 Ga0097620_100227860 3300006931 Bacteria 1951
313 Ga0097620_100358591 3300006931 Bacteria 1553
314 Ga0075435_100040987 3300007076 Bacteria 3700
315 Ga0075435_100205344 3300007076 Bacteria 1670
316 Ga0105240_10002382 3300009093 Bacteria 30315
317 Ga0105240_10006968 3300009093 Bacteria 16506
318 Ga0105240_10013279 3300009093 Bacteria 11324
319 Ga0105240_10119862 3300009093 Bacteria 3169
320 Ga0111539_10028200 3300009094 Bacteria 6852
321 Ga0111539_10116439 3300009094 Bacteria 3134
322 Ga0105245_10065169 3300009098 Bacteria 3294
323 Ga0105245_10072171 3300009098 Bacteria 3135
324 Ga0114129_10383344 3300009147 Bacteria 1856
325 Ga0105243_10137498 3300009148 Bacteria 2080
326 Ga0105243_10342200 3300009148 Bacteria 1370
327 Ga0105243_10399850 3300009148 Bacteria 1276
328 Ga0105241_10021177 3300009174 Bacteria 4806
329 Ga0105241_10040050 3300009174 Bacteria 3536
330 Ga0105241_10043739 3300009174 Bacteria 3393
331 Ga0105242_10083430 3300009176 Bacteria 2676
332 Ga0105242_10122154 3300009176 Bacteria 2237
333 Ga0105248_10003257 3300009177 Bacteria 18001
334 Ga0105248_10008245 3300009177 Bacteria 11447
335 Ga0105248_10119043 3300009177 Bacteria 2979
336 Ga0105248_10335852 3300009177 Bacteria 1701
337 Ga0105237_10018935 3300009545 Bacteria 7116
338 Ga0105237_10071497 3300009545 Bacteria 3464
339 Ga0105237_10087672 3300009545 Bacteria 3102
340 Ga0105238_10001047 3300009551 Bacteria 27979
341 Ga0105238_10006592 3300009551 Bacteria 11568
342 Ga0105238_10169488 3300009551 Bacteria 2159
343 Ga0105238_10399098 3300009551 Bacteria 1368
344 Ga0105249_10082705 3300009553 Bacteria 2987
345 Ga0105249_10121675 3300009553 Bacteria 2481
346 Ga0105239_10047825 3300010375 Bacteria 4689
347 Ga0105239_10052029 3300010375 Bacteria 4490
348 Ga0105239_10071517 3300010375 Bacteria 3811
349 Ga0105239_10223540 3300010375 Bacteria 2112
350 Ga0105239_10730386 3300010375 Bacteria 1133
351 Ga0105246_10027297 3300011119 Bacteria 3739
352 Ga0105246_10039945 3300011119 Bacteria 3164
353 Ga0157373_10013310 3300013100 Bacteria 6037
354 Ga0157373_10074797 3300013100 Bacteria 2390
355 Ga0157371_10001442 3300013102 Bacteria 24677
356 Ga0157370_10013262 3300013104 Bacteria 8492
357 Ga0157370_10017113 3300013104 Bacteria 7320
358 Ga0157370_10036429 3300013104 Bacteria 4773
359 Ga0157370_10071386 3300013104 Bacteria 3276
360 Ga0157374_10001073 3300013296 Bacteria 23714
361 Ga0157374_10002679 3300013296 Bacteria 14978
362 Ga0157374_10009647 3300013296 Bacteria 8291
363 Ga0157374_10151617 3300013296 Bacteria 2254
364 Ga0157378_10028351 3300013297 Bacteria 4940
365 Ga0157378_10030147 3300013297 Bacteria 4792
366 Ga0163162_10032518 3300013306 Bacteria 5182
367 Ga0163162_10049665 3300013306 Bacteria 4204
368 Ga0163162_10117820 3300013306 Bacteria 2757
369 Ga0157372_10000868 3300013307 Bacteria 32826
370 Ga0157372_10027420 3300013307 Bacteria 6202
371 Ga0157372_10076022 3300013307 Bacteria 3791
372 Ga0157372_10146795 3300013307 Bacteria 2720
373 Ga0157375_10008993 3300013308 Bacteria 8743
374 Ga0157375_10014303 3300013308 Bacteria 7074
375 Ga0157375_10232272 3300013308 Bacteria 2003
376 Ga0157375_10278124 3300013308 Bacteria 1837
377 Ga0157375_10285260 3300013308 Bacteria 1814
378 Ga0157375_10530746 3300013308 Bacteria 1340
379 Ga0163163_10004165 3300014325 Bacteria 12325
380 Ga0163163_10004973 3300014325 Bacteria 11446
381 Ga0163163_10206763 3300014325 Bacteria 2011
382 Ga0157380_10032782 3300014326 Bacteria 3998
383 Ga0157380_10061085 3300014326 Bacteria 3014
384 Ga0157380_10073264 3300014326 Bacteria 2776
385 Ga0157377_10012174 3300014745 Bacteria 4318
386 Ga0157379_10001856 3300014968 Bacteria 17486
387 Ga0157379_10004840 3300014968 Bacteria 11563
388 Ga0157379_10008895 3300014968 Bacteria 8754
389 Ga0157379_10009037 3300014968 Bacteria 8681
390 Ga0157379_10018835 3300014968 Bacteria 6089
391 Ga0157379_10378197 3300014968 Bacteria 1299
392 Ga0157376_10004080 3300014969 Bacteria 10103
393 Ga0157376_10012420 3300014969 Bacteria 6322
394 Ga0157376_10088568 3300014969 Bacteria 2674
395 Ga0157376_10158320 3300014969 Bacteria 2050
396 Ga0163161_10004900 3300017792 Bacteria 9323
397 Ga0163161_10048424 3300017792 Bacteria 3069
398 Ga0163161_10050367 3300017792 Bacteria 3013
399 Ga0163161_10053174 3300017792 Bacteria 2936
400 Ga0163161_10065038 3300017792 Bacteria 2661
401 Ga0163161_10189137 3300017792 Bacteria 1582
402 Ga0207697_10003224 3300025315 Bacteria 8110
403 Ga0207697_10044852 3300025315 Bacteria 1820
404 Ga0207656_10033760 3300025321 Bacteria 2133
405 Ga0207656_10075780 3300025321 Bacteria 1503
406 Ga0207682_10000037 3300025893 Bacteria 54103
407 Ga0207682_10000221 3300025893 Bacteria 25725
408 Ga0207692_10009365 3300025898 Bacteria 4087
409 Ga0207692_10034615 3300025898 Bacteria 2447
410 Ga0207642_10003225 3300025899 Bacteria 5119
411 Ga0207642_10036823 3300025899 Bacteria 2103
412 Ga0207688_10001263 3300025901 Bacteria 13116
413 Ga0207680_10003245 3300025903 Bacteria 7658
414 Ga0207680_10009599 3300025903 Bacteria 4806
415 Ga0207680_10015086 3300025903 Bacteria 4022
416 Ga0207647_10057963 3300025904 Bacteria 2373
417 Ga0207699_10002975 3300025906 Bacteria 8055
418 Ga0207699_10046920 3300025906 Bacteria 2530
419 Ga0207699_10140989 3300025906 Bacteria 1584
420 Ga0207645_10000372 3300025907 Bacteria 37106
421 Ga0207645_10000375 3300025907 Bacteria 36955
422 Ga0207645_10001825 3300025907 Bacteria 17179
423 Ga0207645_10024685 3300025907 Bacteria 3893
424 Ga0207645_10027216 3300025907 Bacteria 3694
425 Ga0207645_10061755 3300025907 Bacteria 2393
426 Ga0207645_10084779 3300025907 Bacteria 2034
427 Ga0207645_10111475 3300025907 Bacteria 1771
428 Ga0207643_10000184 3300025908 Bacteria 43056
429 Ga0207643_10017074 3300025908 Bacteria 3963
430 Ga0207643_10024909 3300025908 Bacteria 3303
431 Ga0207643_10074449 3300025908 Bacteria 1959
432 Ga0207643_10196968 3300025908 Bacteria 1225
433 Ga0207705_10022556 3300025909 Bacteria 4490
434 Ga0207705_10401703 3300025909 Bacteria 1060
435 Ga0207654_10004230 3300025911 Bacteria 7241
436 Ga0207654_10020309 3300025911 Bacteria 3519
437 Ga0207654_10042548 3300025911 Bacteria 2572
438 Ga0207654_10084850 3300025911 Bacteria 1916
439 Ga0207707_10001968 3300025912 Bacteria 18649
440 Ga0207707_10014545 3300025912 Bacteria 6854
441 Ga0207707_10029979 3300025912 Bacteria 4756
442 Ga0207707_10107139 3300025912 Bacteria 2443
443 Ga0207707_10365353 3300025912 Bacteria 1242
444 Ga0207695_10009448 3300025913 Bacteria 12060
445 Ga0207695_10012102 3300025913 Bacteria 10371
446 Ga0207695_10026760 3300025913 Bacteria 6432
447 Ga0207695_10077525 3300025913 Bacteria 3375
448 Ga0207695_10414069 3300025913 Bacteria 1232
449 Ga0207693_10009391 3300025915 Bacteria 7977
450 Ga0207693_10022732 3300025915 Bacteria 4981
451 Ga0207663_10078586 3300025916 Bacteria 2151
452 Ga0207663_10152461 3300025916 Bacteria 1623
453 Ga0207660_10020364 3300025917 Bacteria 4450
454 Ga0207660_10058140 3300025917 Bacteria 2772
455 Ga0207662_10001995 3300025918 Bacteria 10077
456 Ga0207662_10095815 3300025918 Bacteria 1832
457 Ga0207657_10001631 3300025919 Bacteria 24164
458 Ga0207657_10013531 3300025919 Bacteria 8002
459 Ga0207657_10039602 3300025919 Bacteria 4186
460 Ga0207657_10044154 3300025919 Bacteria 3920
461 Ga0207657_10107442 3300025919 Bacteria 2308
462 Ga0207657_10142417 3300025919 Bacteria 1958
463 Ga0207657_10211031 3300025919 Bacteria 1558
464 Ga0207649_10001364 3300025920 Bacteria 14486
465 Ga0207649_10014941 3300025920 Bacteria 4357
466 Ga0207649_10027009 3300025920 Bacteria 3365
467 Ga0207649_10036846 3300025920 Bacteria 2949
468 Ga0207649_10059704 3300025920 Bacteria 2394
469 Ga0207652_10003740 3300025921 Bacteria 12483
470 Ga0207652_10060921 3300025921 Bacteria 3258
471 Ga0207646_10014927 3300025922 Bacteria 7354
472 Ga0207646_10031255 3300025922 Bacteria 4822
473 Ga0207681_10004333 3300025923 Bacteria 8760
474 Ga0207681_10016172 3300025923 Bacteria 4661
475 Ga0207681_10017233 3300025923 Bacteria 4533
476 Ga0207681_10017717 3300025923 Bacteria 4477
477 Ga0207681_10024299 3300025923 Bacteria 3888
478 Ga0207681_10024712 3300025923 Bacteria 3858
479 Ga0207681_10058975 3300025923 Bacteria 2630
480 Ga0207681_10088939 3300025923 Bacteria 2201
481 Ga0207694_10002911 3300025924 Bacteria 13778
482 Ga0207694_10005312 3300025924 Bacteria 9924
483 Ga0207694_10072962 3300025924 Bacteria 2684
484 Ga0207650_10000534 3300025925 Bacteria 31116
485 Ga0207650_10006406 3300025925 Bacteria 8018
486 Ga0207650_10019975 3300025925 Bacteria 4717
487 Ga0207650_10023935 3300025925 Bacteria 4336
488 Ga0207650_10026659 3300025925 Bacteria 4125
489 Ga0207650_10150659 3300025925 Bacteria 1835
490 Ga0207659_10000713 3300025926 Bacteria 19773
491 Ga0207659_10002264 3300025926 Bacteria 11455
492 Ga0207659_10004379 3300025926 Bacteria 8531
493 Ga0207659_10040828 3300025926 Bacteria 3247
494 Ga0207659_10416393 3300025926 Bacteria 1126
495 Ga0207687_10004110 3300025927 Bacteria 9748
496 Ga0207700_10000066 3300025928 Bacteria 64844
497 Ga0207700_10225582 3300025928 Bacteria 1590
498 Ga0207664_10001528 3300025929 Bacteria 15189
499 Ga0207664_10007402 3300025929 Bacteria 7612
500 Ga0207664_10019054 3300025929 Bacteria 5064
501 Ga0207664_10038871 3300025929 Bacteria 3691
502 Ga0207664_10084737 3300025929 Bacteria 2585
503 Ga0207644_10004950 3300025931 Bacteria 8693
504 Ga0207644_10010558 3300025931 Bacteria 6089
505 Ga0207644_10014811 3300025931 Bacteria 5227
506 Ga0207644_10055197 3300025931 Bacteria 2863
507 Ga0207644_10076511 3300025931 Bacteria 2462
508 Ga0207644_10081886 3300025931 Bacteria 2386
509 Ga0207644_10142169 3300025931 Bacteria 1849
510 Ga0207644_10162211 3300025931 Bacteria 1738
511 Ga0207644_10274673 3300025931 Bacteria 1352
512 Ga0207690_10000274 3300025932 Bacteria 36658
513 Ga0207690_10038021 3300025932 Bacteria 3129
514 Ga0207690_10042299 3300025932 Bacteria 2991
515 Ga0207706_10000490 3300025933 Bacteria 42281
516 Ga0207706_10002115 3300025933 Bacteria 19440
517 Ga0207706_10006200 3300025933 Bacteria 11110
518 Ga0207706_10043764 3300025933 Bacteria 3967
519 Ga0207706_10362955 3300025933 Bacteria 1258
520 Ga0207686_10000751 3300025934 Bacteria 19996
521 Ga0207670_10004339 3300025936 Bacteria 7621
522 Ga0207669_10006030 3300025937 Bacteria 5497
523 Ga0207669_10019351 3300025937 Bacteria 3543
524 Ga0207669_10351409 3300025937 Bacteria 1139
525 Ga0207704_10006377 3300025938 Bacteria 5499
526 Ga0207704_10017620 3300025938 Bacteria 3708
527 Ga0207704_10079216 3300025938 Bacteria 2116
528 Ga0207704_10092756 3300025938 Bacteria 1988
529 Ga0207704_10109457 3300025938 Bacteria 1864
530 Ga0207665_10003112 3300025939 Bacteria 11126
531 Ga0207691_10000024 3300025940 Bacteria 132111
532 Ga0207691_10000105 3300025940 Bacteria 74790
533 Ga0207691_10000946 3300025940 Bacteria 28764
534 Ga0207691_10006036 3300025940 Bacteria 11692
535 Ga0207691_10008061 3300025940 Bacteria 10121
536 Ga0207691_10044972 3300025940 Bacteria 4061
537 Ga0207691_10054264 3300025940 Bacteria 3656
538 Ga0207691_10078712 3300025940 Bacteria 2967
539 Ga0207691_10101961 3300025940 Bacteria 2561
540 Ga0207691_10201013 3300025940 Bacteria 1734
541 Ga0207711_10001060 3300025941 Bacteria 26348
542 Ga0207711_10002821 3300025941 Bacteria 15264
543 Ga0207711_10024922 3300025941 Bacteria 5017
544 Ga0207711_10046758 3300025941 Bacteria 3698
545 Ga0207711_10064925 3300025941 Bacteria 3154
546 Ga0207711_10094119 3300025941 Bacteria 2640
547 Ga0207689_10000280 3300025942 Bacteria 46392
548 Ga0207689_10003217 3300025942 Bacteria 14956
549 Ga0207689_10009114 3300025942 Bacteria 8589
550 Ga0207689_10012296 3300025942 Bacteria 7325
551 Ga0207689_10020096 3300025942 Bacteria 5623
552 Ga0207689_10137493 3300025942 Bacteria 2012
553 Ga0207661_10013870 3300025944 Bacteria 5889
554 Ga0207661_10225289 3300025944 Bacteria 1658
555 Ga0207661_10232058 3300025944 Bacteria 1634
556 Ga0207679_10006081 3300025945 Bacteria 7613
557 Ga0207679_10008084 3300025945 Bacteria 6689
558 Ga0207679_10033764 3300025945 Bacteria 3603
559 Ga0207679_10038581 3300025945 Bacteria 3404
560 Ga0207679_10086830 3300025945 Bacteria 2407
561 Ga0207679_10098269 3300025945 Bacteria 2282
562 Ga0207667_10000233 3300025949 Bacteria 77272
563 Ga0207667_10007727 3300025949 Bacteria 12855
564 Ga0207667_10029899 3300025949 Bacteria 5901
565 Ga0207667_10149339 3300025949 Bacteria 2406
566 Ga0207667_10218893 3300025949 Bacteria 1951
567 Ga0207667_10252153 3300025949 Bacteria 1805
568 Ga0207667_10312327 3300025949 Bacteria 1605
569 Ga0207651_10005137 3300025960 Bacteria 6683
570 Ga0207651_10022831 3300025960 Bacteria 3835
571 Ga0207651_10066178 3300025960 Bacteria 2538
572 Ga0207651_10088909 3300025960 Bacteria 2253
573 Ga0207712_10022936 3300025961 Bacteria 4116
574 Ga0207712_10037174 3300025961 Bacteria 3321
575 Ga0207712_10150698 3300025961 Bacteria 1796
576 Ga0207668_10001563 3300025972 Bacteria 13401
577 Ga0207668_10001610 3300025972 Bacteria 13173
578 Ga0207668_10035479 3300025972 Bacteria 3321
579 Ga0207668_10037279 3300025972 Bacteria 3252
580 Ga0207668_10186714 3300025972 Bacteria 1639
581 Ga0207668_10391745 3300025972 Bacteria 1172
582 Ga0207640_10004833 3300025981 Bacteria 7317
583 Ga0207640_10008154 3300025981 Bacteria 5804
584 Ga0207640_10149713 3300025981 Bacteria 1713
585 Ga0207640_10173248 3300025981 Bacteria 1610
586 Ga0207640_10379281 3300025981 Bacteria 1145
587 Ga0207658_10004796 3300025986 Bacteria 9359
588 Ga0207658_10014732 3300025986 Bacteria 5358
589 Ga0207658_10037602 3300025986 Bacteria 3479
590 Ga0207658_10065119 3300025986 Bacteria 2736
591 Ga0207658_10075749 3300025986 Bacteria 2561
592 Ga0207658_10131405 3300025986 Bacteria 2012
593 Ga0207658_10180525 3300025986 Bacteria 1746
594 Ga0207658_10370217 3300025986 Bacteria 1252
595 Ga0207677_10010805 3300026023 Bacteria 5178
596 Ga0207677_10058662 3300026023 Bacteria 2651
597 Ga0207677_10072720 3300026023 Bacteria 2432
598 Ga0207677_10154320 3300026023 Bacteria 1776
599 Ga0207677_10186241 3300026023 Bacteria 1637
600 Ga0207703_10001378 3300026035 Bacteria 22200
601 Ga0207703_10005357 3300026035 Bacteria 10334
602 Ga0207703_10035484 3300026035 Bacteria 3963
603 Ga0207703_10042330 3300026035 Bacteria 3653
604 Ga0207703_10049236 3300026035 Bacteria 3406
605 Ga0207703_10240759 3300026035 Bacteria 1626
606 Ga0207703_10460985 3300026035 Bacteria 1189
607 Ga0207639_10001680 3300026041 Bacteria 14925
608 Ga0207639_10005475 3300026041 Bacteria 8581
609 Ga0207639_10036733 3300026041 Bacteria 3633
610 Ga0207639_10169525 3300026041 Bacteria 1847
611 Ga0207678_10002134 3300026067 Bacteria 17910
612 Ga0207678_10010909 3300026067 Bacteria 7982
613 Ga0207678_10019526 3300026067 Bacteria 5954
614 Ga0207678_10040385 3300026067 Bacteria 4047
615 Ga0207678_10044974 3300026067 Bacteria 3818
616 Ga0207678_10180432 3300026067 Bacteria 1803
617 Ga0207678_10211187 3300026067 Bacteria 1660
618 Ga0207708_10069968 3300026075 Bacteria 2687
619 Ga0207708_10351743 3300026075 Bacteria 1209
620 Ga0207702_10000597 3300026078 Bacteria 39958
621 Ga0207702_10002745 3300026078 Bacteria 16477
622 Ga0207702_10075853 3300026078 Bacteria 2905
623 Ga0207641_10001320 3300026088 Bacteria 24547
624 Ga0207641_10003262 3300026088 Bacteria 14451
625 Ga0207641_10003391 3300026088 Bacteria 14137
626 Ga0207641_10006692 3300026088 Bacteria 9661
627 Ga0207641_10053942 3300026088 Bacteria 3409
628 Ga0207641_10069224 3300026088 Bacteria 3029
629 Ga0207641_10088903 3300026088 Bacteria 2699
630 Ga0207641_10121925 3300026088 Bacteria 2328
631 Ga0207641_10123156 3300026088 Bacteria 2317
632 Ga0207641_10299497 3300026088 Bacteria 1518
633 Ga0207648_10000320 3300026089 Bacteria 52595
634 Ga0207648_10001593 3300026089 Bacteria 24841
635 Ga0207648_10007451 3300026089 Bacteria 10759
636 Ga0207648_10011397 3300026089 Bacteria 8377
637 Ga0207648_10020040 3300026089 Bacteria 6034
638 Ga0207648_10107123 3300026089 Bacteria 2453
639 Ga0207648_10132045 3300026089 Bacteria 2198
640 Ga0207648_10191415 3300026089 Bacteria 1813
641 Ga0207676_10000695 3300026095 Bacteria 26546
642 Ga0207676_10000810 3300026095 Bacteria 24390
643 Ga0207676_10003064 3300026095 Bacteria 11921
644 Ga0207676_10005814 3300026095 Bacteria 8721
645 Ga0207676_10309847 3300026095 Bacteria 1445
646 Ga0207674_10000228 3300026116 Bacteria 70115
647 Ga0207674_10002723 3300026116 Bacteria 22045
648 Ga0207674_10004527 3300026116 Bacteria 16694
649 Ga0207674_10007142 3300026116 Bacteria 13045
650 Ga0207674_10009259 3300026116 Bacteria 11288
651 Ga0207674_10116670 3300026116 Bacteria 2640
652 Ga0207675_100000538 3300026118 Bacteria 36903
653 Ga0207675_100000981 3300026118 Bacteria 28343
654 Ga0207675_100019107 3300026118 Bacteria 6397
655 Ga0207675_100026814 3300026118 Bacteria 5362
656 Ga0207675_100032294 3300026118 Bacteria 4876
657 Ga0207675_100043863 3300026118 Bacteria 4177
658 Ga0207675_100087160 3300026118 Bacteria 2932
659 Ga0207675_100252661 3300026118 Bacteria 1707
660 Ga0207683_10000012 3300026121 Bacteria 134768
661 Ga0207683_10000648 3300026121 Bacteria 31842
662 Ga0207683_10002415 3300026121 Bacteria 16316
663 Ga0207683_10007769 3300026121 Bacteria 9176
664 Ga0207683_10013999 3300026121 Bacteria 6840
665 Ga0207683_10273875 3300026121 Bacteria 1542
666 Ga0207698_10003629 3300026142 Bacteria 9315
667 Ga0207698_10008594 3300026142 Bacteria 6470
668 Ga0207698_10013337 3300026142 Bacteria 5417
669 Ga0207698_10030768 3300026142 Bacteria 3865
670 Ga0207698_10036081 3300026142 Bacteria 3625
671 Ga0207698_10068267 3300026142 Bacteria 2807
672 Ga0207698_10521174 3300026142 Bacteria 1160
673 Ga0209999_1003865 3300027543 Bacteria 2694
674 Ga0209983_1010295 3300027665 Bacteria 1910
675 Ga0209983_1026184 3300027665 Bacteria 1233
676 Ga0209971_1012732 3300027682 Bacteria 1993
677 Ga0209966_1010439 3300027695 Bacteria 1674
678 Ga0209974_10005947 3300027876 Bacteria 4274
679 Ga0209974_10025768 3300027876 Bacteria 1946
680 Ga0268266_10006268 3300028379 Bacteria 10911
681 Ga0268266_10013434 3300028379 Bacteria 7050
682 Ga0268266_10042104 3300028379 Bacteria 3899
683 Ga0268266_10092646 3300028379 Bacteria 2651
684 Ga0268266_10158571 3300028379 Bacteria 2046
685 Ga0268266_10187073 3300028379 Bacteria 1889
686 Ga0268266_10399158 3300028379 Bacteria 1300
687 Ga0268265_10023405 3300028380 Bacteria 4353
688 Ga0268265_10029283 3300028380 Bacteria 3951
689 Ga0268265_10038124 3300028380 Bacteria 3533
690 Ga0268265_10062993 3300028380 Bacteria 2852
691 Ga0268265_10084522 3300028380 Bacteria 2516
692 Ga0268265_10132478 3300028380 Bacteria 2074
693 Ga0268265_10259316 3300028380 Bacteria 1544
694 Ga0268264_10000715 3300028381 Bacteria 38163
695 Ga0268264_10005867 3300028381 Bacteria 10393
696 Ga0268264_10007796 3300028381 Bacteria 8914
697 Ga0268264_10042018 3300028381 Bacteria 3783
698 Ga0268264_10079041 3300028381 Bacteria 2805
699 Ga0268264_10162661 3300028381 Bacteria 2012
700 Ga0268264_10219810 3300028381 Bacteria 1748
701 Ga0268264_10404324 3300028381 Bacteria 1313
702 Ga0265330_10006406 3300031235 Bacteria 5818
703 Ga0265332_10001537 3300031238 Bacteria 12792
704 Ga0265325_10028225 3300031241 Bacteria 3027
705 Ga0265329_10001584 3300031242 Bacteria 10888
706 Ga0265331_10008734 3300031250 Bacteria 5742
707 Ga0265327_10007673 3300031251 Bacteria 8262
708 Ga0307408_100021018 3300031548 Bacteria 4412
709 Ga0307408_100215477 3300031548 Bacteria 1563
710 Ga0265314_10045428 3300031711 Bacteria 3105
711 Ga0316576_10019749 3300031727 Bacteria 4621
712 Ga0307405_10000957 3300031731 Bacteria 11553
713 Ga0307405_10006936 3300031731 Bacteria 5624
714 Ga0307413_10025644 3300031824 Bacteria 3235
715 Ga0307413_10027782 3300031824 Bacteria 3141
716 Ga0307410_10005743 3300031852 Bacteria 6611
717 Ga0307410_10022576 3300031852 Bacteria 3892
718 Ga0307410_10046585 3300031852 Bacteria 2893
719 Ga0307410_10178407 3300031852 Bacteria 1606
720 Ga0307406_10001894 3300031901 Bacteria 11411
721 Ga0307406_10004314 3300031901 Bacteria 7736
722 Ga0307406_10080378 3300031901 Bacteria 2164
723 Ga0307407_10000502 3300031903 Bacteria 12090
724 Ga0307407_10106299 3300031903 Bacteria 1753
725 Ga0307412_10000834 3300031911 Bacteria 17697
726 Ga0307409_100000835 3300031995 Bacteria 14201
727 Ga0307409_100059697 3300031995 Bacteria 2969
728 Ga0307416_100013347 3300032002 Bacteria 5579
729 Ga0307416_100016473 3300032002 Bacteria 5140
730 Ga0307416_100022874 3300032002 Bacteria 4522
731 Ga0307414_10053043 3300032004 Bacteria 2826
732 Ga0307414_10134490 3300032004 Bacteria 1925
733 Ga0307411_10001720 3300032005 Bacteria 9201
734 Ga0307411_10001987 3300032005 Bacteria 8778
735 Ga0307411_10144663 3300032005 Bacteria 1758
736 Ga0307415_100000471 3300032126 Bacteria 17381
737 Ga0307415_100031662 3300032126 Bacteria 3410
738 Ga0307415_100044223 3300032126 Bacteria 2976
739 Ga0373923_0025974 3300035111 Bacteria 2326
740 Ga0373923_0106161 3300035111 Unclassified 1243
741 Ga0373953_0055100 3300035117 Bacteria 1614
742 Ga0373954_0001602 3300035118 Bacteria 9231
743 Ga0373956_0121201 3300035119 Bacteria 1221
744 Ga0373957_0016112 3300035120 Bacteria 2583
745 Ga0373943_0062172 3300035170 Bacteria 1868
746 Ga0373943_0111786 3300035170 Bacteria 1442
747 Ga0373946_0061532 3300035171 Bacteria 1599
748 Ga0373955_0018133 3300035172 Bacteria 3495
749 Ga0373955_0039877 3300035172 Bacteria 2509
750 Ga0373924_0054238 3300035410 Bacteria 1666
751 Ga0373924_0146367 3300035410 Bacteria 1032
752 Ga0373935_0091797 3300035692 Bacteria 1989
753 Ga0373927_0008146 3300035695 Bacteria 7069
754 Ga0373927_0035655 3300035695 Bacteria 3235
755 Ga0373933_0014510 3300035724 Bacteria 4385
756 Ga0373933_0192628 3300035724 Bacteria 1303
757 Ga0373947_0047023 3300035725 Bacteria 2585
758 Ga0373947_0079795 3300035725 Bacteria 2023
759 Ga0373937_0012651 3300036401 Bacteria 7426
760 Ga0373937_0047296 3300036401 Bacteria 3936
761 Ga0373937_0048034 3300036401 Bacteria 3905
762 Ga0373937_0146885 3300036401 Unclassified 2208
763 Ga0316582_0265322 3300036647 Bacteria 1178
764 Ga0395899_0078788 3300037312 Bacteria 2401
765 Ga0395900_0153339 3300037418 Bacteria 2354
766 Ga0395905_0052905 3300037471 Bacteria 3801
767 Ga0451577_0190759 3300042876 Bacteria 1848
768 Ga0451576_0115107 3300045051 Bacteria 2800
769 Ga0451576_0663209 3300045051 Bacteria 1096
770 Ga0495592_0286670 3300046454 Bacteria 1075
771 Ga0495629_0069521 3300046459 Bacteria 2457
772 Ga0495580_0166818 3300046472 Bacteria 1523
773 Ga0495580_0187194 3300046472 Bacteria 1429
774 Ga0495582_0024688 3300046473 Bacteria 3289
775 Ga0495662_0034513 3300046476 Bacteria 2441
776 Ga0495664_0060338 3300046477 Bacteria 2258
777 Ga0495628_0331263 3300046516 Bacteria 1122
778 Ga0495587_0036189 3300046536 Bacteria 2970
779 Ga0495621_0000512 3300046539 Bacteria 9613
780 Ga0495621_0028747 3300046539 Bacteria 1892
781 Ga0495621_0034983 3300046539 Bacteria 1738
782 Ga0495667_0019164 3300046559 Bacteria 4617
783 Ga0495657_0208029 3300046675 Bacteria 1190
784 Ga0495647_0002008 3300046681 Bacteria 6353
785 Ga0495613_0042443 3300046689 Bacteria 3365
786 Ga0495680_0143151 3300047322 Bacteria 1748
787 Ga0495684_0046191 3300047471 Bacteria 3331
788 Ga0495593_0048447 3300047673 Bacteria 2258
789 Ga0496100_0007194 3300048903 Bacteria 6119
790 Ga0496101_0018109 3300048904 Bacteria 4783
791 Ga0496101_0082229 3300048904 Bacteria 2383
792 Ga0496102_0003917 3300048905 Bacteria 12606
793 Ga0496102_0012334 3300048905 Bacteria 7394
794 Ga0496102_0040330 3300048905 Bacteria 4223
795 Ga0496102_0304686 3300048905 Bacteria 1501
796 Ga0496103_0101575 3300048906 Bacteria 1821
797 Ga0496104_0007505 3300048907 Bacteria 9644
798 Ga0496105_0003654 3300048908 Bacteria 11435
799 Ga0496106_0000839 3300048909 Bacteria 22300
800 Ga0496107_0091448 3300048910 Bacteria 2224
801 Ga0496107_0234258 3300048910 Bacteria 1366
802 Ga0496109_0001406 3300048912 Bacteria 19959
803 Ga0496109_0101564 3300048912 Bacteria 2669
804 Ga0496109_0374450 3300048912 Bacteria 1345
805 Ga0496110_0027448 3300048913 Bacteria 4881
806 Ga0496110_0211623 3300048913 Bacteria 1763
807 Ga0496112_0017317 3300048915 Bacteria 6768
808 Ga0496112_0044779 3300048915 Bacteria 4336
809 Ga0496112_0283073 3300048915 Bacteria 1605
810 Ga0496113_0151162 3300048916 Bacteria 1832
811 Ga0496114_0028211 3300048917 Bacteria 4605
812 Ga0496114_0058237 3300048917 Bacteria 3226
813 Ga0496114_0324540 3300048917 Bacteria 1361
814 Ga0496115_0084037 3300048918 Bacteria 2595
815 Ga0496115_0200782 3300048918 Bacteria 1647
816 Ga0501034_0161897 3300049571 Bacteria 2208
817 Ga0501036_0159275 3300049572 Bacteria 1904
818 Ga0501036_0236958 3300049572 Unclassified 1531
819 Ga0501067_0019917 3300049583 Bacteria 3712
820 Ga0501072_0068040 3300049588 Bacteria 2811
821 Ga0501073_0044290 3300049589 Bacteria 3136
822 Ga0501074_0097536 3300049590 Bacteria 2104
823 Ga0501080_0001862 3300049742 Bacteria 18118
824 Ga0501083_0043867 3300049744 Bacteria 3028
825 Ga0501083_0054597 3300049744 Bacteria 2681
826 Ga0501035_0085831 3300049822 Bacteria 2774
827 nmdc:mga05p37_406516_c1 3300050507 Bacteria 1588
828 nmdc:mga08y16_13583_c1 3300050511 Bacteria 8571
829 nmdc:mga08y16_84020_c1 3300050511 Bacteria 3318
830 nmdc:mga0n895_183860_c1 3300050512 Bacteria 2122
831 nmdc:mga0n895_244964_c1 3300050512 Bacteria 1819
832 nmdc:mga0rr50_12539_c1 3300050513 Bacteria 5484
833 nmdc:mga0rr50_260582_c1 3300050513 Bacteria 1442
834 nmdc:mga08x19_194612_c1 3300050514 Bacteria 1388
835 nmdc:mga0a205_37207_c1 3300050515 Bacteria 4680
836 Ga0495612_0019191 3300053078 Bacteria 2739
837 Ga0495619_0005662 3300053085 Bacteria 7921
838 Ga0495619_0173167 3300053085 Bacteria 1493
839 Ga0495619_0259461 3300053085 Unclassified 1204
840 Ga0501082_0137796 3300060353 Bacteria 2118
841 Ga0105248_10034777
842 JGI24743J22301_10005969
843 JGI24034J26672_10011558
844 Ga0065712_10138683
845 Ga0065715_10165010
846 Ga0070658_10049863
847 Ga0070658_10103315
848 Ga0070676_10000779
849 Ga0070676_10003237
850 Ga0070676_10011177
851 Ga0070676_10020943
852 Ga0070676_10031243
853 Ga0070676_10078883
854 Ga0070676_10119220
855 Ga0070683_100014846
856 Ga0070683_100029948
857 Ga0070690_100006980
858 Ga0070690_100059133
859 Ga0070690_100069161
860 Ga0070690_100136383
861 Ga0070670_100013167
862 Ga0070670_100016557
863 Ga0070670_100017737
864 Ga0070670_100033875
865 Ga0070670_100037145
866 Ga0070670_100037395
867 Ga0070670_100039851
868 Ga0070670_100040783
869 Ga0070670_100068384
870 Ga0070670_100170142
871 Ga0070670_100176264
872 Ga0070677_10012971
873 Ga0070677_10025924
874 Ga0068869_100002085
875 Ga0068869_100003184
876 Ga0068869_100008807
877 Ga0068869_100011401
878 Ga0068869_100171508
879 Ga0068869_100172334
880 Ga0070666_10000817
881 Ga0070666_10042059
882 Ga0070680_100016703
883 Ga0070680_100030975
884 Ga0070680_100051733
885 Ga0070680_100122866
886 Ga0070680_100214522
887 Ga0070682_100045442
888 Ga0068868_100001366
889 Ga0068868_100014613
890 Ga0068868_100015750
891 Ga0068868_100236078
892 Ga0070660_100010357
893 Ga0070660_100014120
894 Ga0070660_100033882
895 Ga0070660_100109093
896 Ga0070660_100284864
897 Ga0070689_100003189
898 Ga0070689_100007507
899 Ga0070689_100111513
900 Ga0070689_100150301
901 Ga0070687_100015147
902 Ga0070661_100000684
903 Ga0070661_100002959
904 Ga0070661_100006137
905 Ga0070661_100008574
906 Ga0070661_100020674
907 Ga0070661_100102909
908 Ga0070668_100002423
909 Ga0070668_100005268
910 Ga0070668_100007450
911 Ga0070668_100042457
912 Ga0070668_100097028
913 Ga0070668_100215581
914 Ga0070669_100006437
915 Ga0070669_100009280
916 Ga0070669_100018199
917 Ga0070669_100018404
918 Ga0070669_100028240
919 Ga0070669_100071437
920 Ga0070669_100077962
921 Ga0070675_100000627
922 Ga0070675_100007720
923 Ga0070675_100008870
924 Ga0070675_100011059
925 Ga0070675_100042791
926 Ga0070671_100003273
927 Ga0070671_100012618
928 Ga0070671_100031922
929 Ga0070671_100089585
930 Ga0070671_100091027
931 Ga0070671_100138136
932 Ga0070671_100158077
933 Ga0070671_100178216
934 Ga0070674_100008824
935 Ga0070674_100034125
936 Ga0070674_100150506
937 Ga0070674_100338091
938 Ga0070673_100000185
939 Ga0070673_100000201
940 Ga0070673_100006002
941 Ga0070673_100014251
942 Ga0070673_100066387
943 Ga0070673_100087622
944 Ga0070688_100001590
945 Ga0070688_100086373
946 Ga0070659_100001168
947 Ga0070659_100003774
948 Ga0070659_100025701
949 Ga0070659_100051078
950 Ga0070659_100095892
951 Ga0070659_100121459
952 Ga0070667_100001167
953 Ga0070667_100013594
954 Ga0070667_100019677
955 Ga0070667_100043390
956 Ga0070667_100044192
957 Ga0070667_100051551
958 Ga0070667_100165395
959 Ga0070667_100175836
960 Ga0070667_100313141
961 Ga0070703_10051977
962 Ga0070709_10001351
963 Ga0070714_100007989
964 Ga0070714_100008833
965 Ga0070714_100018561
966 Ga0070714_100046592
967 Ga0070713_100000030
968 Ga0070713_100001543
969 Ga0070713_100021192
970 Ga0070710_10012652
971 Ga0070710_10027778
972 Ga0070710_10236864
973 Ga0070711_100006114
974 Ga0070705_100009717
975 Ga0070700_100072053
976 Ga0070700_100099655
977 Ga0070700_100291228
978 Ga0070708_100001043
979 Ga0070708_100082825
980 Ga0070663_100006132
981 Ga0070663_100089464
982 Ga0070663_100229534
983 Ga0070678_100001834
984 Ga0070678_100001855
985 Ga0070678_100005715
986 Ga0070678_100054152
987 Ga0070678_100284531
988 Ga0070662_100000231
989 Ga0070662_100010816
990 Ga0070662_100019356
991 Ga0070662_100021178
992 Ga0070662_100065493
993 Ga0070681_10001167
994 Ga0070681_10015054
995 Ga0070681_10031044
996 Ga0068867_100001434
997 Ga0068867_100004915
998 Ga0068867_100005761
999 Ga0068867_100039560
1000 Ga0068867_100143272
1001 Ga0068867_100305192
1002 Ga0070685_10006489
1003 Ga0070685_10010063
1004 Ga0070685_10092292
1005 Ga0070706_100037659
1006 Ga0070707_100005798
1007 Ga0070707_100035942
1008 Ga0070698_100212340
1009 Ga0070698_100375961
1010 Ga0070699_100019721
1011 Ga0070699_100057335
1012 Ga0070699_100103043
1013 Ga0070679_100054397
1014 Ga0070679_100526120
1015 Ga0070684_100009731
1016 Ga0070684_100068345
1017 Ga0070684_100076289
1018 Ga0070697_100028064
1019 Ga0070697_100045017
1020 Ga0068853_100003933
1021 Ga0068853_100018206
1022 Ga0068853_100025331
1023 Ga0068853_100070055
1024 Ga0068853_100078618
1025 Ga0068853_100196022
1026 Ga0068853_100306097
1027 Ga0070672_100000223
1028 Ga0070672_100000824
1029 Ga0070672_100050782
1030 Ga0070672_100072401
1031 Ga0070672_100114670
1032 Ga0070672_100129707
1033 Ga0070672_100143913
1034 Ga0070686_100040395
1035 Ga0070695_100031213
1036 Ga0070695_100344319
1037 Ga0070696_100002770
1038 Ga0070693_100001116
1039 Ga0070693_100024979
1040 Ga0070665_100005859
1041 Ga0070665_100015989
1042 Ga0070665_100072109
1043 Ga0070665_100075700
1044 Ga0070665_100147453
1045 Ga0070665_100237172
1046 Ga0068855_100004445
1047 Ga0068855_100020149
1048 Ga0068855_100101207
1049 Ga0068855_100160086
1050 Ga0070664_100000449
1051 Ga0070664_100007761
1052 Ga0070664_100010738
1053 Ga0070664_100106136
1054 Ga0070664_100108210
1055 Ga0070664_100110906
1056 Ga0070664_100475366
1057 Ga0068857_100003297
1058 Ga0068857_100003665
1059 Ga0068854_100002982
1060 Ga0068854_100013868
1061 Ga0068854_100022152
1062 Ga0068854_100354459
1063 Ga0068856_100000352
1064 Ga0068856_100002500
1065 Ga0068856_100004315
1066 Ga0068856_100026370
1067 Ga0068856_100044660
1068 Ga0068856_100051442
1069 Ga0070702_100003532
1070 Ga0070702_100004271
1071 Ga0070702_100229225
1072 Ga0068852_100001151
1073 Ga0068852_100003970
1074 Ga0068852_100005558
1075 Ga0068852_100029358
1076 Ga0068852_100102990
1077 Ga0068859_100006727
1078 Ga0068859_100022950
1079 Ga0068859_100043557
1080 Ga0068859_100227862
1081 Ga0068859_100358587
1082 Ga0068864_100003433
1083 Ga0068864_100011081
1084 Ga0068864_100031238
1085 Ga0068864_100033514
1086 Ga0068864_100033762
1087 Ga0068864_100095908
1088 Ga0068866_10004798
1089 Ga0068861_100007478
1090 Ga0068861_100053620
1091 Ga0068861_100077480
1092 Ga0068861_100088153
1093 Ga0068861_100103713
1094 Ga0068861_100122720
1095 Ga0068861_100369837
1096 Ga0068851_10001834
1097 Ga0068851_10008775
1098 Ga0068851_10035807
1099 Ga0068851_10053865
1100 Ga0068851_10104182
1101 Ga0068870_10002095
1102 Ga0068870_10010318
1103 Ga0068870_10052348
1104 Ga0068870_10217704
1105 Ga0068863_100002012
1106 Ga0068863_100006361
1107 Ga0068863_100026272
1108 Ga0068863_100043713
1109 Ga0068863_100048646
1110 Ga0068863_100093703
1111 Ga0068863_100141630
1112 Ga0068858_100002297
1113 Ga0068858_100009487
1114 Ga0068858_100010526
1115 Ga0068858_100026007
1116 Ga0068858_100247419
1117 Ga0068858_100473163
1118 Ga0068860_100003704
1119 Ga0068860_100005698
1120 Ga0068860_100037392
1121 Ga0068862_100007504
1122 Ga0068862_100009794
1123 Ga0068862_100015852
1124 Ga0068862_100086560
1125 Ga0068862_100126495
1126 Ga0068862_100141259
1127 Ga0081539_10050070
1128 Ga0070715_10026607
1129 Ga0070712_100005225
1130 Ga0097621_100006614
1131 Ga0097621_100024307
1132 Ga0097621_100027316
1133 Ga0097621_100089203
1134 Ga0097621_100270884
1135 Ga0068871_100001509
1136 Ga0068871_100007421
1137 Ga0068871_100045492
1138 Ga0068871_100063693
1139 Ga0068871_100172183
1140 Ga0068871_100402857
1141 Ga0075428_100233157
1142 Ga0075433_10003436
1143 Ga0075434_100210396
1144 Ga0068865_100001092
1145 Ga0068865_100009925
1146 Ga0068865_100018534
1147 Ga0068865_100070784
1148 Ga0068865_100115479
1149 Ga0097620_100006727
1150 Ga0097620_100022951
1151 Ga0097620_100043557
1152 Ga0097620_100227860
1153 Ga0097620_100358591
1154 Ga0075435_100040987
1155 Ga0075435_100205344
1156 Ga0105240_10002382
1157 Ga0105240_10006968
1158 Ga0105240_10013279
1159 Ga0105240_10119862
1160 Ga0111539_10028200
1161 Ga0111539_10116439
1162 Ga0105245_10065169
1163 Ga0105245_10072171
1164 Ga0114129_10383344
1165 Ga0105243_10137498
1166 Ga0105243_10342200
1167 Ga0105243_10399850
1168 Ga0105241_10021177
1169 Ga0105241_10040050
1170 Ga0105241_10043739
1171 Ga0105242_10083430
1172 Ga0105242_10122154
1173 Ga0105248_10003257
1174 Ga0105248_10008245
1175 Ga0105248_10119043
1176 Ga0105248_10335852
1177 Ga0105237_10018935
1178 Ga0105237_10071497
1179 Ga0105237_10087672
1180 Ga0105238_10001047
1181 Ga0105238_10006592
1182 Ga0105238_10169488
1183 Ga0105238_10399098
1184 Ga0105249_10082705
1185 Ga0105249_10121675
1186 Ga0105239_10047825
1187 Ga0105239_10052029
1188 Ga0105239_10071517
1189 Ga0105239_10223540
1190 Ga0105239_10730386
1191 Ga0105246_10027297
1192 Ga0105246_10039945
1193 Ga0157373_10013310
1194 Ga0157373_10074797
1195 Ga0157371_10001442
1196 Ga0157370_10013262
1197 Ga0157370_10017113
1198 Ga0157370_10036429
1199 Ga0157370_10071386
1200 Ga0157374_10001073
1201 Ga0157374_10002679
1202 Ga0157374_10009647
1203 Ga0157374_10151617
1204 Ga0157378_10028351
1205 Ga0157378_10030147
1206 Ga0163162_10032518
1207 Ga0163162_10049665
1208 Ga0163162_10117820
1209 Ga0157372_10000868
1210 Ga0157372_10027420
1211 Ga0157372_10076022
1212 Ga0157372_10146795
1213 Ga0157375_10008993
1214 Ga0157375_10014303
1215 Ga0157375_10232272
1216 Ga0157375_10278124
1217 Ga0157375_10285260
1218 Ga0157375_10530746
1219 Ga0163163_10004165
1220 Ga0163163_10004973
1221 Ga0163163_10206763
1222 Ga0157380_10032782
1223 Ga0157380_10061085
1224 Ga0157380_10073264
1225 Ga0157377_10012174
1226 Ga0157379_10001856
1227 Ga0157379_10004840
1228 Ga0157379_10008895
1229 Ga0157379_10009037
1230 Ga0157379_10018835
1231 Ga0157379_10378197
1232 Ga0157376_10004080
1233 Ga0157376_10012420
1234 Ga0157376_10088568
1235 Ga0157376_10158320
1236 Ga0163161_10004900
1237 Ga0163161_10048424
1238 Ga0163161_10050367
1239 Ga0163161_10053174
1240 Ga0163161_10065038
1241 Ga0163161_10189137
1242 Ga0207697_10003224
1243 Ga0207697_10044852
1244 Ga0207656_10033760
1245 Ga0207656_10075780
1246 Ga0207682_10000037
1247 Ga0207682_10000221
1248 Ga0207692_10009365
1249 Ga0207692_10034615
1250 Ga0207642_10003225
1251 Ga0207642_10036823
1252 Ga0207688_10001263
1253 Ga0207680_10003245
1254 Ga0207680_10009599
1255 Ga0207680_10015086
1256 Ga0207647_10057963
1257 Ga0207699_10002975
1258 Ga0207699_10046920
1259 Ga0207699_10140989
1260 Ga0207645_10000372
1261 Ga0207645_10000375
1262 Ga0207645_10001825
1263 Ga0207645_10024685
1264 Ga0207645_10027216
1265 Ga0207645_10061755
1266 Ga0207645_10084779
1267 Ga0207645_10111475
1268 Ga0207643_10000184
1269 Ga0207643_10017074
1270 Ga0207643_10024909
1271 Ga0207643_10074449
1272 Ga0207643_10196968
1273 Ga0207705_10022556
1274 Ga0207705_10401703
1275 Ga0207654_10004230
1276 Ga0207654_10020309
1277 Ga0207654_10042548
1278 Ga0207654_10084850
1279 Ga0207707_10001968
1280 Ga0207707_10014545
1281 Ga0207707_10029979
1282 Ga0207707_10107139
1283 Ga0207707_10365353
1284 Ga0207695_10009448
1285 Ga0207695_10012102
1286 Ga0207695_10026760
1287 Ga0207695_10077525
1288 Ga0207695_10414069
1289 Ga0207693_10009391
1290 Ga0207693_10022732
1291 Ga0207663_10078586
1292 Ga0207663_10152461
1293 Ga0207660_10020364
1294 Ga0207660_10058140
1295 Ga0207662_10001995
1296 Ga0207662_10095815
1297 Ga0207657_10001631
1298 Ga0207657_10013531
1299 Ga0207657_10039602
1300 Ga0207657_10044154
1301 Ga0207657_10107442
1302 Ga0207657_10142417
1303 Ga0207657_10211031
1304 Ga0207649_10001364
1305 Ga0207649_10014941
1306 Ga0207649_10027009
1307 Ga0207649_10036846
1308 Ga0207649_10059704
1309 Ga0207652_10003740
1310 Ga0207652_10060921
1311 Ga0207646_10014927
1312 Ga0207646_10031255
1313 Ga0207681_10004333
1314 Ga0207681_10016172
1315 Ga0207681_10017233
1316 Ga0207681_10017717
1317 Ga0207681_10024299
1318 Ga0207681_10024712
1319 Ga0207681_10058975
1320 Ga0207681_10088939
1321 Ga0207694_10002911
1322 Ga0207694_10005312
1323 Ga0207694_10072962
1324 Ga0207650_10000534
1325 Ga0207650_10006406
1326 Ga0207650_10019975
1327 Ga0207650_10023935
1328 Ga0207650_10026659
1329 Ga0207650_10150659
1330 Ga0207659_10000713
1331 Ga0207659_10002264
1332 Ga0207659_10004379
1333 Ga0207659_10040828
1334 Ga0207659_10416393
1335 Ga0207687_10004110
1336 Ga0207700_10000066
1337 Ga0207700_10225582
1338 Ga0207664_10001528
1339 Ga0207664_10007402
1340 Ga0207664_10019054
1341 Ga0207664_10038871
1342 Ga0207664_10084737
1343 Ga0207644_10004950
1344 Ga0207644_10010558
1345 Ga0207644_10014811
1346 Ga0207644_10055197
1347 Ga0207644_10076511
1348 Ga0207644_10081886
1349 Ga0207644_10142169
1350 Ga0207644_10162211
1351 Ga0207644_10274673
1352 Ga0207690_10000274
1353 Ga0207690_10038021
1354 Ga0207690_10042299
1355 Ga0207706_10000490
1356 Ga0207706_10002115
1357 Ga0207706_10006200
1358 Ga0207706_10043764
1359 Ga0207706_10362955
1360 Ga0207686_10000751
1361 Ga0207670_10004339
1362 Ga0207669_10006030
1363 Ga0207669_10019351
1364 Ga0207669_10351409
1365 Ga0207704_10006377
1366 Ga0207704_10017620
1367 Ga0207704_10079216
1368 Ga0207704_10092756
1369 Ga0207704_10109457
1370 Ga0207665_10003112
1371 Ga0207691_10000024
1372 Ga0207691_10000105
1373 Ga0207691_10000946
1374 Ga0207691_10006036
1375 Ga0207691_10008061
1376 Ga0207691_10044972
1377 Ga0207691_10054264
1378 Ga0207691_10078712
1379 Ga0207691_10101961
1380 Ga0207691_10201013
1381 Ga0207711_10001060
1382 Ga0207711_10002821
1383 Ga0207711_10024922
1384 Ga0207711_10046758
1385 Ga0207711_10064925
1386 Ga0207711_10094119
1387 Ga0207689_10000280
1388 Ga0207689_10003217
1389 Ga0207689_10009114
1390 Ga0207689_10012296
1391 Ga0207689_10020096
1392 Ga0207689_10137493
1393 Ga0207661_10013870
1394 Ga0207661_10225289
1395 Ga0207661_10232058
1396 Ga0207679_10006081
1397 Ga0207679_10008084
1398 Ga0207679_10033764
1399 Ga0207679_10038581
1400 Ga0207679_10086830
1401 Ga0207679_10098269
1402 Ga0207667_10000233
1403 Ga0207667_10007727
1404 Ga0207667_10029899
1405 Ga0207667_10149339
1406 Ga0207667_10218893
1407 Ga0207667_10252153
1408 Ga0207667_10312327
1409 Ga0207651_10005137
1410 Ga0207651_10022831
1411 Ga0207651_10066178
1412 Ga0207651_10088909
1413 Ga0207712_10022936
1414 Ga0207712_10037174
1415 Ga0207712_10150698
1416 Ga0207668_10001563
1417 Ga0207668_10001610
1418 Ga0207668_10035479
1419 Ga0207668_10037279
1420 Ga0207668_10186714
1421 Ga0207668_10391745
1422 Ga0207640_10004833
1423 Ga0207640_10008154
1424 Ga0207640_10149713
1425 Ga0207640_10173248
1426 Ga0207640_10379281
1427 Ga0207658_10004796
1428 Ga0207658_10014732
1429 Ga0207658_10037602
1430 Ga0207658_10065119
1431 Ga0207658_10075749
1432 Ga0207658_10131405
1433 Ga0207658_10180525
1434 Ga0207658_10370217
1435 Ga0207677_10010805
1436 Ga0207677_10058662
1437 Ga0207677_10072720
1438 Ga0207677_10154320
1439 Ga0207677_10186241
1440 Ga0207703_10001378
1441 Ga0207703_10005357
1442 Ga0207703_10035484
1443 Ga0207703_10042330
1444 Ga0207703_10049236
1445 Ga0207703_10240759
1446 Ga0207703_10460985
1447 Ga0207639_10001680
1448 Ga0207639_10005475
1449 Ga0207639_10036733
1450 Ga0207639_10169525
1451 Ga0207678_10002134
1452 Ga0207678_10010909
1453 Ga0207678_10019526
1454 Ga0207678_10040385
1455 Ga0207678_10044974
1456 Ga0207678_10180432
1457 Ga0207678_10211187
1458 Ga0207708_10069968
1459 Ga0207708_10351743
1460 Ga0207702_10000597
1461 Ga0207702_10002745
1462 Ga0207702_10075853
1463 Ga0207641_10001320
1464 Ga0207641_10003262
1465 Ga0207641_10003391
1466 Ga0207641_10006692
1467 Ga0207641_10053942
1468 Ga0207641_10069224
1469 Ga0207641_10088903
1470 Ga0207641_10121925
1471 Ga0207641_10123156
1472 Ga0207641_10299497
1473 Ga0207648_10000320
1474 Ga0207648_10001593
1475 Ga0207648_10007451
1476 Ga0207648_10011397
1477 Ga0207648_10020040
1478 Ga0207648_10107123
1479 Ga0207648_10132045
1480 Ga0207648_10191415
1481 Ga0207676_10000695
1482 Ga0207676_10000810
1483 Ga0207676_10003064
1484 Ga0207676_10005814
1485 Ga0207676_10309847
1486 Ga0207674_10000228
1487 Ga0207674_10002723
1488 Ga0207674_10004527
1489 Ga0207674_10007142
1490 Ga0207674_10009259
1491 Ga0207674_10116670
1492 Ga0207675_100000538
1493 Ga0207675_100000981
1494 Ga0207675_100019107
1495 Ga0207675_100026814
1496 Ga0207675_100032294
1497 Ga0207675_100043863
1498 Ga0207675_100087160
1499 Ga0207675_100252661
1500 Ga0207683_10000012
1501 Ga0207683_10000648
1502 Ga0207683_10002415
1503 Ga0207683_10007769
1504 Ga0207683_10013999
1505 Ga0207683_10273875
1506 Ga0207698_10003629
1507 Ga0207698_10008594
1508 Ga0207698_10013337
1509 Ga0207698_10030768
1510 Ga0207698_10036081
1511 Ga0207698_10068267
1512 Ga0207698_10521174
1513 Ga0209999_1003865
1514 Ga0209983_1010295
1515 Ga0209983_1026184
1516 Ga0209971_1012732
1517 Ga0209966_1010439
1518 Ga0209974_10005947
1519 Ga0209974_10025768
1520 Ga0268266_10006268
1521 Ga0268266_10013434
1522 Ga0268266_10042104
1523 Ga0268266_10092646
1524 Ga0268266_10158571
1525 Ga0268266_10187073
1526 Ga0268266_10399158
1527 Ga0268265_10023405
1528 Ga0268265_10029283
1529 Ga0268265_10038124
1530 Ga0268265_10062993
1531 Ga0268265_10084522
1532 Ga0268265_10132478
1533 Ga0268265_10259316
1534 Ga0268264_10000715
1535 Ga0268264_10005867
1536 Ga0268264_10007796
1537 Ga0268264_10042018
1538 Ga0268264_10079041
1539 Ga0268264_10162661
1540 Ga0268264_10219810
1541 Ga0268264_10404324
1542 Ga0265330_10006406
1543 Ga0265332_10001537
1544 Ga0265325_10028225
1545 Ga0265329_10001584
1546 Ga0265331_10008734
1547 Ga0265327_10007673
1548 Ga0307408_100021018
1549 Ga0307408_100215477
1550 Ga0265314_10045428
1551 Ga0316576_10019749
1552 Ga0307405_10000957
1553 Ga0307405_10006936
1554 Ga0307413_10025644
1555 Ga0307413_10027782
1556 Ga0307410_10005743
1557 Ga0307410_10022576
1558 Ga0307410_10046585
1559 Ga0307410_10178407
1560 Ga0307406_10001894
1561 Ga0307406_10004314
1562 Ga0307406_10080378
1563 Ga0307407_10000502
1564 Ga0307407_10106299
1565 Ga0307412_10000834
1566 Ga0307409_100000835
1567 Ga0307409_100059697
1568 Ga0307416_100013347
1569 Ga0307416_100016473
1570 Ga0307416_100022874
1571 Ga0307414_10053043
1572 Ga0307414_10134490
1573 Ga0307411_10001720
1574 Ga0307411_10001987
1575 Ga0307411_10144663
1576 Ga0307415_100000471
1577 Ga0307415_100031662
1578 Ga0307415_100044223
1579 Ga0373923_0025974
1580 Ga0373923_0106161
1581 Ga0373953_0055100
1582 Ga0373954_0001602
1583 Ga0373956_0121201
1584 Ga0373957_0016112
1585 Ga0373943_0062172
1586 Ga0373943_0111786
1587 Ga0373946_0061532
1588 Ga0373955_0018133
1589 Ga0373955_0039877
1590 Ga0373924_0054238
1591 Ga0373924_0146367
1592 Ga0373935_0091797
1593 Ga0373927_0008146
1594 Ga0373927_0035655
1595 Ga0373933_0014510
1596 Ga0373933_0192628
1597 Ga0373947_0047023
1598 Ga0373947_0079795
1599 Ga0373937_0012651
1600 Ga0373937_0047296
1601 Ga0373937_0048034
1602 Ga0373937_0146885
1603 Ga0316582_0265322
1604 Ga0395899_0078788
1605 Ga0395900_0153339
1606 Ga0395905_0052905
1607 Ga0451577_0190759
1608 Ga0451576_0115107
1609 Ga0451576_0663209
1610 Ga0495592_0286670
1611 Ga0495629_0069521
1612 Ga0495580_0166818
1613 Ga0495580_0187194
1614 Ga0495582_0024688
1615 Ga0495662_0034513
1616 Ga0495664_0060338
1617 Ga0495628_0331263
1618 Ga0495587_0036189
1619 Ga0495621_0000512
1620 Ga0495621_0028747
1621 Ga0495621_0034983
1622 Ga0495667_0019164
1623 Ga0495657_0208029
1624 Ga0495647_0002008
1625 Ga0495613_0042443
1626 Ga0495680_0143151
1627 Ga0495684_0046191
1628 Ga0495593_0048447
1629 Ga0496100_0007194
1630 Ga0496101_0018109
1631 Ga0496101_0082229
1632 Ga0496102_0003917
1633 Ga0496102_0012334
1634 Ga0496102_0040330
1635 Ga0496102_0304686
1636 Ga0496103_0101575
1637 Ga0496104_0007505
1638 Ga0496105_0003654
1639 Ga0496106_0000839
1640 Ga0496107_0091448
1641 Ga0496107_0234258
1642 Ga0496109_0001406
1643 Ga0496109_0101564
1644 Ga0496109_0374450
1645 Ga0496110_0027448
1646 Ga0496110_0211623
1647 Ga0496112_0017317
1648 Ga0496112_0044779
1649 Ga0496112_0283073
1650 Ga0496113_0151162
1651 Ga0496114_0028211
1652 Ga0496114_0058237
1653 Ga0496114_0324540
1654 Ga0496115_0084037
1655 Ga0496115_0200782
1656 Ga0501034_0161897
1657 Ga0501036_0159275
1658 Ga0501036_0236958
1659 Ga0501067_0019917
1660 Ga0501072_0068040
1661 Ga0501073_0044290
1662 Ga0501074_0097536
1663 Ga0501080_0001862
1664 Ga0501083_0043867
1665 Ga0501083_0054597
1666 Ga0501035_0085831
1667 nmdc:mga05p37_406516_c1
1668 nmdc:mga08y16_13583_c1
1669 nmdc:mga08y16_84020_c1
1670 nmdc:mga0n895_183860_c1
1671 nmdc:mga0n895_244964_c1
1672 nmdc:mga0rr50_12539_c1
1673 nmdc:mga0rr50_260582_c1
1674 nmdc:mga08x19_194612_c1
1675 nmdc:mga0a205_37207_c1
1676 Ga0495612_0019191
1677 Ga0495619_0005662
1678 Ga0495619_0173167
1679 Ga0495619_0259461
1680 Ga0501082_0137796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

51

139

0.89

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

178

302

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jxk-assembly1.cif.gz_B crystal structure of oxidoreductase rop_24000 (target efi-506400) from rhodococcus opacus b4 0.966 4 330
3nx4-assembly1.cif.gz_B crystal structure of the yhdh oxidoreductase from salmonella enterica in complex with nadp 0.9658 5 329
4jxk-assembly1.cif.gz_B crystal structure of oxidoreductase rop_24000 (target efi-506400) from rhodococcus opacus b4 0.9602 4 330
3nx4-assembly1.cif.gz_B crystal structure of the yhdh oxidoreductase from salmonella enterica in complex with nadp 0.96 5 329
1y9e-assembly1.cif.gz_B crystal structure of bacillus subtilis protein yhfp with nad bound 0.9537 1 328
ID Description Score Start End Superfamily
af_Q2FVQ0_97_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9648 130 289 3.40.50.720
af_Q2FVQ0_2_295_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9606 35 326 3.90.180.10
af_P26646_4_324_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9578 8 329 2.40.50.140
af_P26646_4_324_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.952 8 329 2.40.50.140
af_Q2FVQ0_2_295_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9511 35 326 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A6D0M0M7-F1-model_v4 deleted 0.978 136 269
AF-A0A2I6QIP0-F1-model_v4 Alcohol dehydrogenase (EC 1.1.1.1) 0.978 116 229 GO:0004022
GO:0043957
AF-A0A3N9URX8-F1-model_v4 Oxidoreductase 0.9778 1 331 GO:0043957
AF-A0A2N2UW23-F1-model_v4 Oxidoreductase 0.9777 2 330 GO:0043957
AF-A0A3N9URX8-F1-model_v4 Oxidoreductase 0.9749 1 331 GO:0043957

Map