F482542
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 828 | 279 | 828 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10071448|Ga0070658_100714482 |
| Length | 132 |
| Sequence | MSSSQHSTSRNNAEKDEMAQPTIDQTTFDELKETAGAEFVGELVDTFLGEAPAMLDELRRSLDAGDADRFRRAAHSLKSNSHTFGAMTLGAMARELELGGIASVRNAGAAPLDALTTEYSRVAAALTALKNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 103 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 189 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 213 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 269 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 270 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 3.38 |
| Rhizosphere | 95.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10018002 | 3300001991 | Bacteria | 1331 |
| 2 | Ga0065715_10162868 | 3300005293 | Bacteria | 1613 |
| 3 | Ga0065715_10274298 | 3300005293 | Bacteria | 1103 |
| 4 | Ga0070658_10071448 | 3300005327 | Bacteria | 2843 |
| 5 | Ga0070676_10000349 | 3300005328 | Bacteria | 21146 |
| 6 | Ga0070676_10440632 | 3300005328 | Bacteria | 914 |
| 7 | Ga0070676_10450540 | 3300005328 | Bacteria | 905 |
| 8 | Ga0070676_10601232 | 3300005328 | Bacteria | 793 |
| 9 | Ga0070683_100026175 | 3300005329 | Bacteria | 5249 |
| 10 | Ga0070683_100348861 | 3300005329 | Bacteria | 1409 |
| 11 | Ga0070690_100007721 | 3300005330 | Bacteria | 6167 |
| 12 | Ga0070690_100009894 | 3300005330 | Bacteria | 5531 |
| 13 | Ga0070690_100562678 | 3300005330 | Bacteria | 861 |
| 14 | Ga0070670_100006222 | 3300005331 | Bacteria | 10096 |
| 15 | Ga0070670_100023428 | 3300005331 | Bacteria | 5314 |
| 16 | Ga0070670_100033631 | 3300005331 | Bacteria | 4416 |
| 17 | Ga0070670_100045157 | 3300005331 | Bacteria | 3787 |
| 18 | Ga0070670_100080500 | 3300005331 | Bacteria | 2799 |
| 19 | Ga0070670_100179110 | 3300005331 | Bacteria | 1840 |
| 20 | Ga0070670_100364209 | 3300005331 | Bacteria | 1272 |
| 21 | Ga0070670_101041813 | 3300005331 | Bacteria | 745 |
| 22 | Ga0070670_101499920 | 3300005331 | Bacteria | 619 |
| 23 | Ga0070677_10134529 | 3300005333 | Bacteria | 1133 |
| 24 | Ga0070677_10138047 | 3300005333 | Bacteria | 1121 |
| 25 | Ga0070677_10162955 | 3300005333 | Bacteria | 1048 |
| 26 | Ga0070677_10592129 | 3300005333 | Bacteria | 613 |
| 27 | Ga0068869_100004464 | 3300005334 | Bacteria | 8699 |
| 28 | Ga0068869_100014013 | 3300005334 | Bacteria | 5348 |
| 29 | Ga0068869_100022675 | 3300005334 | Bacteria | 4329 |
| 30 | Ga0068869_100287042 | 3300005334 | Bacteria | 1325 |
| 31 | Ga0068869_100345635 | 3300005334 | Bacteria | 1211 |
| 32 | Ga0068869_100499826 | 3300005334 | Bacteria | 1015 |
| 33 | Ga0068869_100835847 | 3300005334 | Bacteria | 793 |
| 34 | Ga0070666_10002690 | 3300005335 | Bacteria | 10723 |
| 35 | Ga0070666_11128251 | 3300005335 | Bacteria | 583 |
| 36 | Ga0070682_100338523 | 3300005337 | Bacteria | 1118 |
| 37 | Ga0068868_100028854 | 3300005338 | Bacteria | 4246 |
| 38 | Ga0068868_100080132 | 3300005338 | Bacteria | 2616 |
| 39 | Ga0068868_100148605 | 3300005338 | Bacteria | 1928 |
| 40 | Ga0068868_100221540 | 3300005338 | Bacteria | 1584 |
| 41 | Ga0068868_100277865 | 3300005338 | Bacteria | 1417 |
| 42 | Ga0068868_100299338 | 3300005338 | Bacteria | 1366 |
| 43 | Ga0068868_100502025 | 3300005338 | Bacteria | 1063 |
| 44 | Ga0070660_100274962 | 3300005339 | Bacteria | 1377 |
| 45 | Ga0070689_100039446 | 3300005340 | Bacteria | 3616 |
| 46 | Ga0070689_100053248 | 3300005340 | Bacteria | 3131 |
| 47 | Ga0070691_10026265 | 3300005341 | Bacteria | 2714 |
| 48 | Ga0070691_10180114 | 3300005341 | Bacteria | 1100 |
| 49 | Ga0070687_100204325 | 3300005343 | Bacteria | 1199 |
| 50 | Ga0070687_100663840 | 3300005343 | Bacteria | 724 |
| 51 | Ga0070661_100018929 | 3300005344 | Bacteria | 4903 |
| 52 | Ga0070661_100093927 | 3300005344 | Bacteria | 2222 |
| 53 | Ga0070661_101431450 | 3300005344 | Bacteria | 582 |
| 54 | Ga0070692_10503040 | 3300005345 | Bacteria | 786 |
| 55 | Ga0070668_100004358 | 3300005347 | Bacteria | 10499 |
| 56 | Ga0070668_100004660 | 3300005347 | Bacteria | 10158 |
| 57 | Ga0070668_100166973 | 3300005347 | Bacteria | 1789 |
| 58 | Ga0070668_100248223 | 3300005347 | Bacteria | 1476 |
| 59 | Ga0070669_100001355 | 3300005353 | Bacteria | 17636 |
| 60 | Ga0070669_100081074 | 3300005353 | Bacteria | 2416 |
| 61 | Ga0070669_100416313 | 3300005353 | Bacteria | 1102 |
| 62 | Ga0070669_100700816 | 3300005353 | Bacteria | 855 |
| 63 | Ga0070669_101158564 | 3300005353 | Bacteria | 667 |
| 64 | Ga0070669_101524307 | 3300005353 | Bacteria | 581 |
| 65 | Ga0070675_100004937 | 3300005354 | Bacteria | 10172 |
| 66 | Ga0070675_100006916 | 3300005354 | Bacteria | 8709 |
| 67 | Ga0070675_100010885 | 3300005354 | Bacteria | 7115 |
| 68 | Ga0070675_100605760 | 3300005354 | Bacteria | 994 |
| 69 | Ga0070675_101243166 | 3300005354 | Bacteria | 686 |
| 70 | Ga0070671_100006007 | 3300005355 | Bacteria | 9676 |
| 71 | Ga0070671_100043601 | 3300005355 | Bacteria | 3728 |
| 72 | Ga0070671_100057656 | 3300005355 | Bacteria | 3232 |
| 73 | Ga0070671_100152775 | 3300005355 | Bacteria | 1950 |
| 74 | Ga0070671_100178282 | 3300005355 | Bacteria | 1798 |
| 75 | Ga0070671_101411866 | 3300005355 | Bacteria | 615 |
| 76 | Ga0070671_101597486 | 3300005355 | Bacteria | 578 |
| 77 | Ga0070674_100024685 | 3300005356 | Bacteria | 3905 |
| 78 | Ga0070674_100027999 | 3300005356 | Bacteria | 3698 |
| 79 | Ga0070674_100312655 | 3300005356 | Bacteria | 1256 |
| 80 | Ga0070674_100558454 | 3300005356 | Bacteria | 962 |
| 81 | Ga0070673_100002494 | 3300005364 | Bacteria | 11228 |
| 82 | Ga0070673_100007378 | 3300005364 | Bacteria | 7245 |
| 83 | Ga0070673_100010065 | 3300005364 | Bacteria | 6384 |
| 84 | Ga0070673_100213008 | 3300005364 | Bacteria | 1669 |
| 85 | Ga0070673_100769326 | 3300005364 | Bacteria | 887 |
| 86 | Ga0070673_100886824 | 3300005364 | Bacteria | 827 |
| 87 | Ga0070688_100003186 | 3300005365 | Bacteria | 8407 |
| 88 | Ga0070688_100031098 | 3300005365 | Bacteria | 3209 |
| 89 | Ga0070688_101000563 | 3300005365 | Bacteria | 664 |
| 90 | Ga0070659_100226456 | 3300005366 | Bacteria | 1544 |
| 91 | Ga0070659_101158084 | 3300005366 | Bacteria | 683 |
| 92 | Ga0070667_100003589 | 3300005367 | Bacteria | 13206 |
| 93 | Ga0070667_100011330 | 3300005367 | Bacteria | 7375 |
| 94 | Ga0070667_100093357 | 3300005367 | Bacteria | 2591 |
| 95 | Ga0070667_100191955 | 3300005367 | Bacteria | 1810 |
| 96 | Ga0070667_100226560 | 3300005367 | Bacteria | 1665 |
| 97 | Ga0070667_100911236 | 3300005367 | Bacteria | 818 |
| 98 | Ga0070667_101451928 | 3300005367 | Bacteria | 644 |
| 99 | Ga0070667_101507323 | 3300005367 | Bacteria | 631 |
| 100 | Ga0070667_101592799 | 3300005367 | Bacteria | 614 |
| 101 | Ga0070703_10327459 | 3300005406 | Bacteria | 647 |
| 102 | Ga0070709_10399805 | 3300005434 | Bacteria | 1025 |
| 103 | Ga0070709_10461027 | 3300005434 | Bacteria | 959 |
| 104 | Ga0070713_100018564 | 3300005436 | Bacteria | 5286 |
| 105 | Ga0070713_100034755 | 3300005436 | Bacteria | 4053 |
| 106 | Ga0070710_10071601 | 3300005437 | Bacteria | 2000 |
| 107 | Ga0070701_10285146 | 3300005438 | Bacteria | 1010 |
| 108 | Ga0070701_10948080 | 3300005438 | Bacteria | 597 |
| 109 | Ga0070711_100127872 | 3300005439 | Bacteria | 1888 |
| 110 | Ga0070711_100152100 | 3300005439 | Bacteria | 1746 |
| 111 | Ga0070711_100158359 | 3300005439 | Bacteria | 1714 |
| 112 | Ga0070711_101871591 | 3300005439 | Bacteria | 527 |
| 113 | Ga0070705_101843414 | 3300005440 | Bacteria | 514 |
| 114 | Ga0070700_100285337 | 3300005441 | Bacteria | 1199 |
| 115 | Ga0070700_101818524 | 3300005441 | Bacteria | 525 |
| 116 | Ga0070694_100046133 | 3300005444 | Bacteria | 2924 |
| 117 | Ga0070694_100104044 | 3300005444 | Bacteria | 2012 |
| 118 | Ga0070694_100343881 | 3300005444 | Bacteria | 1154 |
| 119 | Ga0070708_100061431 | 3300005445 | Bacteria | 3356 |
| 120 | Ga0070708_100607106 | 3300005445 | Bacteria | 1031 |
| 121 | Ga0070663_100062189 | 3300005455 | Bacteria | 2690 |
| 122 | Ga0070663_100525309 | 3300005455 | Bacteria | 986 |
| 123 | Ga0070663_100607662 | 3300005455 | Bacteria | 920 |
| 124 | Ga0070678_100000200 | 3300005456 | Bacteria | 26391 |
| 125 | Ga0070678_100003150 | 3300005456 | Bacteria | 9133 |
| 126 | Ga0070678_100004438 | 3300005456 | Bacteria | 7962 |
| 127 | Ga0070678_101491961 | 3300005456 | Bacteria | 633 |
| 128 | Ga0070662_100004299 | 3300005457 | Bacteria | 8994 |
| 129 | Ga0070662_100093657 | 3300005457 | Bacteria | 2260 |
| 130 | Ga0070662_101234033 | 3300005457 | Bacteria | 643 |
| 131 | Ga0068867_100001816 | 3300005459 | Bacteria | 14866 |
| 132 | Ga0068867_100143599 | 3300005459 | Bacteria | 1868 |
| 133 | Ga0068867_100177915 | 3300005459 | Bacteria | 1689 |
| 134 | Ga0068867_100181723 | 3300005459 | Bacteria | 1673 |
| 135 | Ga0068867_100239919 | 3300005459 | Bacteria | 1469 |
| 136 | Ga0068867_100255407 | 3300005459 | Bacteria | 1427 |
| 137 | Ga0068867_101460794 | 3300005459 | Bacteria | 636 |
| 138 | Ga0068867_101715684 | 3300005459 | Bacteria | 589 |
| 139 | Ga0070685_10002346 | 3300005466 | Bacteria | 9760 |
| 140 | Ga0070685_10048537 | 3300005466 | Bacteria | 2445 |
| 141 | Ga0070685_11126423 | 3300005466 | Bacteria | 594 |
| 142 | Ga0070706_100002177 | 3300005467 | Bacteria | 19930 |
| 143 | Ga0070706_100041664 | 3300005467 | Bacteria | 4239 |
| 144 | Ga0070706_100433500 | 3300005467 | Bacteria | 1223 |
| 145 | Ga0070706_100644013 | 3300005467 | Bacteria | 984 |
| 146 | Ga0070707_100343726 | 3300005468 | Bacteria | 1449 |
| 147 | Ga0070707_100937715 | 3300005468 | Bacteria | 830 |
| 148 | Ga0070698_100242679 | 3300005471 | Bacteria | 1735 |
| 149 | Ga0070698_101261175 | 3300005471 | Bacteria | 689 |
| 150 | Ga0070698_101474148 | 3300005471 | Bacteria | 632 |
| 151 | Ga0070699_100016620 | 3300005518 | Bacteria | 6316 |
| 152 | Ga0070679_100721745 | 3300005530 | Bacteria | 939 |
| 153 | Ga0070679_101026724 | 3300005530 | Bacteria | 769 |
| 154 | Ga0070684_100067833 | 3300005535 | Bacteria | 3134 |
| 155 | Ga0070684_100119444 | 3300005535 | Bacteria | 2371 |
| 156 | Ga0070697_100003955 | 3300005536 | Bacteria | 11386 |
| 157 | Ga0070697_100170785 | 3300005536 | Bacteria | 1840 |
| 158 | Ga0068853_100424614 | 3300005539 | Bacteria | 1247 |
| 159 | Ga0068853_100830807 | 3300005539 | Bacteria | 885 |
| 160 | Ga0068853_101996566 | 3300005539 | Bacteria | 562 |
| 161 | Ga0070672_100002480 | 3300005543 | Bacteria | 11730 |
| 162 | Ga0070672_100003516 | 3300005543 | Bacteria | 10157 |
| 163 | Ga0070672_100006345 | 3300005543 | Bacteria | 7939 |
| 164 | Ga0070672_100042381 | 3300005543 | Bacteria | 3504 |
| 165 | Ga0070672_100126052 | 3300005543 | Bacteria | 2100 |
| 166 | Ga0070672_100219926 | 3300005543 | Bacteria | 1593 |
| 167 | Ga0070672_100605558 | 3300005543 | Bacteria | 954 |
| 168 | Ga0070672_100906554 | 3300005543 | Bacteria | 779 |
| 169 | Ga0070686_100010668 | 3300005544 | Bacteria | 5191 |
| 170 | Ga0070686_100617603 | 3300005544 | Bacteria | 856 |
| 171 | Ga0070695_100066156 | 3300005545 | Bacteria | 2355 |
| 172 | Ga0070695_100343605 | 3300005545 | Bacteria | 1116 |
| 173 | Ga0070696_100029617 | 3300005546 | Bacteria | 3743 |
| 174 | Ga0070696_100092412 | 3300005546 | Bacteria | 2156 |
| 175 | Ga0070696_100391251 | 3300005546 | Bacteria | 1085 |
| 176 | Ga0070693_100003470 | 3300005547 | Bacteria | 7360 |
| 177 | Ga0070693_100051136 | 3300005547 | Bacteria | 2365 |
| 178 | Ga0070665_100001447 | 3300005548 | Bacteria | 27820 |
| 179 | Ga0070665_100010890 | 3300005548 | Bacteria | 9200 |
| 180 | Ga0070665_100156748 | 3300005548 | Bacteria | 2279 |
| 181 | Ga0070665_100221361 | 3300005548 | Bacteria | 1893 |
| 182 | Ga0070704_100919340 | 3300005549 | Bacteria | 788 |
| 183 | Ga0070704_102131119 | 3300005549 | Bacteria | 521 |
| 184 | Ga0068855_100242196 | 3300005563 | Bacteria | 2015 |
| 185 | Ga0068855_100481762 | 3300005563 | Bacteria | 1350 |
| 186 | Ga0070664_100011186 | 3300005564 | Bacteria | 7279 |
| 187 | Ga0070664_100123786 | 3300005564 | Bacteria | 2266 |
| 188 | Ga0070664_100141413 | 3300005564 | Bacteria | 2119 |
| 189 | Ga0070664_100327808 | 3300005564 | Bacteria | 1388 |
| 190 | Ga0070664_101385159 | 3300005564 | Bacteria | 665 |
| 191 | Ga0068857_100060502 | 3300005577 | Bacteria | 3364 |
| 192 | Ga0068857_100536073 | 3300005577 | Bacteria | 1101 |
| 193 | Ga0068857_100809218 | 3300005577 | Bacteria | 895 |
| 194 | Ga0068857_101376830 | 3300005577 | Bacteria | 686 |
| 195 | Ga0068854_100021313 | 3300005578 | Bacteria | 4396 |
| 196 | Ga0068854_100067017 | 3300005578 | Bacteria | 2614 |
| 197 | Ga0068854_100247147 | 3300005578 | Bacteria | 1423 |
| 198 | Ga0068854_100293136 | 3300005578 | Bacteria | 1313 |
| 199 | Ga0068856_100109894 | 3300005614 | Bacteria | 2754 |
| 200 | Ga0068856_100381326 | 3300005614 | Bacteria | 1429 |
| 201 | Ga0068856_100553063 | 3300005614 | Bacteria | 1172 |
| 202 | Ga0068856_100657540 | 3300005614 | Bacteria | 1068 |
| 203 | Ga0068856_101299534 | 3300005614 | Bacteria | 743 |
| 204 | Ga0070702_100089340 | 3300005615 | Bacteria | 1865 |
| 205 | Ga0070702_100141044 | 3300005615 | Bacteria | 1535 |
| 206 | Ga0068852_100002870 | 3300005616 | Bacteria | 11950 |
| 207 | Ga0068852_100236526 | 3300005616 | Bacteria | 1744 |
| 208 | Ga0068852_101583450 | 3300005616 | Bacteria | 677 |
| 209 | Ga0068859_100004763 | 3300005617 | Bacteria | 13795 |
| 210 | Ga0068859_100217140 | 3300005617 | Bacteria | 2000 |
| 211 | Ga0068859_100282454 | 3300005617 | Bacteria | 1753 |
| 212 | Ga0068859_100298536 | 3300005617 | Bacteria | 1704 |
| 213 | Ga0068859_100354840 | 3300005617 | Unclassified | 1561 |
| 214 | Ga0068859_100372233 | 3300005617 | Bacteria | 1524 |
| 215 | Ga0068859_101647599 | 3300005617 | Bacteria | 709 |
| 216 | Ga0068864_100003322 | 3300005618 | Bacteria | 13294 |
| 217 | Ga0068864_100004826 | 3300005618 | Bacteria | 11049 |
| 218 | Ga0068864_100013280 | 3300005618 | Bacteria | 6822 |
| 219 | Ga0068864_100388533 | 3300005618 | Bacteria | 1324 |
| 220 | Ga0068864_100453194 | 3300005618 | Bacteria | 1227 |
| 221 | Ga0068866_10004240 | 3300005718 | Bacteria | 5886 |
| 222 | Ga0068866_10009601 | 3300005718 | Bacteria | 4113 |
| 223 | Ga0068866_10511994 | 3300005718 | Bacteria | 796 |
| 224 | Ga0068866_10559427 | 3300005718 | Bacteria | 766 |
| 225 | Ga0068861_100005340 | 3300005719 | Bacteria | 8680 |
| 226 | Ga0068861_100185450 | 3300005719 | Bacteria | 1735 |
| 227 | Ga0068861_100238683 | 3300005719 | Bacteria | 1545 |
| 228 | Ga0068861_100728712 | 3300005719 | Bacteria | 924 |
| 229 | Ga0068861_101312261 | 3300005719 | Bacteria | 704 |
| 230 | Ga0068861_101501743 | 3300005719 | Bacteria | 661 |
| 231 | Ga0068851_10004503 | 3300005834 | Bacteria | 6287 |
| 232 | Ga0068851_10009674 | 3300005834 | Bacteria | 4488 |
| 233 | Ga0068851_10025530 | 3300005834 | Bacteria | 2899 |
| 234 | Ga0068851_10086276 | 3300005834 | Bacteria | 1646 |
| 235 | Ga0068851_10295793 | 3300005834 | Bacteria | 929 |
| 236 | Ga0068851_10726881 | 3300005834 | Bacteria | 613 |
| 237 | Ga0068870_10190692 | 3300005840 | Bacteria | 1236 |
| 238 | Ga0068863_100003437 | 3300005841 | Bacteria | 15608 |
| 239 | Ga0068863_100057019 | 3300005841 | Bacteria | 3697 |
| 240 | Ga0068863_100131898 | 3300005841 | Bacteria | 2386 |
| 241 | Ga0068863_100256330 | 3300005841 | Bacteria | 1690 |
| 242 | Ga0068863_101085467 | 3300005841 | Bacteria | 805 |
| 243 | Ga0068863_101224542 | 3300005841 | Bacteria | 757 |
| 244 | Ga0068863_101576436 | 3300005841 | Bacteria | 666 |
| 245 | Ga0068858_100004492 | 3300005842 | Bacteria | 13669 |
| 246 | Ga0068858_100005455 | 3300005842 | Bacteria | 12452 |
| 247 | Ga0068858_100098322 | 3300005842 | Bacteria | 2729 |
| 248 | Ga0068858_100157766 | 3300005842 | Bacteria | 2135 |
| 249 | Ga0068858_100292875 | 3300005842 | Bacteria | 1552 |
| 250 | Ga0068858_101289726 | 3300005842 | Bacteria | 719 |
| 251 | Ga0068860_100008213 | 3300005843 | Bacteria | 10390 |
| 252 | Ga0068860_100043728 | 3300005843 | Bacteria | 4271 |
| 253 | Ga0068860_100050725 | 3300005843 | Bacteria | 3949 |
| 254 | Ga0068860_100147875 | 3300005843 | Bacteria | 2261 |
| 255 | Ga0068860_100594344 | 3300005843 | Bacteria | 1112 |
| 256 | Ga0068860_100640253 | 3300005843 | Bacteria | 1071 |
| 257 | Ga0068860_101247665 | 3300005843 | Bacteria | 764 |
| 258 | Ga0068862_100218231 | 3300005844 | Bacteria | 1726 |
| 259 | Ga0068862_100225149 | 3300005844 | Bacteria | 1699 |
| 260 | Ga0068862_100258395 | 3300005844 | Bacteria | 1589 |
| 261 | Ga0068862_100666164 | 3300005844 | Bacteria | 1005 |
| 262 | Ga0068862_102541743 | 3300005844 | Bacteria | 524 |
| 263 | Ga0070715_10204131 | 3300006163 | Bacteria | 1006 |
| 264 | Ga0070715_10578935 | 3300006163 | Bacteria | 655 |
| 265 | Ga0070716_100019244 | 3300006173 | Bacteria | 3566 |
| 266 | Ga0070716_100070153 | 3300006173 | Bacteria | 2056 |
| 267 | Ga0070712_100014681 | 3300006175 | Bacteria | 5028 |
| 268 | Ga0070712_100407616 | 3300006175 | Bacteria | 1124 |
| 269 | Ga0097621_100010446 | 3300006237 | Bacteria | 6798 |
| 270 | Ga0097621_100015171 | 3300006237 | Bacteria | 5789 |
| 271 | Ga0097621_100046162 | 3300006237 | Bacteria | 3523 |
| 272 | Ga0097621_100090046 | 3300006237 | Bacteria | 2566 |
| 273 | Ga0097621_100391017 | 3300006237 | Bacteria | 1244 |
| 274 | Ga0075370_10981170 | 3300006353 | Bacteria | 517 |
| 275 | Ga0068871_100001041 | 3300006358 | Bacteria | 18568 |
| 276 | Ga0068871_100012102 | 3300006358 | Bacteria | 6350 |
| 277 | Ga0068871_100033591 | 3300006358 | Bacteria | 4064 |
| 278 | Ga0068871_100100279 | 3300006358 | Bacteria | 2425 |
| 279 | Ga0068871_100468078 | 3300006358 | Bacteria | 1132 |
| 280 | Ga0068871_100672595 | 3300006358 | Bacteria | 947 |
| 281 | Ga0068871_101496881 | 3300006358 | Bacteria | 638 |
| 282 | Ga0075428_100906408 | 3300006844 | Bacteria | 935 |
| 283 | Ga0075428_102348646 | 3300006844 | Bacteria | 548 |
| 284 | Ga0075433_10051439 | 3300006852 | Bacteria | 3587 |
| 285 | Ga0075434_100009598 | 3300006871 | Bacteria | 9034 |
| 286 | Ga0075434_100367914 | 3300006871 | Bacteria | 1459 |
| 287 | Ga0068865_100001927 | 3300006881 | Bacteria | 12209 |
| 288 | Ga0068865_100033555 | 3300006881 | Bacteria | 3437 |
| 289 | Ga0068865_100172820 | 3300006881 | Bacteria | 1658 |
| 290 | Ga0068865_100225712 | 3300006881 | Bacteria | 1466 |
| 291 | Ga0068865_100349449 | 3300006881 | Bacteria | 1197 |
| 292 | Ga0075436_100019321 | 3300006914 | Bacteria | 4670 |
| 293 | Ga0075436_100046702 | 3300006914 | Bacteria | 2987 |
| 294 | Ga0097620_100004763 | 3300006931 | Bacteria | 13795 |
| 295 | Ga0097620_100217143 | 3300006931 | Bacteria | 2000 |
| 296 | Ga0097620_100282441 | 3300006931 | Bacteria | 1753 |
| 297 | Ga0097620_100298535 | 3300006931 | Bacteria | 1704 |
| 298 | Ga0097620_100354849 | 3300006931 | Unclassified | 1561 |
| 299 | Ga0097620_100372214 | 3300006931 | Bacteria | 1524 |
| 300 | Ga0097620_101647571 | 3300006931 | Bacteria | 709 |
| 301 | Ga0075435_100106617 | 3300007076 | Bacteria | 2327 |
| 302 | Ga0075435_100503143 | 3300007076 | Bacteria | 1048 |
| 303 | Ga0075435_100596340 | 3300007076 | Bacteria | 958 |
| 304 | Ga0105251_10244730 | 3300009011 | Bacteria | 808 |
| 305 | Ga0105240_10105340 | 3300009093 | Bacteria | 3424 |
| 306 | Ga0111539_10530712 | 3300009094 | Bacteria | 1371 |
| 307 | Ga0105245_10002094 | 3300009098 | Bacteria | 18092 |
| 308 | Ga0105245_10082037 | 3300009098 | Bacteria | 2949 |
| 309 | Ga0105245_10106808 | 3300009098 | Bacteria | 2598 |
| 310 | Ga0105245_10129798 | 3300009098 | Bacteria | 2363 |
| 311 | Ga0105245_10165119 | 3300009098 | Bacteria | 2104 |
| 312 | Ga0105245_12195210 | 3300009098 | Bacteria | 606 |
| 313 | Ga0105245_13240144 | 3300009098 | Unclassified | 504 |
| 314 | Ga0105247_10189803 | 3300009101 | Bacteria | 1375 |
| 315 | Ga0105247_11759754 | 3300009101 | Unclassified | 514 |
| 316 | Ga0105243_10117042 | 3300009148 | Bacteria | 2240 |
| 317 | Ga0105241_10028850 | 3300009174 | Bacteria | 4135 |
| 318 | Ga0105241_10734094 | 3300009174 | Bacteria | 904 |
| 319 | Ga0105241_11290246 | 3300009174 | Bacteria | 695 |
| 320 | Ga0105241_11310377 | 3300009174 | Bacteria | 690 |
| 321 | Ga0105242_10113265 | 3300009176 | Bacteria | 2316 |
| 322 | Ga0105242_10238169 | 3300009176 | Bacteria | 1635 |
| 323 | Ga0105242_11081074 | 3300009176 | Bacteria | 815 |
| 324 | Ga0105242_11094402 | 3300009176 | Bacteria | 810 |
| 325 | Ga0105248_10001701 | 3300009177 | Bacteria | 24486 |
| 326 | Ga0105248_10745552 | 3300009177 | Bacteria | 1105 |
| 327 | Ga0105248_11004560 | 3300009177 | Bacteria | 942 |
| 328 | Ga0105237_10069691 | 3300009545 | Bacteria | 3512 |
| 329 | Ga0105237_10121692 | 3300009545 | Bacteria | 2604 |
| 330 | Ga0105237_11151428 | 3300009545 | Bacteria | 782 |
| 331 | Ga0105238_10068737 | 3300009551 | Bacteria | 3543 |
| 332 | Ga0105238_10193408 | 3300009551 | Bacteria | 2010 |
| 333 | Ga0105238_10213369 | 3300009551 | Bacteria | 1907 |
| 334 | Ga0105238_12108389 | 3300009551 | Bacteria | 598 |
| 335 | Ga0105249_10172220 | 3300009553 | Bacteria | 2100 |
| 336 | Ga0105249_10434427 | 3300009553 | Bacteria | 1349 |
| 337 | Ga0105249_10977131 | 3300009553 | Bacteria | 915 |
| 338 | Ga0105239_10508872 | 3300010375 | Bacteria | 1369 |
| 339 | Ga0105239_11981226 | 3300010375 | Bacteria | 676 |
| 340 | Ga0105246_10015253 | 3300011119 | Bacteria | 4848 |
| 341 | Ga0105246_10343005 | 3300011119 | Bacteria | 1221 |
| 342 | Ga0157335_1038528 | 3300012492 | Bacteria | 530 |
| 343 | Ga0157319_1031713 | 3300012497 | Bacteria | 575 |
| 344 | Ga0157373_10132472 | 3300013100 | Bacteria | 1753 |
| 345 | Ga0157373_10831315 | 3300013100 | Bacteria | 682 |
| 346 | Ga0157371_10146774 | 3300013102 | Bacteria | 1681 |
| 347 | Ga0157370_10054056 | 3300013104 | Bacteria | 3828 |
| 348 | Ga0157370_10089239 | 3300013104 | Bacteria | 2896 |
| 349 | Ga0157369_10189005 | 3300013105 | Bacteria | 2164 |
| 350 | Ga0157369_10272367 | 3300013105 | Bacteria | 1764 |
| 351 | Ga0157369_11044279 | 3300013105 | Bacteria | 836 |
| 352 | Ga0157369_11605096 | 3300013105 | Bacteria | 661 |
| 353 | Ga0157374_10004890 | 3300013296 | Bacteria | 11242 |
| 354 | Ga0157374_10012603 | 3300013296 | Bacteria | 7361 |
| 355 | Ga0157374_10029804 | 3300013296 | Bacteria | 4949 |
| 356 | Ga0157374_12459234 | 3300013296 | Unclassified | 548 |
| 357 | Ga0157378_10019423 | 3300013297 | Bacteria | 5974 |
| 358 | Ga0157378_10065242 | 3300013297 | Bacteria | 3259 |
| 359 | Ga0157378_10484180 | 3300013297 | Bacteria | 1233 |
| 360 | Ga0157378_10515479 | 3300013297 | Bacteria | 1196 |
| 361 | Ga0163162_10002112 | 3300013306 | Bacteria | 18669 |
| 362 | Ga0163162_10002653 | 3300013306 | Bacteria | 16955 |
| 363 | Ga0163162_10118524 | 3300013306 | Bacteria | 2749 |
| 364 | Ga0163162_10981542 | 3300013306 | Bacteria | 955 |
| 365 | Ga0163162_11159014 | 3300013306 | Bacteria | 877 |
| 366 | Ga0163162_12072307 | 3300013306 | Bacteria | 652 |
| 367 | Ga0157372_10098133 | 3300013307 | Bacteria | 3342 |
| 368 | Ga0157372_10170779 | 3300013307 | Bacteria | 2516 |
| 369 | Ga0157372_13098919 | 3300013307 | Unclassified | 531 |
| 370 | Ga0157375_10006548 | 3300013308 | Bacteria | 10137 |
| 371 | Ga0157375_10053422 | 3300013308 | Bacteria | 3975 |
| 372 | Ga0157375_10116475 | 3300013308 | Bacteria | 2776 |
| 373 | Ga0157375_10334481 | 3300013308 | Bacteria | 1680 |
| 374 | Ga0157375_10457352 | 3300013308 | Bacteria | 1442 |
| 375 | Ga0157375_10854959 | 3300013308 | Bacteria | 1056 |
| 376 | Ga0157375_11900538 | 3300013308 | Bacteria | 707 |
| 377 | Ga0157375_12444959 | 3300013308 | Bacteria | 623 |
| 378 | Ga0163163_10284778 | 3300014325 | Bacteria | 1704 |
| 379 | Ga0163163_12073768 | 3300014325 | Bacteria | 628 |
| 380 | Ga0157380_10025430 | 3300014326 | Bacteria | 4489 |
| 381 | Ga0157380_10507686 | 3300014326 | Bacteria | 1173 |
| 382 | Ga0157380_10650702 | 3300014326 | Bacteria | 1051 |
| 383 | Ga0157380_11080427 | 3300014326 | Bacteria | 840 |
| 384 | Ga0157380_11166477 | 3300014326 | Bacteria | 812 |
| 385 | Ga0157380_11842347 | 3300014326 | Bacteria | 665 |
| 386 | Ga0157377_10026156 | 3300014745 | Bacteria | 3120 |
| 387 | Ga0157377_10114776 | 3300014745 | Bacteria | 1624 |
| 388 | Ga0157377_11743835 | 3300014745 | Bacteria | 504 |
| 389 | Ga0157379_10001106 | 3300014968 | Bacteria | 22048 |
| 390 | Ga0157379_10050312 | 3300014968 | Bacteria | 3719 |
| 391 | Ga0157379_10995373 | 3300014968 | Bacteria | 799 |
| 392 | Ga0157376_10001970 | 3300014969 | Bacteria | 13739 |
| 393 | Ga0157376_10131535 | 3300014969 | Bacteria | 2233 |
| 394 | Ga0157376_10165860 | 3300014969 | Bacteria | 2007 |
| 395 | Ga0157376_10218321 | 3300014969 | Bacteria | 1764 |
| 396 | Ga0157376_11790699 | 3300014969 | Bacteria | 650 |
| 397 | Ga0163161_10009441 | 3300017792 | Bacteria | 6750 |
| 398 | Ga0163161_10035466 | 3300017792 | Bacteria | 3570 |
| 399 | Ga0207697_10035786 | 3300025315 | Bacteria | 2033 |
| 400 | Ga0207697_10041299 | 3300025315 | Bacteria | 1894 |
| 401 | Ga0207697_10119606 | 3300025315 | Bacteria | 1133 |
| 402 | Ga0207656_10017342 | 3300025321 | Bacteria | 2819 |
| 403 | Ga0207656_10224135 | 3300025321 | Bacteria | 914 |
| 404 | Ga0207653_10203298 | 3300025885 | Bacteria | 747 |
| 405 | Ga0207682_10073588 | 3300025893 | Bacteria | 1451 |
| 406 | Ga0207682_10102713 | 3300025893 | Bacteria | 1251 |
| 407 | Ga0207682_10115407 | 3300025893 | Bacteria | 1186 |
| 408 | Ga0207682_10291255 | 3300025893 | Bacteria | 764 |
| 409 | Ga0207692_10014177 | 3300025898 | Bacteria | 3478 |
| 410 | Ga0207692_10170454 | 3300025898 | Bacteria | 1261 |
| 411 | Ga0207692_10851231 | 3300025898 | Bacteria | 598 |
| 412 | Ga0207642_10000974 | 3300025899 | Bacteria | 8944 |
| 413 | Ga0207642_10036785 | 3300025899 | Bacteria | 2104 |
| 414 | Ga0207642_10647038 | 3300025899 | Bacteria | 662 |
| 415 | Ga0207688_10045458 | 3300025901 | Bacteria | 2449 |
| 416 | Ga0207680_10001982 | 3300025903 | Bacteria | 9581 |
| 417 | Ga0207680_10218988 | 3300025903 | Bacteria | 1304 |
| 418 | Ga0207680_10264823 | 3300025903 | Bacteria | 1191 |
| 419 | Ga0207680_10443012 | 3300025903 | Bacteria | 921 |
| 420 | Ga0207680_10829842 | 3300025903 | Bacteria | 663 |
| 421 | Ga0207685_10006487 | 3300025905 | Bacteria | 3189 |
| 422 | Ga0207685_10061182 | 3300025905 | Bacteria | 1492 |
| 423 | Ga0207685_10632267 | 3300025905 | Bacteria | 577 |
| 424 | Ga0207699_10066559 | 3300025906 | Bacteria | 2187 |
| 425 | Ga0207645_10001058 | 3300025907 | Bacteria | 22793 |
| 426 | Ga0207645_10011861 | 3300025907 | Bacteria | 5931 |
| 427 | Ga0207645_10024055 | 3300025907 | Bacteria | 3953 |
| 428 | Ga0207645_10067652 | 3300025907 | Bacteria | 2283 |
| 429 | Ga0207645_10184954 | 3300025907 | Bacteria | 1368 |
| 430 | Ga0207643_10661220 | 3300025908 | Bacteria | 674 |
| 431 | Ga0207705_10078861 | 3300025909 | Bacteria | 2398 |
| 432 | Ga0207705_10415746 | 3300025909 | Bacteria | 1041 |
| 433 | Ga0207684_10037844 | 3300025910 | Bacteria | 4093 |
| 434 | Ga0207684_10101330 | 3300025910 | Bacteria | 2461 |
| 435 | Ga0207684_10106282 | 3300025910 | Bacteria | 2401 |
| 436 | Ga0207654_10064933 | 3300025911 | Bacteria | 2148 |
| 437 | Ga0207654_10125505 | 3300025911 | Bacteria | 1618 |
| 438 | Ga0207654_10311393 | 3300025911 | Bacteria | 1073 |
| 439 | Ga0207707_10061036 | 3300025912 | Bacteria | 3280 |
| 440 | Ga0207695_10419839 | 3300025913 | Bacteria | 1222 |
| 441 | Ga0207693_10002975 | 3300025915 | Bacteria | 14675 |
| 442 | Ga0207693_10059619 | 3300025915 | Bacteria | 2989 |
| 443 | Ga0207663_10083523 | 3300025916 | Bacteria | 2098 |
| 444 | Ga0207663_10599683 | 3300025916 | Bacteria | 865 |
| 445 | Ga0207663_11088797 | 3300025916 | Bacteria | 642 |
| 446 | Ga0207660_10082588 | 3300025917 | Bacteria | 2364 |
| 447 | Ga0207662_10055703 | 3300025918 | Bacteria | 2360 |
| 448 | Ga0207662_10080367 | 3300025918 | Bacteria | 1988 |
| 449 | Ga0207662_10092022 | 3300025918 | Bacteria | 1866 |
| 450 | Ga0207662_10229232 | 3300025918 | Bacteria | 1212 |
| 451 | Ga0207657_10004934 | 3300025919 | Bacteria | 14029 |
| 452 | Ga0207657_10014119 | 3300025919 | Bacteria | 7814 |
| 453 | Ga0207657_11090432 | 3300025919 | Bacteria | 610 |
| 454 | Ga0207649_10368293 | 3300025920 | Bacteria | 1068 |
| 455 | Ga0207652_10111575 | 3300025921 | Bacteria | 2425 |
| 456 | Ga0207646_10017711 | 3300025922 | Bacteria | 6657 |
| 457 | Ga0207646_10038017 | 3300025922 | Bacteria | 4338 |
| 458 | Ga0207646_10118233 | 3300025922 | Bacteria | 2381 |
| 459 | Ga0207646_10620375 | 3300025922 | Bacteria | 970 |
| 460 | Ga0207681_10009784 | 3300025923 | Bacteria | 5864 |
| 461 | Ga0207681_10067279 | 3300025923 | Bacteria | 2483 |
| 462 | Ga0207681_10115981 | 3300025923 | Bacteria | 1956 |
| 463 | Ga0207681_10125092 | 3300025923 | Bacteria | 1892 |
| 464 | Ga0207681_10186940 | 3300025923 | Bacteria | 1582 |
| 465 | Ga0207681_10467351 | 3300025923 | Bacteria | 1028 |
| 466 | Ga0207681_10619399 | 3300025923 | Bacteria | 895 |
| 467 | Ga0207681_11379166 | 3300025923 | Bacteria | 592 |
| 468 | Ga0207694_10082798 | 3300025924 | Bacteria | 2522 |
| 469 | Ga0207694_10360232 | 3300025924 | Bacteria | 1205 |
| 470 | Ga0207650_10021570 | 3300025925 | Bacteria | 4551 |
| 471 | Ga0207650_10028783 | 3300025925 | Bacteria | 3987 |
| 472 | Ga0207650_10034275 | 3300025925 | Bacteria | 3681 |
| 473 | Ga0207650_10067697 | 3300025925 | Bacteria | 2680 |
| 474 | Ga0207650_10075850 | 3300025925 | Bacteria | 2539 |
| 475 | Ga0207650_10185592 | 3300025925 | Bacteria | 1659 |
| 476 | Ga0207650_10224883 | 3300025925 | Bacteria | 1512 |
| 477 | Ga0207650_10230724 | 3300025925 | Bacteria | 1493 |
| 478 | Ga0207650_10255416 | 3300025925 | Bacteria | 1420 |
| 479 | Ga0207650_10885078 | 3300025925 | Bacteria | 758 |
| 480 | Ga0207659_10000739 | 3300025926 | Bacteria | 19339 |
| 481 | Ga0207659_10013667 | 3300025926 | Bacteria | 5209 |
| 482 | Ga0207659_10083054 | 3300025926 | Bacteria | 2373 |
| 483 | Ga0207659_10155121 | 3300025926 | Bacteria | 1792 |
| 484 | Ga0207659_10279706 | 3300025926 | Bacteria | 1364 |
| 485 | Ga0207659_10528908 | 3300025926 | Bacteria | 1000 |
| 486 | Ga0207659_11347804 | 3300025926 | Bacteria | 612 |
| 487 | Ga0207687_10023872 | 3300025927 | Bacteria | 4080 |
| 488 | Ga0207687_10024630 | 3300025927 | Bacteria | 4023 |
| 489 | Ga0207687_10480488 | 3300025927 | Bacteria | 1034 |
| 490 | Ga0207687_10848735 | 3300025927 | Bacteria | 780 |
| 491 | Ga0207700_10075216 | 3300025928 | Bacteria | 2616 |
| 492 | Ga0207700_10106194 | 3300025928 | Bacteria | 2250 |
| 493 | Ga0207644_10004900 | 3300025931 | Bacteria | 8726 |
| 494 | Ga0207644_10030901 | 3300025931 | Bacteria | 3728 |
| 495 | Ga0207644_10040621 | 3300025931 | Bacteria | 3288 |
| 496 | Ga0207644_10043213 | 3300025931 | Bacteria | 3197 |
| 497 | Ga0207644_10043560 | 3300025931 | Bacteria | 3186 |
| 498 | Ga0207644_11279485 | 3300025931 | Bacteria | 616 |
| 499 | Ga0207644_11354346 | 3300025931 | Bacteria | 598 |
| 500 | Ga0207690_10153753 | 3300025932 | Bacteria | 1708 |
| 501 | Ga0207690_10607480 | 3300025932 | Bacteria | 893 |
| 502 | Ga0207706_10036136 | 3300025933 | Bacteria | 4389 |
| 503 | Ga0207706_10099578 | 3300025933 | Bacteria | 2557 |
| 504 | Ga0207706_10473777 | 3300025933 | Bacteria | 1082 |
| 505 | Ga0207706_10553112 | 3300025933 | Bacteria | 991 |
| 506 | Ga0207706_10966485 | 3300025933 | Bacteria | 717 |
| 507 | Ga0207686_10000315 | 3300025934 | Bacteria | 34957 |
| 508 | Ga0207686_10355449 | 3300025934 | Bacteria | 1104 |
| 509 | Ga0207686_10831284 | 3300025934 | Bacteria | 742 |
| 510 | Ga0207709_10240072 | 3300025935 | Bacteria | 1318 |
| 511 | Ga0207709_10463935 | 3300025935 | Bacteria | 981 |
| 512 | Ga0207709_10492946 | 3300025935 | Bacteria | 955 |
| 513 | Ga0207709_10777763 | 3300025935 | Bacteria | 771 |
| 514 | Ga0207670_10007822 | 3300025936 | Bacteria | 5998 |
| 515 | Ga0207670_10129703 | 3300025936 | Bacteria | 1845 |
| 516 | Ga0207669_10040819 | 3300025937 | Bacteria | 2695 |
| 517 | Ga0207669_10056737 | 3300025937 | Bacteria | 2380 |
| 518 | Ga0207669_10080594 | 3300025937 | Bacteria | 2082 |
| 519 | Ga0207669_10096515 | 3300025937 | Bacteria | 1941 |
| 520 | Ga0207704_10001306 | 3300025938 | Bacteria | 11152 |
| 521 | Ga0207704_10031604 | 3300025938 | Bacteria | 2985 |
| 522 | Ga0207704_10289057 | 3300025938 | Bacteria | 1250 |
| 523 | Ga0207704_10395589 | 3300025938 | Bacteria | 1089 |
| 524 | Ga0207704_10622089 | 3300025938 | Bacteria | 886 |
| 525 | Ga0207665_10013218 | 3300025939 | Bacteria | 5429 |
| 526 | Ga0207665_10017508 | 3300025939 | Bacteria | 4710 |
| 527 | Ga0207691_10000041 | 3300025940 | Bacteria | 106275 |
| 528 | Ga0207691_10002908 | 3300025940 | Bacteria | 16703 |
| 529 | Ga0207691_10004381 | 3300025940 | Bacteria | 13683 |
| 530 | Ga0207691_10012171 | 3300025940 | Bacteria | 8248 |
| 531 | Ga0207691_10018599 | 3300025940 | Bacteria | 6585 |
| 532 | Ga0207691_10298931 | 3300025940 | Bacteria | 1383 |
| 533 | Ga0207691_10372734 | 3300025940 | Bacteria | 1219 |
| 534 | Ga0207691_10615661 | 3300025940 | Bacteria | 919 |
| 535 | Ga0207711_10000934 | 3300025941 | Bacteria | 28177 |
| 536 | Ga0207711_10001347 | 3300025941 | Bacteria | 23185 |
| 537 | Ga0207711_11923641 | 3300025941 | Bacteria | 534 |
| 538 | Ga0207689_10003613 | 3300025942 | Bacteria | 14131 |
| 539 | Ga0207689_10004127 | 3300025942 | Bacteria | 13200 |
| 540 | Ga0207689_10044332 | 3300025942 | Bacteria | 3677 |
| 541 | Ga0207689_10049582 | 3300025942 | Bacteria | 3463 |
| 542 | Ga0207689_10078702 | 3300025942 | Bacteria | 2709 |
| 543 | Ga0207689_10079763 | 3300025942 | Bacteria | 2690 |
| 544 | Ga0207689_10457072 | 3300025942 | Bacteria | 1067 |
| 545 | Ga0207661_10181883 | 3300025944 | Bacteria | 1837 |
| 546 | Ga0207679_10030361 | 3300025945 | Bacteria | 3773 |
| 547 | Ga0207679_10078728 | 3300025945 | Bacteria | 2511 |
| 548 | Ga0207679_10295574 | 3300025945 | Bacteria | 1394 |
| 549 | Ga0207679_10405293 | 3300025945 | Bacteria | 1200 |
| 550 | Ga0207679_11264173 | 3300025945 | Bacteria | 677 |
| 551 | Ga0207667_10150534 | 3300025949 | Bacteria | 2395 |
| 552 | Ga0207667_10530075 | 3300025949 | Bacteria | 1192 |
| 553 | Ga0207651_10002868 | 3300025960 | Bacteria | 8318 |
| 554 | Ga0207651_10008943 | 3300025960 | Bacteria | 5440 |
| 555 | Ga0207651_10016042 | 3300025960 | Bacteria | 4374 |
| 556 | Ga0207651_10096420 | 3300025960 | Bacteria | 2181 |
| 557 | Ga0207651_10240883 | 3300025960 | Bacteria | 1474 |
| 558 | Ga0207712_10117167 | 3300025961 | Bacteria | 2008 |
| 559 | Ga0207712_10163879 | 3300025961 | Bacteria | 1731 |
| 560 | Ga0207712_10313564 | 3300025961 | Bacteria | 1291 |
| 561 | Ga0207668_10022678 | 3300025972 | Bacteria | 4023 |
| 562 | Ga0207668_10049202 | 3300025972 | Bacteria | 2896 |
| 563 | Ga0207668_10067191 | 3300025972 | Bacteria | 2544 |
| 564 | Ga0207640_10097190 | 3300025981 | Bacteria | 2055 |
| 565 | Ga0207640_10149059 | 3300025981 | Bacteria | 1716 |
| 566 | Ga0207640_10226403 | 3300025981 | Bacteria | 1435 |
| 567 | Ga0207640_10513554 | 3300025981 | Bacteria | 1000 |
| 568 | Ga0207640_10861516 | 3300025981 | Bacteria | 789 |
| 569 | Ga0207658_10007536 | 3300025986 | Bacteria | 7413 |
| 570 | Ga0207658_10011830 | 3300025986 | Bacteria | 5945 |
| 571 | Ga0207658_10096819 | 3300025986 | Bacteria | 2302 |
| 572 | Ga0207658_10132053 | 3300025986 | Bacteria | 2007 |
| 573 | Ga0207658_10167107 | 3300025986 | Bacteria | 1808 |
| 574 | Ga0207658_10222288 | 3300025986 | Bacteria | 1589 |
| 575 | Ga0207658_10674105 | 3300025986 | Bacteria | 933 |
| 576 | Ga0207658_10712375 | 3300025986 | Bacteria | 907 |
| 577 | Ga0207677_10000112 | 3300026023 | Bacteria | 66499 |
| 578 | Ga0207677_10000232 | 3300026023 | Bacteria | 43610 |
| 579 | Ga0207677_10003482 | 3300026023 | Bacteria | 8344 |
| 580 | Ga0207677_10004436 | 3300026023 | Bacteria | 7536 |
| 581 | Ga0207677_10066752 | 3300026023 | Bacteria | 2517 |
| 582 | Ga0207677_10285207 | 3300026023 | Bacteria | 1357 |
| 583 | Ga0207677_10531928 | 3300026023 | Bacteria | 1021 |
| 584 | Ga0207677_10884018 | 3300026023 | Bacteria | 805 |
| 585 | Ga0207703_10004690 | 3300026035 | Bacteria | 11165 |
| 586 | Ga0207703_10010253 | 3300026035 | Bacteria | 7339 |
| 587 | Ga0207703_10072886 | 3300026035 | Bacteria | 2839 |
| 588 | Ga0207703_10490667 | 3300026035 | Bacteria | 1152 |
| 589 | Ga0207703_10492621 | 3300026035 | Bacteria | 1149 |
| 590 | Ga0207639_10047156 | 3300026041 | Bacteria | 3255 |
| 591 | Ga0207639_10236768 | 3300026041 | Bacteria | 1585 |
| 592 | Ga0207639_10884014 | 3300026041 | Bacteria | 835 |
| 593 | Ga0207639_10890362 | 3300026041 | Bacteria | 832 |
| 594 | Ga0207639_11128705 | 3300026041 | Bacteria | 735 |
| 595 | Ga0207678_10036749 | 3300026067 | Bacteria | 4264 |
| 596 | Ga0207678_10124494 | 3300026067 | Bacteria | 2199 |
| 597 | Ga0207678_10169095 | 3300026067 | Bacteria | 1866 |
| 598 | Ga0207678_10235436 | 3300026067 | Bacteria | 1568 |
| 599 | Ga0207708_10117884 | 3300026075 | Bacteria | 2067 |
| 600 | Ga0207708_11549259 | 3300026075 | Bacteria | 582 |
| 601 | Ga0207702_10071215 | 3300026078 | Bacteria | 2993 |
| 602 | Ga0207702_10181329 | 3300026078 | Bacteria | 1939 |
| 603 | Ga0207702_10391842 | 3300026078 | Bacteria | 1338 |
| 604 | Ga0207702_11230919 | 3300026078 | Bacteria | 743 |
| 605 | Ga0207702_11472166 | 3300026078 | Bacteria | 674 |
| 606 | Ga0207641_10009275 | 3300026088 | Bacteria | 8114 |
| 607 | Ga0207641_10018659 | 3300026088 | Bacteria | 5686 |
| 608 | Ga0207641_10192991 | 3300026088 | Bacteria | 1873 |
| 609 | Ga0207641_10217212 | 3300026088 | Bacteria | 1771 |
| 610 | Ga0207641_10307698 | 3300026088 | Bacteria | 1499 |
| 611 | Ga0207641_10583447 | 3300026088 | Bacteria | 1093 |
| 612 | Ga0207648_10000601 | 3300026089 | Bacteria | 40481 |
| 613 | Ga0207648_10006033 | 3300026089 | Bacteria | 12082 |
| 614 | Ga0207648_10016691 | 3300026089 | Bacteria | 6699 |
| 615 | Ga0207648_10082693 | 3300026089 | Bacteria | 2800 |
| 616 | Ga0207648_10333556 | 3300026089 | Bacteria | 1365 |
| 617 | Ga0207648_10540499 | 3300026089 | Bacteria | 1069 |
| 618 | Ga0207648_11378201 | 3300026089 | Bacteria | 663 |
| 619 | Ga0207676_10001973 | 3300026095 | Bacteria | 14942 |
| 620 | Ga0207676_10002815 | 3300026095 | Bacteria | 12373 |
| 621 | Ga0207676_10005593 | 3300026095 | Bacteria | 8893 |
| 622 | Ga0207676_10743469 | 3300026095 | Bacteria | 953 |
| 623 | Ga0207676_11535339 | 3300026095 | Unclassified | 663 |
| 624 | Ga0207674_10028821 | 3300026116 | Bacteria | 5854 |
| 625 | Ga0207674_10064451 | 3300026116 | Bacteria | 3696 |
| 626 | Ga0207674_10569533 | 3300026116 | Bacteria | 1094 |
| 627 | Ga0207674_11292503 | 3300026116 | Bacteria | 699 |
| 628 | Ga0207675_100023855 | 3300026118 | Bacteria | 5689 |
| 629 | Ga0207675_100065421 | 3300026118 | Bacteria | 3398 |
| 630 | Ga0207675_100124674 | 3300026118 | Bacteria | 2439 |
| 631 | Ga0207675_100440651 | 3300026118 | Bacteria | 1289 |
| 632 | Ga0207675_100931854 | 3300026118 | Bacteria | 885 |
| 633 | Ga0207675_100949358 | 3300026118 | Bacteria | 877 |
| 634 | Ga0207675_101720273 | 3300026118 | Bacteria | 647 |
| 635 | Ga0207683_10000011 | 3300026121 | Bacteria | 140261 |
| 636 | Ga0207683_10001380 | 3300026121 | Bacteria | 21898 |
| 637 | Ga0207683_10029643 | 3300026121 | Bacteria | 4738 |
| 638 | Ga0207683_10350736 | 3300026121 | Bacteria | 1354 |
| 639 | Ga0207683_10932688 | 3300026121 | Bacteria | 806 |
| 640 | Ga0207683_11149815 | 3300026121 | Bacteria | 720 |
| 641 | Ga0207698_10146733 | 3300026142 | Bacteria | 2041 |
| 642 | Ga0207698_10596915 | 3300026142 | Bacteria | 1088 |
| 643 | Ga0207698_12177500 | 3300026142 | Unclassified | 567 |
| 644 | Ga0268266_10022303 | 3300028379 | Bacteria | 5396 |
| 645 | Ga0268266_10041420 | 3300028379 | Bacteria | 3929 |
| 646 | Ga0268266_10129710 | 3300028379 | Bacteria | 2254 |
| 647 | Ga0268266_10356093 | 3300028379 | Bacteria | 1376 |
| 648 | Ga0268265_10037462 | 3300028380 | Bacteria | 3560 |
| 649 | Ga0268265_10313581 | 3300028380 | Bacteria | 1417 |
| 650 | Ga0268265_10857027 | 3300028380 | Bacteria | 889 |
| 651 | Ga0268265_11239606 | 3300028380 | Bacteria | 744 |
| 652 | Ga0268264_10001396 | 3300028381 | Bacteria | 22573 |
| 653 | Ga0268264_10009610 | 3300028381 | Bacteria | 8012 |
| 654 | Ga0268264_10048228 | 3300028381 | Bacteria | 3542 |
| 655 | Ga0268264_10183238 | 3300028381 | Bacteria | 1903 |
| 656 | Ga0268264_10236073 | 3300028381 | Bacteria | 1691 |
| 657 | Ga0268264_10722200 | 3300028381 | Bacteria | 991 |
| 658 | Ga0268264_10736117 | 3300028381 | Bacteria | 981 |
| 659 | Ga0307406_11230033 | 3300031901 | Bacteria | 651 |
| 660 | Ga0307407_10062716 | 3300031903 | Bacteria | 2178 |
| 661 | Ga0373926_0030153 | 3300035083 | Bacteria | 1909 |
| 662 | Ga0373926_0036616 | 3300035083 | Bacteria | 1744 |
| 663 | Ga0373928_0024020 | 3300035084 | Bacteria | 1304 |
| 664 | Ga0373928_0133372 | 3300035084 | Bacteria | 675 |
| 665 | Ga0373928_0260454 | 3300035084 | Bacteria | 519 |
| 666 | Ga0373934_0015891 | 3300035086 | Bacteria | 2859 |
| 667 | Ga0373951_0140500 | 3300035091 | Bacteria | 670 |
| 668 | Ga0373923_0011822 | 3300035111 | Bacteria | 3213 |
| 669 | Ga0373932_0012687 | 3300035112 | Bacteria | 2080 |
| 670 | Ga0373939_0384012 | 3300035114 | Bacteria | 579 |
| 671 | Ga0373945_0007255 | 3300035116 | Bacteria | 3589 |
| 672 | Ga0373945_0091816 | 3300035116 | Bacteria | 1176 |
| 673 | Ga0373954_0001619 | 3300035118 | Bacteria | 9205 |
| 674 | Ga0373956_0009565 | 3300035119 | Bacteria | 3948 |
| 675 | Ga0373957_0098387 | 3300035120 | Bacteria | 1169 |
| 676 | Ga0373943_0007593 | 3300035170 | Bacteria | 4869 |
| 677 | Ga0373943_0154262 | 3300035170 | Bacteria | 1246 |
| 678 | Ga0373946_0052500 | 3300035171 | Bacteria | 1710 |
| 679 | Ga0373946_0084357 | 3300035171 | Bacteria | 1397 |
| 680 | Ga0373946_0300027 | 3300035171 | Bacteria | 794 |
| 681 | Ga0373955_0049502 | 3300035172 | Bacteria | 2281 |
| 682 | Ga0373955_0362219 | 3300035172 | Bacteria | 879 |
| 683 | Ga0373962_0182455 | 3300035242 | Bacteria | 702 |
| 684 | Ga0373924_0008951 | 3300035410 | Bacteria | 3657 |
| 685 | Ga0373924_0209304 | 3300035410 | Bacteria | 861 |
| 686 | Ga0373924_0249169 | 3300035410 | Bacteria | 786 |
| 687 | Ga0373931_0030884 | 3300035691 | Bacteria | 2760 |
| 688 | Ga0373931_0151210 | 3300035691 | Bacteria | 1353 |
| 689 | Ga0373935_0026452 | 3300035692 | Bacteria | 3581 |
| 690 | Ga0373935_0094455 | 3300035692 | Bacteria | 1962 |
| 691 | Ga0373935_0257832 | 3300035692 | Bacteria | 1222 |
| 692 | Ga0373935_0479087 | 3300035692 | Bacteria | 901 |
| 693 | Ga0373935_0529367 | 3300035692 | Bacteria | 858 |
| 694 | Ga0373935_0867380 | 3300035692 | Bacteria | 668 |
| 695 | Ga0373927_0006222 | 3300035695 | Bacteria | 8149 |
| 696 | Ga0373927_0031549 | 3300035695 | Bacteria | 3453 |
| 697 | Ga0373927_0064743 | 3300035695 | Bacteria | 2365 |
| 698 | Ga0373927_0080199 | 3300035695 | Bacteria | 2115 |
| 699 | Ga0373927_0133697 | 3300035695 | Bacteria | 1621 |
| 700 | Ga0373927_0309310 | 3300035695 | Bacteria | 1040 |
| 701 | Ga0373933_0045591 | 3300035724 | Bacteria | 2600 |
| 702 | Ga0373947_0003277 | 3300035725 | Bacteria | 9599 |
| 703 | Ga0373947_0016537 | 3300035725 | Bacteria | 4239 |
| 704 | Ga0373947_0349811 | 3300035725 | Bacteria | 991 |
| 705 | Ga0373947_0431673 | 3300035725 | Bacteria | 891 |
| 706 | Ga0373947_0506047 | 3300035725 | Bacteria | 821 |
| 707 | Ga0373947_0549110 | 3300035725 | Bacteria | 786 |
| 708 | Ga0373937_0006916 | 3300036401 | Bacteria | 9792 |
| 709 | Ga0373937_0148509 | 3300036401 | Bacteria | 2195 |
| 710 | Ga0373937_0234752 | 3300036401 | Bacteria | 1727 |
| 711 | Ga0373937_0298820 | 3300036401 | Bacteria | 1521 |
| 712 | Ga0373937_0335210 | 3300036401 | Bacteria | 1432 |
| 713 | Ga0373937_0828763 | 3300036401 | Bacteria | 873 |
| 714 | Ga0373937_0969690 | 3300036401 | Bacteria | 799 |
| 715 | Ga0373925_0021569 | 3300037068 | Bacteria | 4694 |
| 716 | Ga0373925_0049097 | 3300037068 | Bacteria | 3145 |
| 717 | Ga0373925_0057184 | 3300037068 | Bacteria | 2923 |
| 718 | Ga0373925_0244101 | 3300037068 | Bacteria | 1439 |
| 719 | Ga0373925_0249700 | 3300037068 | Bacteria | 1422 |
| 720 | Ga0373925_0314705 | 3300037068 | Bacteria | 1266 |
| 721 | Ga0373925_0407639 | 3300037068 | Bacteria | 1109 |
| 722 | Ga0451804_0049404 | 3300041463 | Bacteria | 531 |
| 723 | Ga0451833_0352810 | 3300041491 | Bacteria | 570 |
| 724 | Ga0451835_1159940 | 3300041492 | Bacteria | 585 |
| 725 | Ga0451853_3538724 | 3300041512 | Bacteria | 1441 |
| 726 | Ga0451577_0022341 | 3300042876 | Bacteria | 5775 |
| 727 | Ga0451577_1088562 | 3300042876 | Bacteria | 715 |
| 728 | Ga0453684_0398230 | 3300044712 | Bacteria | 1542 |
| 729 | Ga0453684_1962515 | 3300044712 | Bacteria | 590 |
| 730 | Ga0451576_0654171 | 3300045051 | Bacteria | 1104 |
| 731 | Ga0495592_0139344 | 3300046454 | Bacteria | 1689 |
| 732 | Ga0495592_0813422 | 3300046454 | Bacteria | 554 |
| 733 | Ga0495629_0012122 | 3300046459 | Bacteria | 6247 |
| 734 | Ga0495651_0060828 | 3300046462 | Bacteria | 2892 |
| 735 | Ga0495653_0063020 | 3300046463 | Bacteria | 2800 |
| 736 | Ga0495653_0314156 | 3300046463 | Bacteria | 1018 |
| 737 | Ga0495580_0008291 | 3300046472 | Bacteria | 8271 |
| 738 | Ga0495580_0063574 | 3300046472 | Bacteria | 2588 |
| 739 | Ga0495580_0099455 | 3300046472 | Bacteria | 2023 |
| 740 | Ga0495639_0018538 | 3300046475 | Bacteria | 3031 |
| 741 | Ga0495639_0225656 | 3300046475 | Bacteria | 922 |
| 742 | Ga0495664_0001368 | 3300046477 | Bacteria | 12878 |
| 743 | Ga0495608_0084344 | 3300046511 | Bacteria | 2061 |
| 744 | Ga0495628_0048104 | 3300046516 | Bacteria | 3381 |
| 745 | Ga0495628_0340472 | 3300046516 | Bacteria | 1104 |
| 746 | Ga0495630_0147262 | 3300046517 | Bacteria | 1791 |
| 747 | Ga0495630_0530143 | 3300046517 | Bacteria | 903 |
| 748 | Ga0495630_0856958 | 3300046517 | Bacteria | 693 |
| 749 | Ga0495663_0391655 | 3300046525 | Bacteria | 510 |
| 750 | Ga0495642_0232570 | 3300046528 | Bacteria | 805 |
| 751 | Ga0495665_0128445 | 3300046531 | Bacteria | 1327 |
| 752 | Ga0495587_0085390 | 3300046536 | Bacteria | 1827 |
| 753 | Ga0495621_0080875 | 3300046539 | Bacteria | 1211 |
| 754 | Ga0495645_0018538 | 3300046543 | Bacteria | 5001 |
| 755 | Ga0495645_0078781 | 3300046543 | Bacteria | 2368 |
| 756 | Ga0495667_0099190 | 3300046559 | Unclassified | 1886 |
| 757 | Ga0495634_0328463 | 3300046642 | Bacteria | 919 |
| 758 | Ga0495635_0004423 | 3300046663 | Bacteria | 9734 |
| 759 | Ga0495635_0034435 | 3300046663 | Bacteria | 3512 |
| 760 | Ga0495635_0087081 | 3300046663 | Bacteria | 2137 |
| 761 | Ga0495657_0069280 | 3300046675 | Bacteria | 2309 |
| 762 | Ga0495599_0060718 | 3300046678 | Bacteria | 2364 |
| 763 | Ga0495623_0065629 | 3300046679 | Bacteria | 2269 |
| 764 | Ga0495646_0199259 | 3300046680 | Bacteria | 1091 |
| 765 | Ga0495647_0001693 | 3300046681 | Bacteria | 6829 |
| 766 | Ga0495647_0008363 | 3300046681 | Bacteria | 3477 |
| 767 | Ga0495647_0027972 | 3300046681 | Bacteria | 2076 |
| 768 | Ga0495658_0169422 | 3300046683 | Bacteria | 1351 |
| 769 | Ga0495613_0005266 | 3300046689 | Bacteria | 9717 |
| 770 | Ga0495613_0043094 | 3300046689 | Bacteria | 3339 |
| 771 | Ga0495624_0117773 | 3300046690 | Bacteria | 1632 |
| 772 | Ga0495600_0007268 | 3300046809 | Bacteria | 6765 |
| 773 | Ga0495581_0431839 | 3300047315 | Bacteria | 767 |
| 774 | Ga0495604_0108186 | 3300047317 | Bacteria | 2031 |
| 775 | Ga0495604_0401207 | 3300047317 | Bacteria | 903 |
| 776 | Ga0495636_0212059 | 3300047318 | Bacteria | 887 |
| 777 | Ga0495636_0388524 | 3300047318 | Bacteria | 663 |
| 778 | Ga0495674_0283799 | 3300047319 | Bacteria | 1356 |
| 779 | Ga0495674_0523878 | 3300047319 | Bacteria | 946 |
| 780 | Ga0495676_0482969 | 3300047321 | Bacteria | 815 |
| 781 | Ga0495680_0037844 | 3300047322 | Bacteria | 3862 |
| 782 | Ga0495680_0172619 | 3300047322 | Bacteria | 1565 |
| 783 | Ga0495675_0097950 | 3300047444 | Bacteria | 1837 |
| 784 | Ga0495684_0003986 | 3300047471 | Bacteria | 11515 |
| 785 | Ga0495684_0127643 | 3300047471 | Bacteria | 1912 |
| 786 | Ga0496101_0114222 | 3300048904 | Bacteria | 2036 |
| 787 | Ga0496101_0198031 | 3300048904 | Bacteria | 1552 |
| 788 | Ga0496101_1632892 | 3300048904 | Bacteria | 500 |
| 789 | Ga0496102_0117571 | 3300048905 | Bacteria | 2481 |
| 790 | Ga0496102_1475025 | 3300048905 | Bacteria | 599 |
| 791 | Ga0496103_0372255 | 3300048906 | Bacteria | 918 |
| 792 | Ga0496104_0005138 | 3300048907 | Bacteria | 11430 |
| 793 | Ga0496104_0343427 | 3300048907 | Bacteria | 1406 |
| 794 | Ga0496105_0102754 | 3300048908 | Bacteria | 2360 |
| 795 | Ga0496105_0303123 | 3300048908 | Bacteria | 1284 |
| 796 | Ga0496106_0082298 | 3300048909 | Bacteria | 2474 |
| 797 | Ga0496106_0538310 | 3300048909 | Bacteria | 937 |
| 798 | Ga0496107_0100631 | 3300048910 | Bacteria | 2119 |
| 799 | Ga0496108_0592699 | 3300048911 | Bacteria | 966 |
| 800 | Ga0496109_0015328 | 3300048912 | Bacteria | 6677 |
| 801 | Ga0496109_0209102 | 3300048912 | Bacteria | 1835 |
| 802 | Ga0496109_1325199 | 3300048912 | Bacteria | 656 |
| 803 | Ga0496110_0203925 | 3300048913 | Bacteria | 1797 |
| 804 | Ga0496110_0335575 | 3300048913 | Bacteria | 1377 |
| 805 | Ga0496111_0096310 | 3300048914 | Bacteria | 2172 |
| 806 | Ga0496112_0023091 | 3300048915 | Bacteria | 5937 |
| 807 | Ga0496112_0166917 | 3300048915 | Unclassified | 2167 |
| 808 | Ga0496112_0402385 | 3300048915 | Bacteria | 1309 |
| 809 | Ga0496112_0603714 | 3300048915 | Bacteria | 1029 |
| 810 | Ga0496114_0398708 | 3300048917 | Bacteria | 1218 |
| 811 | Ga0496115_0115084 | 3300048918 | Bacteria | 2211 |
| 812 | Ga0496115_0644781 | 3300048918 | Bacteria | 838 |
| 813 | Ga0496123_0097698 | 3300048926 | Bacteria | 1720 |
| 814 | nmdc:mga0k408_470241_c1 | 3300050493 | Bacteria | 746 |
| 815 | nmdc:mga07m45_300048_c1 | 3300050496 | Bacteria | 934 |
| 816 | nmdc:mga08y16_476060_c1 | 3300050511 | Bacteria | 1271 |
| 817 | nmdc:mga0n895_1729430_c1 | 3300050512 | Bacteria | 587 |
| 818 | nmdc:mga0n895_500669_c1 | 3300050512 | Bacteria | 1224 |
| 819 | nmdc:mga0n895_506034_c1 | 3300050512 | Bacteria | 1216 |
| 820 | nmdc:mga0n895_63697_c1 | 3300050512 | Bacteria | 3646 |
| 821 | nmdc:mga0rr50_108671_c1 | 3300050513 | Bacteria | 2191 |
| 822 | nmdc:mga08x19_230358_c1 | 3300050514 | Bacteria | 1275 |
| 823 | nmdc:mga0a205_438124_c1 | 3300050515 | Bacteria | 1168 |
| 824 | Ga0495601_0068845 | 3300053077 | Bacteria | 2257 |
| 825 | Ga0495601_0374901 | 3300053077 | Bacteria | 924 |
| 826 | Ga0495612_0026148 | 3300053078 | Bacteria | 2346 |
| 827 | Ga0495595_0450360 | 3300053084 | Bacteria | 654 |
| 828 | Ga0495619_0004347 | 3300053085 | Bacteria | 9040 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026041 | Ga0207639_10884014 | Ga0207639_108840141 | 108 |
| 2 | 3300005331 | Ga0070670_100033631 | Ga0070670_1000336312 | 109 |
| 3 | 3300005334 | Ga0068869_100022675 | Ga0068869_1000226752 | 109 |
| 4 | 3300005335 | Ga0070666_11128251 | Ga0070666_111282512 | 109 |
| 5 | 3300005343 | Ga0070687_100663840 | Ga0070687_1006638402 | 109 |
| 6 | 3300005353 | Ga0070669_100700816 | Ga0070669_1007008162 | 109 |
| 7 | 3300005354 | Ga0070675_100010885 | Ga0070675_1000108853 | 109 |
| 8 | 3300005355 | Ga0070671_100043601 | Ga0070671_1000436013 | 109 |
| 9 | 3300005364 | Ga0070673_100002494 | Ga0070673_1000024942 | 109 |
| 10 | 3300005365 | Ga0070688_101000563 | Ga0070688_1010005632 | 109 |
| 11 | 3300005366 | Ga0070659_101158084 | Ga0070659_1011580842 | 109 |
| 12 | 3300005367 | Ga0070667_100191955 | Ga0070667_1001919552 | 109 |
| 13 | 3300005439 | Ga0070711_101871591 | Ga0070711_1018715911 | 109 |
| 14 | 3300005444 | Ga0070694_100046133 | Ga0070694_1000461331 | 109 |
| 15 | 3300005456 | Ga0070678_101491961 | Ga0070678_1014919612 | 109 |
| 16 | 3300005459 | Ga0068867_100143599 | Ga0068867_1001435992 | 109 |
| 17 | 3300005543 | Ga0070672_100006345 | Ga0070672_1000063452 | 109 |
| 18 | 3300005577 | Ga0068857_100060502 | Ga0068857_1000605022 | 109 |
| 19 | 3300005617 | Ga0068859_100217140 | Ga0068859_1002171402 | 109 |
| 20 | 3300005617 | Ga0068859_100372233 | Ga0068859_1003722332 | 109 |
| 21 | 3300005718 | Ga0068866_10559427 | Ga0068866_105594272 | 109 |
| 22 | 3300005719 | Ga0068861_100728712 | Ga0068861_1007287122 | 109 |
| 23 | 3300005719 | Ga0068861_101501743 | Ga0068861_1015017432 | 109 |
| 24 | 3300005842 | Ga0068858_100098322 | Ga0068858_1000983223 | 109 |
| 25 | 3300006353 | Ga0075370_10981170 | Ga0075370_109811702 | 109 |
| 26 | 3300006931 | Ga0097620_100217143 | Ga0097620_1002171432 | 109 |
| 27 | 3300006931 | Ga0097620_100372214 | Ga0097620_1003722142 | 109 |
| 28 | 3300009098 | Ga0105245_10165119 | Ga0105245_101651192 | 109 |
| 29 | 3300009101 | Ga0105247_11759754 | Ga0105247_117597542 | 109 |
| 30 | 3300009545 | Ga0105237_11151428 | Ga0105237_111514281 | 109 |
| 31 | 3300009553 | Ga0105249_10434427 | Ga0105249_104344272 | 109 |
| 32 | 3300013306 | Ga0163162_11159014 | Ga0163162_111590141 | 109 |
| 33 | 3300013308 | Ga0157375_10053422 | Ga0157375_100534222 | 109 |
| 34 | 3300014325 | Ga0163163_10284778 | Ga0163163_102847782 | 109 |
| 35 | 3300014326 | Ga0157380_11080427 | Ga0157380_110804272 | 109 |
| 36 | 3300014745 | Ga0157377_10114776 | Ga0157377_101147762 | 109 |
| 37 | 3300025903 | Ga0207680_10829842 | Ga0207680_108298421 | 109 |
| 38 | 3300025907 | Ga0207645_10011861 | Ga0207645_100118615 | 109 |
| 39 | 3300025908 | Ga0207643_10661220 | Ga0207643_106612202 | 109 |
| 40 | 3300025918 | Ga0207662_10092022 | Ga0207662_100920222 | 109 |
| 41 | 3300025918 | Ga0207662_10229232 | Ga0207662_102292322 | 109 |
| 42 | 3300025923 | Ga0207681_10186940 | Ga0207681_101869402 | 109 |
| 43 | 3300025925 | Ga0207650_10067697 | Ga0207650_100676972 | 109 |
| 44 | 3300025926 | Ga0207659_10083054 | Ga0207659_100830542 | 109 |
| 45 | 3300025931 | Ga0207644_10030901 | Ga0207644_100309013 | 109 |
| 46 | 3300025934 | Ga0207686_10831284 | Ga0207686_108312841 | 109 |
| 47 | 3300025935 | Ga0207709_10492946 | Ga0207709_104929462 | 109 |
| 48 | 3300025940 | Ga0207691_10002908 | Ga0207691_100029086 | 109 |
| 49 | 3300025942 | Ga0207689_10004127 | Ga0207689_1000412713 | 109 |
| 50 | 3300025945 | Ga0207679_10295574 | Ga0207679_102955741 | 109 |
| 51 | 3300025960 | Ga0207651_10016042 | Ga0207651_100160422 | 109 |
| 52 | 3300025981 | Ga0207640_10861516 | Ga0207640_108615161 | 109 |
| 53 | 3300025986 | Ga0207658_10167107 | Ga0207658_101671072 | 109 |
| 54 | 3300026023 | Ga0207677_10285207 | Ga0207677_102852072 | 109 |
| 55 | 3300026035 | Ga0207703_10072886 | Ga0207703_100728862 | 109 |
| 56 | 3300026089 | Ga0207648_10006033 | Ga0207648_1000603311 | 109 |
| 57 | 3300026116 | Ga0207674_10064451 | Ga0207674_100644512 | 109 |
| 58 | 3300026118 | Ga0207675_100931854 | Ga0207675_1009318542 | 109 |
| 59 | 3300026118 | Ga0207675_101720273 | Ga0207675_1017202732 | 109 |
| 60 | 3300026121 | Ga0207683_11149815 | Ga0207683_111498152 | 109 |
| 61 | 3300035084 | Ga0373928_0133372 | Ga0373928_0133372_319_651 | 109 |
| 62 | 3300035171 | Ga0373946_0300027 | Ga0373946_0300027_434_766 | 109 |
| 63 | 3300035695 | Ga0373927_0064743 | Ga0373927_0064743_852_1184 | 109 |
| 64 | 3300035725 | Ga0373947_0506047 | Ga0373947_0506047_390_722 | 109 |
| 65 | 3300037068 | Ga0373925_0049097 | Ga0373925_0049097_2456_2788 | 109 |
| 66 | 3300048905 | Ga0496102_1475025 | Ga0496102_1475025_232_570 | 109 |
| 67 | 3300050493 | nmdc:mga0k408_470241_c1 | nmdc:mga0k408_470241_c1_146_484 | 109 |
| 68 | 3300050496 | nmdc:mga07m45_300048_c1 | nmdc:mga07m45_300048_c1_96_434 | 109 |
| 69 | 3300005347 | Ga0070668_100166973 | Ga0070668_1001669731 | 110 |
| 70 | 3300005354 | Ga0070675_100605760 | Ga0070675_1006057602 | 110 |
| 71 | 3300005843 | Ga0068860_100050725 | Ga0068860_1000507253 | 110 |
| 72 | 3300005844 | Ga0068862_100225149 | Ga0068862_1002251492 | 110 |
| 73 | 3300013306 | Ga0163162_12072307 | Ga0163162_120723072 | 110 |
| 74 | 3300013308 | Ga0157375_12444959 | Ga0157375_124449592 | 110 |
| 75 | 3300025923 | Ga0207681_10125092 | Ga0207681_101250922 | 110 |
| 76 | 3300025926 | Ga0207659_10528908 | Ga0207659_105289082 | 110 |
| 77 | 3300026118 | Ga0207675_100440651 | Ga0207675_1004406511 | 110 |
| 78 | 3300028380 | Ga0268265_11239606 | Ga0268265_112396062 | 110 |
| 79 | 3300028381 | Ga0268264_10183238 | Ga0268264_101832383 | 110 |
| 80 | 3300035084 | Ga0373928_0024020 | Ga0373928_0024020_404_739 | 111 |
| 81 | 3300035112 | Ga0373932_0012687 | Ga0373932_0012687_1076_1411 | 111 |
| 82 | 3300035114 | Ga0373939_0384012 | Ga0373939_0384012_68_403 | 111 |
| 83 | 3300035691 | Ga0373931_0030884 | Ga0373931_0030884_556_891 | 111 |
| 84 | 3300037068 | Ga0373925_0314705 | Ga0373925_0314705_907_1242 | 111 |
| 85 | 3300047317 | Ga0495604_0401207 | Ga0495604_0401207_315_650 | 111 |
| 86 | 3300048907 | Ga0496104_0343427 | Ga0496104_0343427_973_1308 | 111 |
| 87 | 3300048915 | Ga0496112_0603714 | Ga0496112_0603714_527_862 | 111 |
| 88 | 3300048926 | Ga0496123_0097698 | Ga0496123_0097698_342_677 | 111 |
| 89 | 3300005330 | Ga0070690_100562678 | Ga0070690_1005626781 | 112 |
| 90 | 3300005334 | Ga0068869_100499826 | Ga0068869_1004998261 | 112 |
| 91 | 3300005353 | Ga0070669_101524307 | Ga0070669_1015243072 | 112 |
| 92 | 3300005438 | Ga0070701_10948080 | Ga0070701_109480802 | 112 |
| 93 | 3300005549 | Ga0070704_102131119 | Ga0070704_1021311192 | 112 |
| 94 | 3300005577 | Ga0068857_100809218 | Ga0068857_1008092182 | 112 |
| 95 | 3300005617 | Ga0068859_100354840 | Ga0068859_1003548402 | 112 |
| 96 | 3300005618 | Ga0068864_100453194 | Ga0068864_1004531942 | 112 |
| 97 | 3300006844 | Ga0075428_102348646 | Ga0075428_1023486461 | 112 |
| 98 | 3300006871 | Ga0075434_100367914 | Ga0075434_1003679142 | 112 |
| 99 | 3300006931 | Ga0097620_100354849 | Ga0097620_1003548492 | 112 |
| 100 | 3300007076 | Ga0075435_100106617 | Ga0075435_1001066172 | 112 |
| 101 | 3300009098 | Ga0105245_10129798 | Ga0105245_101297982 | 112 |
| 102 | 3300010375 | Ga0105239_11981226 | Ga0105239_119812262 | 112 |
| 103 | 3300013296 | Ga0157374_12459234 | Ga0157374_124592341 | 112 |
| 104 | 3300013297 | Ga0157378_10515479 | Ga0157378_105154792 | 112 |
| 105 | 3300014968 | Ga0157379_10995373 | Ga0157379_109953732 | 112 |
| 106 | 3300025923 | Ga0207681_11379166 | Ga0207681_113791662 | 112 |
| 107 | 3300025927 | Ga0207687_10848735 | Ga0207687_108487352 | 112 |
| 108 | 3300025942 | Ga0207689_10078702 | Ga0207689_100787022 | 112 |
| 109 | 3300026095 | Ga0207676_11535339 | Ga0207676_115353391 | 112 |
| 110 | 3300031901 | Ga0307406_11230033 | Ga0307406_112300332 | 112 |
| 111 | 3300031903 | Ga0307407_10062716 | Ga0307407_100627163 | 112 |
| 112 | 3300035083 | Ga0373926_0030153 | Ga0373926_0030153_1145_1483 | 112 |
| 113 | 3300048915 | Ga0496112_0166917 | Ga0496112_0166917_74_412 | 112 |
| 114 | 3300050512 | nmdc:mga0n895_500669_c1 | nmdc:mga0n895_500669_c1_848_1186 | 112 |
| 115 | 3300050512 | nmdc:mga0n895_506034_c1 | nmdc:mga0n895_506034_c1_727_1065 | 112 |
| 116 | 3300050513 | nmdc:mga0rr50_108671_c1 | nmdc:mga0rr50_108671_c1_1365_1703 | 112 |
| 117 | 3300005331 | Ga0070670_100045157 | Ga0070670_1000451572 | 113 |
| 118 | 3300005331 | Ga0070670_100364209 | Ga0070670_1003642092 | 113 |
| 119 | 3300005333 | Ga0070677_10134529 | Ga0070677_101345292 | 113 |
| 120 | 3300005333 | Ga0070677_10138047 | Ga0070677_101380472 | 113 |
| 121 | 3300005334 | Ga0068869_100287042 | Ga0068869_1002870421 | 113 |
| 122 | 3300005338 | Ga0068868_100299338 | Ga0068868_1002993382 | 113 |
| 123 | 3300005338 | Ga0068868_100502025 | Ga0068868_1005020252 | 113 |
| 124 | 3300005347 | Ga0070668_100248223 | Ga0070668_1002482232 | 113 |
| 125 | 3300005353 | Ga0070669_100081074 | Ga0070669_1000810742 | 113 |
| 126 | 3300005354 | Ga0070675_100006916 | Ga0070675_1000069162 | 113 |
| 127 | 3300005354 | Ga0070675_101243166 | Ga0070675_1012431661 | 113 |
| 128 | 3300005355 | Ga0070671_100178282 | Ga0070671_1001782822 | 113 |
| 129 | 3300005356 | Ga0070674_100312655 | Ga0070674_1003126552 | 113 |
| 130 | 3300005356 | Ga0070674_100558454 | Ga0070674_1005584542 | 113 |
| 131 | 3300005364 | Ga0070673_100010065 | Ga0070673_1000100655 | 113 |
| 132 | 3300005364 | Ga0070673_100769326 | Ga0070673_1007693262 | 113 |
| 133 | 3300005364 | Ga0070673_100886824 | Ga0070673_1008868242 | 113 |
| 134 | 3300005367 | Ga0070667_100093357 | Ga0070667_1000933572 | 113 |
| 135 | 3300005367 | Ga0070667_100226560 | Ga0070667_1002265602 | 113 |
| 136 | 3300005367 | Ga0070667_100911236 | Ga0070667_1009112362 | 113 |
| 137 | 3300005438 | Ga0070701_10285146 | Ga0070701_102851462 | 113 |
| 138 | 3300005441 | Ga0070700_100285337 | Ga0070700_1002853372 | 113 |
| 139 | 3300005441 | Ga0070700_101818524 | Ga0070700_1018185242 | 113 |
| 140 | 3300005455 | Ga0070663_100062189 | Ga0070663_1000621892 | 113 |
| 141 | 3300005456 | Ga0070678_100004438 | Ga0070678_1000044382 | 113 |
| 142 | 3300005457 | Ga0070662_100093657 | Ga0070662_1000936572 | 113 |
| 143 | 3300005459 | Ga0068867_100177915 | Ga0068867_1001779152 | 113 |
| 144 | 3300005459 | Ga0068867_100239919 | Ga0068867_1002399192 | 113 |
| 145 | 3300005459 | Ga0068867_100255407 | Ga0068867_1002554072 | 113 |
| 146 | 3300005459 | Ga0068867_101715684 | Ga0068867_1017156842 | 113 |
| 147 | 3300005466 | Ga0070685_11126423 | Ga0070685_111264231 | 113 |
| 148 | 3300005543 | Ga0070672_100002480 | Ga0070672_1000024803 | 113 |
| 149 | 3300005543 | Ga0070672_100042381 | Ga0070672_1000423814 | 113 |
| 150 | 3300005543 | Ga0070672_100126052 | Ga0070672_1001260522 | 113 |
| 151 | 3300005543 | Ga0070672_100605558 | Ga0070672_1006055582 | 113 |
| 152 | 3300005544 | Ga0070686_100617603 | Ga0070686_1006176031 | 113 |
| 153 | 3300005548 | Ga0070665_100156748 | Ga0070665_1001567482 | 113 |
| 154 | 3300005564 | Ga0070664_100141413 | Ga0070664_1001414132 | 113 |
| 155 | 3300005564 | Ga0070664_100327808 | Ga0070664_1003278082 | 113 |
| 156 | 3300005578 | Ga0068854_100293136 | Ga0068854_1002931362 | 113 |
| 157 | 3300005617 | Ga0068859_100282454 | Ga0068859_1002824543 | 113 |
| 158 | 3300005618 | Ga0068864_100003322 | Ga0068864_10000332212 | 113 |
| 159 | 3300005718 | Ga0068866_10009601 | Ga0068866_100096012 | 113 |
| 160 | 3300005719 | Ga0068861_100005340 | Ga0068861_1000053408 | 113 |
| 161 | 3300005834 | Ga0068851_10086276 | Ga0068851_100862762 | 113 |
| 162 | 3300005834 | Ga0068851_10295793 | Ga0068851_102957932 | 113 |
| 163 | 3300005840 | Ga0068870_10190692 | Ga0068870_101906922 | 113 |
| 164 | 3300005841 | Ga0068863_100256330 | Ga0068863_1002563302 | 113 |
| 165 | 3300005841 | Ga0068863_101224542 | Ga0068863_1012245422 | 113 |
| 166 | 3300005842 | Ga0068858_100157766 | Ga0068858_1001577662 | 113 |
| 167 | 3300005842 | Ga0068858_100292875 | Ga0068858_1002928752 | 113 |
| 168 | 3300005843 | Ga0068860_100594344 | Ga0068860_1005943442 | 113 |
| 169 | 3300005844 | Ga0068862_100218231 | Ga0068862_1002182312 | 113 |
| 170 | 3300005844 | Ga0068862_102541743 | Ga0068862_1025417431 | 113 |
| 171 | 3300006163 | Ga0070715_10204131 | Ga0070715_102041311 | 113 |
| 172 | 3300006237 | Ga0097621_100010446 | Ga0097621_1000104462 | 113 |
| 173 | 3300006358 | Ga0068871_100012102 | Ga0068871_1000121024 | 113 |
| 174 | 3300006358 | Ga0068871_101496881 | Ga0068871_1014968812 | 113 |
| 175 | 3300006881 | Ga0068865_100033555 | Ga0068865_1000335552 | 113 |
| 176 | 3300006931 | Ga0097620_100282441 | Ga0097620_1002824412 | 113 |
| 177 | 3300009094 | Ga0111539_10530712 | Ga0111539_105307122 | 113 |
| 178 | 3300009098 | Ga0105245_13240144 | Ga0105245_132401441 | 113 |
| 179 | 3300009148 | Ga0105243_10117042 | Ga0105243_101170422 | 113 |
| 180 | 3300009176 | Ga0105242_11081074 | Ga0105242_110810741 | 113 |
| 181 | 3300009177 | Ga0105248_10745552 | Ga0105248_107455522 | 113 |
| 182 | 3300013306 | Ga0163162_10981542 | Ga0163162_109815421 | 113 |
| 183 | 3300013308 | Ga0157375_10334481 | Ga0157375_103344812 | 113 |
| 184 | 3300013308 | Ga0157375_10854959 | Ga0157375_108549592 | 113 |
| 185 | 3300014326 | Ga0157380_10025430 | Ga0157380_100254306 | 113 |
| 186 | 3300014326 | Ga0157380_10507686 | Ga0157380_105076862 | 113 |
| 187 | 3300014326 | Ga0157380_11842347 | Ga0157380_118423471 | 113 |
| 188 | 3300014969 | Ga0157376_10218321 | Ga0157376_102183212 | 113 |
| 189 | 3300017792 | Ga0163161_10035466 | Ga0163161_100354664 | 113 |
| 190 | 3300025315 | Ga0207697_10035786 | Ga0207697_100357862 | 113 |
| 191 | 3300025315 | Ga0207697_10119606 | Ga0207697_101196062 | 113 |
| 192 | 3300025893 | Ga0207682_10073588 | Ga0207682_100735882 | 113 |
| 193 | 3300025893 | Ga0207682_10102713 | Ga0207682_101027132 | 113 |
| 194 | 3300025893 | Ga0207682_10115407 | Ga0207682_101154072 | 113 |
| 195 | 3300025899 | Ga0207642_10036785 | Ga0207642_100367852 | 113 |
| 196 | 3300025901 | Ga0207688_10045458 | Ga0207688_100454582 | 113 |
| 197 | 3300025903 | Ga0207680_10264823 | Ga0207680_102648232 | 113 |
| 198 | 3300025903 | Ga0207680_10443012 | Ga0207680_104430122 | 113 |
| 199 | 3300025905 | Ga0207685_10061182 | Ga0207685_100611822 | 113 |
| 200 | 3300025907 | Ga0207645_10024055 | Ga0207645_100240552 | 113 |
| 201 | 3300025907 | Ga0207645_10067652 | Ga0207645_100676522 | 113 |
| 202 | 3300025909 | Ga0207705_10415746 | Ga0207705_104157461 | 113 |
| 203 | 3300025918 | Ga0207662_10055703 | Ga0207662_100557032 | 113 |
| 204 | 3300025923 | Ga0207681_10067279 | Ga0207681_100672791 | 113 |
| 205 | 3300025923 | Ga0207681_10467351 | Ga0207681_104673512 | 113 |
| 206 | 3300025925 | Ga0207650_10224883 | Ga0207650_102248832 | 113 |
| 207 | 3300025926 | Ga0207659_10013667 | Ga0207659_100136672 | 113 |
| 208 | 3300025926 | Ga0207659_10155121 | Ga0207659_101551212 | 113 |
| 209 | 3300025926 | Ga0207659_11347804 | Ga0207659_113478042 | 113 |
| 210 | 3300025931 | Ga0207644_10043213 | Ga0207644_100432132 | 113 |
| 211 | 3300025933 | Ga0207706_10036136 | Ga0207706_100361362 | 113 |
| 212 | 3300025933 | Ga0207706_10473777 | Ga0207706_104737772 | 113 |
| 213 | 3300025935 | Ga0207709_10240072 | Ga0207709_102400722 | 113 |
| 214 | 3300025935 | Ga0207709_10463935 | Ga0207709_104639352 | 113 |
| 215 | 3300025937 | Ga0207669_10080594 | Ga0207669_100805942 | 113 |
| 216 | 3300025937 | Ga0207669_10096515 | Ga0207669_100965152 | 113 |
| 217 | 3300025938 | Ga0207704_10031604 | Ga0207704_100316042 | 113 |
| 218 | 3300025940 | Ga0207691_10004381 | Ga0207691_100043813 | 113 |
| 219 | 3300025940 | Ga0207691_10012171 | Ga0207691_100121712 | 113 |
| 220 | 3300025940 | Ga0207691_10018599 | Ga0207691_100185992 | 113 |
| 221 | 3300025941 | Ga0207711_11923641 | Ga0207711_119236412 | 113 |
| 222 | 3300025942 | Ga0207689_10457072 | Ga0207689_104570722 | 113 |
| 223 | 3300025945 | Ga0207679_10078728 | Ga0207679_100787282 | 113 |
| 224 | 3300025960 | Ga0207651_10096420 | Ga0207651_100964202 | 113 |
| 225 | 3300025960 | Ga0207651_10240883 | Ga0207651_102408832 | 113 |
| 226 | 3300025961 | Ga0207712_10163879 | Ga0207712_101638792 | 113 |
| 227 | 3300025972 | Ga0207668_10049202 | Ga0207668_100492022 | 113 |
| 228 | 3300025981 | Ga0207640_10513554 | Ga0207640_105135542 | 113 |
| 229 | 3300025986 | Ga0207658_10096819 | Ga0207658_100968192 | 113 |
| 230 | 3300025986 | Ga0207658_10132053 | Ga0207658_101320532 | 113 |
| 231 | 3300025986 | Ga0207658_10712375 | Ga0207658_107123751 | 113 |
| 232 | 3300026023 | Ga0207677_10066752 | Ga0207677_100667522 | 113 |
| 233 | 3300026023 | Ga0207677_10531928 | Ga0207677_105319282 | 113 |
| 234 | 3300026035 | Ga0207703_10492621 | Ga0207703_104926212 | 113 |
| 235 | 3300026067 | Ga0207678_10036749 | Ga0207678_100367492 | 113 |
| 236 | 3300026075 | Ga0207708_10117884 | Ga0207708_101178842 | 113 |
| 237 | 3300026075 | Ga0207708_11549259 | Ga0207708_115492592 | 113 |
| 238 | 3300026088 | Ga0207641_10018659 | Ga0207641_100186592 | 113 |
| 239 | 3300026088 | Ga0207641_10217212 | Ga0207641_102172122 | 113 |
| 240 | 3300026088 | Ga0207641_10583447 | Ga0207641_105834472 | 113 |
| 241 | 3300026089 | Ga0207648_10016691 | Ga0207648_100166912 | 113 |
| 242 | 3300026089 | Ga0207648_10082693 | Ga0207648_100826932 | 113 |
| 243 | 3300026095 | Ga0207676_10002815 | Ga0207676_100028153 | 113 |
| 244 | 3300026116 | Ga0207674_10569533 | Ga0207674_105695332 | 113 |
| 245 | 3300026118 | Ga0207675_100124674 | Ga0207675_1001246742 | 113 |
| 246 | 3300026121 | Ga0207683_10029643 | Ga0207683_100296433 | 113 |
| 247 | 3300026121 | Ga0207683_10350736 | Ga0207683_103507362 | 113 |
| 248 | 3300026142 | Ga0207698_10596915 | Ga0207698_105969152 | 113 |
| 249 | 3300028379 | Ga0268266_10129710 | Ga0268266_101297102 | 113 |
| 250 | 3300028380 | Ga0268265_10857027 | Ga0268265_108570272 | 113 |
| 251 | 3300028381 | Ga0268264_10009610 | Ga0268264_100096102 | 113 |
| 252 | 3300028381 | Ga0268264_10236073 | Ga0268264_102360732 | 113 |
| 253 | 3300028381 | Ga0268264_10722200 | Ga0268264_107222002 | 113 |
| 254 | 3300035692 | Ga0373935_0529367 | Ga0373935_0529367_150_491 | 113 |
| 255 | 3300035725 | Ga0373947_0431673 | Ga0373947_0431673_32_373 | 113 |
| 256 | 3300036401 | Ga0373937_0335210 | Ga0373937_0335210_678_1019 | 113 |
| 257 | 3300037068 | Ga0373925_0407639 | Ga0373925_0407639_95_436 | 113 |
| 258 | 3300041512 | Ga0451853_3538724 | Ga0451853_3538724_21_362 | 113 |
| 259 | 3300042876 | Ga0451577_0022341 | Ga0451577_0022341_2573_2914 | 113 |
| 260 | 3300042876 | Ga0451577_1088562 | Ga0451577_1088562_263_604 | 113 |
| 261 | 3300044712 | Ga0453684_0398230 | Ga0453684_0398230_132_473 | 113 |
| 262 | 3300044712 | Ga0453684_1962515 | Ga0453684_1962515_59_400 | 113 |
| 263 | 3300045051 | Ga0451576_0654171 | Ga0451576_0654171_318_659 | 113 |
| 264 | 3300046454 | Ga0495592_0139344 | Ga0495592_0139344_719_1060 | 113 |
| 265 | 3300046463 | Ga0495653_0314156 | Ga0495653_0314156_241_582 | 113 |
| 266 | 3300046475 | Ga0495639_0225656 | Ga0495639_0225656_160_501 | 113 |
| 267 | 3300046516 | Ga0495628_0340472 | Ga0495628_0340472_641_982 | 113 |
| 268 | 3300046517 | Ga0495630_0856958 | Ga0495630_0856958_35_376 | 113 |
| 269 | 3300046681 | Ga0495647_0027972 | Ga0495647_0027972_953_1294 | 113 |
| 270 | 3300046683 | Ga0495658_0169422 | Ga0495658_0169422_901_1242 | 113 |
| 271 | 3300046689 | Ga0495613_0043094 | Ga0495613_0043094_2096_2437 | 113 |
| 272 | 3300047319 | Ga0495674_0283799 | Ga0495674_0283799_812_1153 | 113 |
| 273 | 3300047321 | Ga0495676_0482969 | Ga0495676_0482969_68_409 | 113 |
| 274 | 3300047322 | Ga0495680_0172619 | Ga0495680_0172619_381_722 | 113 |
| 275 | 3300048912 | Ga0496109_1325199 | Ga0496109_1325199_27_368 | 113 |
| 276 | 3300050511 | nmdc:mga08y16_476060_c1 | nmdc:mga08y16_476060_c1_463_804 | 113 |
| 277 | 3300053077 | Ga0495601_0374901 | Ga0495601_0374901_191_532 | 113 |
| 278 | 3300005331 | Ga0070670_101041813 | Ga0070670_1010418132 | 114 |
| 279 | 3300005530 | Ga0070679_101026724 | Ga0070679_1010267242 | 114 |
| 280 | 3300005543 | Ga0070672_100906554 | Ga0070672_1009065542 | 114 |
| 281 | 3300005834 | Ga0068851_10726881 | Ga0068851_107268812 | 114 |
| 282 | 3300006358 | Ga0068871_100468078 | Ga0068871_1004680782 | 114 |
| 283 | 3300009551 | Ga0105238_12108389 | Ga0105238_121083892 | 114 |
| 284 | 3300013104 | Ga0157370_10089239 | Ga0157370_100892392 | 114 |
| 285 | 3300013105 | Ga0157369_10189005 | Ga0157369_101890052 | 114 |
| 286 | 3300025919 | Ga0207657_10014119 | Ga0207657_100141192 | 114 |
| 287 | 3300025925 | Ga0207650_10075850 | Ga0207650_100758502 | 114 |
| 288 | 3300025940 | Ga0207691_10615661 | Ga0207691_106156612 | 114 |
| 289 | 3300026041 | Ga0207639_10890362 | Ga0207639_108903622 | 114 |
| 290 | 3300036401 | Ga0373937_0148509 | Ga0373937_0148509_1088_1432 | 114 |
| 291 | 3300041463 | Ga0451804_0049404 | Ga0451804_0049404_127_471 | 114 |
| 292 | 3300041491 | Ga0451833_0352810 | Ga0451833_0352810_177_521 | 114 |
| 293 | 3300047318 | Ga0495636_0212059 | Ga0495636_0212059_166_516 | 114 |
| 294 | 3300050512 | nmdc:mga0n895_1729430_c1 | nmdc:mga0n895_1729430_c1_79_423 | 114 |
| 295 | 3300001991 | JGI24743J22301_10018002 | JGI24743J22301_100180022 | 115 |
| 296 | 3300005293 | Ga0065715_10162868 | Ga0065715_101628682 | 115 |
| 297 | 3300005293 | Ga0065715_10274298 | Ga0065715_102742982 | 115 |
| 298 | 3300005327 | Ga0070658_10071448 | Ga0070658_100714482 | 115 |
| 299 | 3300005328 | Ga0070676_10000349 | Ga0070676_100003498 | 115 |
| 300 | 3300005328 | Ga0070676_10440632 | Ga0070676_104406322 | 115 |
| 301 | 3300005328 | Ga0070676_10450540 | Ga0070676_104505402 | 115 |
| 302 | 3300005328 | Ga0070676_10601232 | Ga0070676_106012322 | 115 |
| 303 | 3300005329 | Ga0070683_100026175 | Ga0070683_1000261752 | 115 |
| 304 | 3300005329 | Ga0070683_100348861 | Ga0070683_1003488612 | 115 |
| 305 | 3300005330 | Ga0070690_100007721 | Ga0070690_1000077212 | 115 |
| 306 | 3300005330 | Ga0070690_100009894 | Ga0070690_1000098942 | 115 |
| 307 | 3300005331 | Ga0070670_100006222 | Ga0070670_1000062223 | 115 |
| 308 | 3300005331 | Ga0070670_100023428 | Ga0070670_1000234283 | 115 |
| 309 | 3300005331 | Ga0070670_100080500 | Ga0070670_1000805003 | 115 |
| 310 | 3300005331 | Ga0070670_100179110 | Ga0070670_1001791102 | 115 |
| 311 | 3300005331 | Ga0070670_101499920 | Ga0070670_1014999202 | 115 |
| 312 | 3300005333 | Ga0070677_10162955 | Ga0070677_101629552 | 115 |
| 313 | 3300005333 | Ga0070677_10592129 | Ga0070677_105921292 | 115 |
| 314 | 3300005334 | Ga0068869_100004464 | Ga0068869_1000044642 | 115 |
| 315 | 3300005334 | Ga0068869_100014013 | Ga0068869_1000140132 | 115 |
| 316 | 3300005334 | Ga0068869_100345635 | Ga0068869_1003456352 | 115 |
| 317 | 3300005334 | Ga0068869_100835847 | Ga0068869_1008358472 | 115 |
| 318 | 3300005335 | Ga0070666_10002690 | Ga0070666_100026902 | 115 |
| 319 | 3300005337 | Ga0070682_100338523 | Ga0070682_1003385232 | 115 |
| 320 | 3300005338 | Ga0068868_100028854 | Ga0068868_1000288544 | 115 |
| 321 | 3300005338 | Ga0068868_100080132 | Ga0068868_1000801322 | 115 |
| 322 | 3300005338 | Ga0068868_100148605 | Ga0068868_1001486052 | 115 |
| 323 | 3300005338 | Ga0068868_100221540 | Ga0068868_1002215402 | 115 |
| 324 | 3300005338 | Ga0068868_100277865 | Ga0068868_1002778652 | 115 |
| 325 | 3300005339 | Ga0070660_100274962 | Ga0070660_1002749622 | 115 |
| 326 | 3300005340 | Ga0070689_100039446 | Ga0070689_1000394462 | 115 |
| 327 | 3300005340 | Ga0070689_100053248 | Ga0070689_1000532483 | 115 |
| 328 | 3300005341 | Ga0070691_10026265 | Ga0070691_100262653 | 115 |
| 329 | 3300005341 | Ga0070691_10180114 | Ga0070691_101801142 | 115 |
| 330 | 3300005343 | Ga0070687_100204325 | Ga0070687_1002043251 | 115 |
| 331 | 3300005344 | Ga0070661_100018929 | Ga0070661_1000189294 | 115 |
| 332 | 3300005344 | Ga0070661_100093927 | Ga0070661_1000939273 | 115 |
| 333 | 3300005344 | Ga0070661_101431450 | Ga0070661_1014314501 | 115 |
| 334 | 3300005345 | Ga0070692_10503040 | Ga0070692_105030402 | 115 |
| 335 | 3300005347 | Ga0070668_100004358 | Ga0070668_1000043582 | 115 |
| 336 | 3300005347 | Ga0070668_100004660 | Ga0070668_10000466010 | 115 |
| 337 | 3300005353 | Ga0070669_100001355 | Ga0070669_1000013555 | 115 |
| 338 | 3300005353 | Ga0070669_100416313 | Ga0070669_1004163132 | 115 |
| 339 | 3300005353 | Ga0070669_101158564 | Ga0070669_1011585641 | 115 |
| 340 | 3300005354 | Ga0070675_100004937 | Ga0070675_1000049372 | 115 |
| 341 | 3300005355 | Ga0070671_100006007 | Ga0070671_1000060072 | 115 |
| 342 | 3300005355 | Ga0070671_100057656 | Ga0070671_1000576562 | 115 |
| 343 | 3300005355 | Ga0070671_100152775 | Ga0070671_1001527752 | 115 |
| 344 | 3300005355 | Ga0070671_101411866 | Ga0070671_1014118662 | 115 |
| 345 | 3300005355 | Ga0070671_101597486 | Ga0070671_1015974862 | 115 |
| 346 | 3300005356 | Ga0070674_100024685 | Ga0070674_1000246854 | 115 |
| 347 | 3300005356 | Ga0070674_100027999 | Ga0070674_1000279993 | 115 |
| 348 | 3300005364 | Ga0070673_100007378 | Ga0070673_1000073782 | 115 |
| 349 | 3300005364 | Ga0070673_100213008 | Ga0070673_1002130082 | 115 |
| 350 | 3300005365 | Ga0070688_100003186 | Ga0070688_1000031863 | 115 |
| 351 | 3300005365 | Ga0070688_100031098 | Ga0070688_1000310981 | 115 |
| 352 | 3300005366 | Ga0070659_100226456 | Ga0070659_1002264562 | 115 |
| 353 | 3300005367 | Ga0070667_100003589 | Ga0070667_1000035895 | 115 |
| 354 | 3300005367 | Ga0070667_100011330 | Ga0070667_1000113305 | 115 |
| 355 | 3300005367 | Ga0070667_101451928 | Ga0070667_1014519282 | 115 |
| 356 | 3300005367 | Ga0070667_101507323 | Ga0070667_1015073232 | 115 |
| 357 | 3300005367 | Ga0070667_101592799 | Ga0070667_1015927992 | 115 |
| 358 | 3300005406 | Ga0070703_10327459 | Ga0070703_103274591 | 115 |
| 359 | 3300005434 | Ga0070709_10399805 | Ga0070709_103998051 | 115 |
| 360 | 3300005434 | Ga0070709_10461027 | Ga0070709_104610272 | 115 |
| 361 | 3300005436 | Ga0070713_100018564 | Ga0070713_1000185644 | 115 |
| 362 | 3300005436 | Ga0070713_100034755 | Ga0070713_1000347552 | 115 |
| 363 | 3300005437 | Ga0070710_10071601 | Ga0070710_100716012 | 115 |
| 364 | 3300005439 | Ga0070711_100127872 | Ga0070711_1001278722 | 115 |
| 365 | 3300005439 | Ga0070711_100152100 | Ga0070711_1001521002 | 115 |
| 366 | 3300005439 | Ga0070711_100158359 | Ga0070711_1001583592 | 115 |
| 367 | 3300005440 | Ga0070705_101843414 | Ga0070705_1018434141 | 115 |
| 368 | 3300005444 | Ga0070694_100104044 | Ga0070694_1001040441 | 115 |
| 369 | 3300005444 | Ga0070694_100343881 | Ga0070694_1003438812 | 115 |
| 370 | 3300005445 | Ga0070708_100061431 | Ga0070708_1000614312 | 115 |
| 371 | 3300005445 | Ga0070708_100607106 | Ga0070708_1006071061 | 115 |
| 372 | 3300005455 | Ga0070663_100525309 | Ga0070663_1005253092 | 115 |
| 373 | 3300005455 | Ga0070663_100607662 | Ga0070663_1006076622 | 115 |
| 374 | 3300005456 | Ga0070678_100000200 | Ga0070678_1000002006 | 115 |
| 375 | 3300005456 | Ga0070678_100003150 | Ga0070678_1000031503 | 115 |
| 376 | 3300005457 | Ga0070662_100004299 | Ga0070662_1000042999 | 115 |
| 377 | 3300005457 | Ga0070662_101234033 | Ga0070662_1012340331 | 115 |
| 378 | 3300005459 | Ga0068867_100001816 | Ga0068867_1000018162 | 115 |
| 379 | 3300005459 | Ga0068867_100181723 | Ga0068867_1001817232 | 115 |
| 380 | 3300005459 | Ga0068867_101460794 | Ga0068867_1014607942 | 115 |
| 381 | 3300005466 | Ga0070685_10002346 | Ga0070685_100023462 | 115 |
| 382 | 3300005466 | Ga0070685_10048537 | Ga0070685_100485374 | 115 |
| 383 | 3300005467 | Ga0070706_100002177 | Ga0070706_10000217710 | 115 |
| 384 | 3300005467 | Ga0070706_100041664 | Ga0070706_1000416642 | 115 |
| 385 | 3300005467 | Ga0070706_100433500 | Ga0070706_1004335001 | 115 |
| 386 | 3300005467 | Ga0070706_100644013 | Ga0070706_1006440132 | 115 |
| 387 | 3300005468 | Ga0070707_100343726 | Ga0070707_1003437262 | 115 |
| 388 | 3300005468 | Ga0070707_100937715 | Ga0070707_1009377152 | 115 |
| 389 | 3300005471 | Ga0070698_100242679 | Ga0070698_1002426793 | 115 |
| 390 | 3300005471 | Ga0070698_101261175 | Ga0070698_1012611751 | 115 |
| 391 | 3300005471 | Ga0070698_101474148 | Ga0070698_1014741481 | 115 |
| 392 | 3300005518 | Ga0070699_100016620 | Ga0070699_1000166204 | 115 |
| 393 | 3300005530 | Ga0070679_100721745 | Ga0070679_1007217452 | 115 |
| 394 | 3300005535 | Ga0070684_100067833 | Ga0070684_1000678332 | 115 |
| 395 | 3300005535 | Ga0070684_100119444 | Ga0070684_1001194442 | 115 |
| 396 | 3300005536 | Ga0070697_100003955 | Ga0070697_1000039552 | 115 |
| 397 | 3300005536 | Ga0070697_100170785 | Ga0070697_1001707852 | 115 |
| 398 | 3300005539 | Ga0068853_100424614 | Ga0068853_1004246141 | 115 |
| 399 | 3300005539 | Ga0068853_100830807 | Ga0068853_1008308072 | 115 |
| 400 | 3300005539 | Ga0068853_101996566 | Ga0068853_1019965661 | 115 |
| 401 | 3300005543 | Ga0070672_100003516 | Ga0070672_1000035162 | 115 |
| 402 | 3300005543 | Ga0070672_100219926 | Ga0070672_1002199262 | 115 |
| 403 | 3300005544 | Ga0070686_100010668 | Ga0070686_1000106683 | 115 |
| 404 | 3300005545 | Ga0070695_100066156 | Ga0070695_1000661563 | 115 |
| 405 | 3300005545 | Ga0070695_100343605 | Ga0070695_1003436051 | 115 |
| 406 | 3300005546 | Ga0070696_100029617 | Ga0070696_1000296172 | 115 |
| 407 | 3300005546 | Ga0070696_100092412 | Ga0070696_1000924122 | 115 |
| 408 | 3300005546 | Ga0070696_100391251 | Ga0070696_1003912512 | 115 |
| 409 | 3300005547 | Ga0070693_100003470 | Ga0070693_1000034705 | 115 |
| 410 | 3300005547 | Ga0070693_100051136 | Ga0070693_1000511362 | 115 |
| 411 | 3300005548 | Ga0070665_100001447 | Ga0070665_10000144713 | 115 |
| 412 | 3300005548 | Ga0070665_100010890 | Ga0070665_1000108902 | 115 |
| 413 | 3300005548 | Ga0070665_100221361 | Ga0070665_1002213612 | 115 |
| 414 | 3300005549 | Ga0070704_100919340 | Ga0070704_1009193402 | 115 |
| 415 | 3300005563 | Ga0068855_100242196 | Ga0068855_1002421962 | 115 |
| 416 | 3300005563 | Ga0068855_100481762 | Ga0068855_1004817622 | 115 |
| 417 | 3300005564 | Ga0070664_100011186 | Ga0070664_1000111864 | 115 |
| 418 | 3300005564 | Ga0070664_100123786 | Ga0070664_1001237862 | 115 |
| 419 | 3300005564 | Ga0070664_101385159 | Ga0070664_1013851592 | 115 |
| 420 | 3300005577 | Ga0068857_100536073 | Ga0068857_1005360732 | 115 |
| 421 | 3300005577 | Ga0068857_101376830 | Ga0068857_1013768302 | 115 |
| 422 | 3300005578 | Ga0068854_100021313 | Ga0068854_1000213133 | 115 |
| 423 | 3300005578 | Ga0068854_100067017 | Ga0068854_1000670172 | 115 |
| 424 | 3300005578 | Ga0068854_100247147 | Ga0068854_1002471472 | 115 |
| 425 | 3300005614 | Ga0068856_100109894 | Ga0068856_1001098942 | 115 |
| 426 | 3300005614 | Ga0068856_100381326 | Ga0068856_1003813262 | 115 |
| 427 | 3300005614 | Ga0068856_100553063 | Ga0068856_1005530632 | 115 |
| 428 | 3300005614 | Ga0068856_100657540 | Ga0068856_1006575402 | 115 |
| 429 | 3300005614 | Ga0068856_101299534 | Ga0068856_1012995342 | 115 |
| 430 | 3300005615 | Ga0070702_100089340 | Ga0070702_1000893402 | 115 |
| 431 | 3300005615 | Ga0070702_100141044 | Ga0070702_1001410442 | 115 |
| 432 | 3300005616 | Ga0068852_100002870 | Ga0068852_1000028704 | 115 |
| 433 | 3300005616 | Ga0068852_100236526 | Ga0068852_1002365262 | 115 |
| 434 | 3300005616 | Ga0068852_101583450 | Ga0068852_1015834502 | 115 |
| 435 | 3300005617 | Ga0068859_100004763 | Ga0068859_1000047633 | 115 |
| 436 | 3300005617 | Ga0068859_100298536 | Ga0068859_1002985362 | 115 |
| 437 | 3300005617 | Ga0068859_101647599 | Ga0068859_1016475991 | 115 |
| 438 | 3300005618 | Ga0068864_100004826 | Ga0068864_1000048262 | 115 |
| 439 | 3300005618 | Ga0068864_100013280 | Ga0068864_1000132803 | 115 |
| 440 | 3300005618 | Ga0068864_100388533 | Ga0068864_1003885332 | 115 |
| 441 | 3300005718 | Ga0068866_10004240 | Ga0068866_100042402 | 115 |
| 442 | 3300005718 | Ga0068866_10511994 | Ga0068866_105119942 | 115 |
| 443 | 3300005719 | Ga0068861_100185450 | Ga0068861_1001854502 | 115 |
| 444 | 3300005719 | Ga0068861_100238683 | Ga0068861_1002386832 | 115 |
| 445 | 3300005719 | Ga0068861_101312261 | Ga0068861_1013122612 | 115 |
| 446 | 3300005834 | Ga0068851_10004503 | Ga0068851_100045033 | 115 |
| 447 | 3300005834 | Ga0068851_10009674 | Ga0068851_100096742 | 115 |
| 448 | 3300005834 | Ga0068851_10025530 | Ga0068851_100255302 | 115 |
| 449 | 3300005841 | Ga0068863_100003437 | Ga0068863_1000034375 | 115 |
| 450 | 3300005841 | Ga0068863_100057019 | Ga0068863_1000570192 | 115 |
| 451 | 3300005841 | Ga0068863_100131898 | Ga0068863_1001318982 | 115 |
| 452 | 3300005841 | Ga0068863_101085467 | Ga0068863_1010854672 | 115 |
| 453 | 3300005841 | Ga0068863_101576436 | Ga0068863_1015764362 | 115 |
| 454 | 3300005842 | Ga0068858_100004492 | Ga0068858_1000044925 | 115 |
| 455 | 3300005842 | Ga0068858_100005455 | Ga0068858_1000054557 | 115 |
| 456 | 3300005842 | Ga0068858_101289726 | Ga0068858_1012897262 | 115 |
| 457 | 3300005843 | Ga0068860_100008213 | Ga0068860_1000082133 | 115 |
| 458 | 3300005843 | Ga0068860_100043728 | Ga0068860_1000437283 | 115 |
| 459 | 3300005843 | Ga0068860_100147875 | Ga0068860_1001478752 | 115 |
| 460 | 3300005843 | Ga0068860_100640253 | Ga0068860_1006402532 | 115 |
| 461 | 3300005843 | Ga0068860_101247665 | Ga0068860_1012476652 | 115 |
| 462 | 3300005844 | Ga0068862_100258395 | Ga0068862_1002583952 | 115 |
| 463 | 3300005844 | Ga0068862_100666164 | Ga0068862_1006661642 | 115 |
| 464 | 3300006163 | Ga0070715_10578935 | Ga0070715_105789352 | 115 |
| 465 | 3300006173 | Ga0070716_100019244 | Ga0070716_1000192442 | 115 |
| 466 | 3300006173 | Ga0070716_100070153 | Ga0070716_1000701532 | 115 |
| 467 | 3300006175 | Ga0070712_100014681 | Ga0070712_1000146812 | 115 |
| 468 | 3300006175 | Ga0070712_100407616 | Ga0070712_1004076162 | 115 |
| 469 | 3300006237 | Ga0097621_100015171 | Ga0097621_1000151715 | 115 |
| 470 | 3300006237 | Ga0097621_100046162 | Ga0097621_1000461622 | 115 |
| 471 | 3300006237 | Ga0097621_100090046 | Ga0097621_1000900463 | 115 |
| 472 | 3300006237 | Ga0097621_100391017 | Ga0097621_1003910172 | 115 |
| 473 | 3300006358 | Ga0068871_100001041 | Ga0068871_1000010415 | 115 |
| 474 | 3300006358 | Ga0068871_100033591 | Ga0068871_1000335913 | 115 |
| 475 | 3300006358 | Ga0068871_100100279 | Ga0068871_1001002793 | 115 |
| 476 | 3300006358 | Ga0068871_100672595 | Ga0068871_1006725952 | 115 |
| 477 | 3300006844 | Ga0075428_100906408 | Ga0075428_1009064082 | 115 |
| 478 | 3300006852 | Ga0075433_10051439 | Ga0075433_100514394 | 115 |
| 479 | 3300006871 | Ga0075434_100009598 | Ga0075434_1000095988 | 115 |
| 480 | 3300006881 | Ga0068865_100001927 | Ga0068865_1000019272 | 115 |
| 481 | 3300006881 | Ga0068865_100172820 | Ga0068865_1001728202 | 115 |
| 482 | 3300006881 | Ga0068865_100225712 | Ga0068865_1002257122 | 115 |
| 483 | 3300006881 | Ga0068865_100349449 | Ga0068865_1003494492 | 115 |
| 484 | 3300006914 | Ga0075436_100019321 | Ga0075436_1000193214 | 115 |
| 485 | 3300006914 | Ga0075436_100046702 | Ga0075436_1000467022 | 115 |
| 486 | 3300006931 | Ga0097620_100004763 | Ga0097620_1000047633 | 115 |
| 487 | 3300006931 | Ga0097620_100298535 | Ga0097620_1002985352 | 115 |
| 488 | 3300006931 | Ga0097620_101647571 | Ga0097620_1016475711 | 115 |
| 489 | 3300007076 | Ga0075435_100503143 | Ga0075435_1005031432 | 115 |
| 490 | 3300007076 | Ga0075435_100596340 | Ga0075435_1005963402 | 115 |
| 491 | 3300009011 | Ga0105251_10244730 | Ga0105251_102447302 | 115 |
| 492 | 3300009093 | Ga0105240_10105340 | Ga0105240_101053402 | 115 |
| 493 | 3300009098 | Ga0105245_10002094 | Ga0105245_100020942 | 115 |
| 494 | 3300009098 | Ga0105245_10082037 | Ga0105245_100820373 | 115 |
| 495 | 3300009098 | Ga0105245_10106808 | Ga0105245_101068082 | 115 |
| 496 | 3300009098 | Ga0105245_12195210 | Ga0105245_121952102 | 115 |
| 497 | 3300009101 | Ga0105247_10189803 | Ga0105247_101898032 | 115 |
| 498 | 3300009174 | Ga0105241_10028850 | Ga0105241_100288502 | 115 |
| 499 | 3300009174 | Ga0105241_10734094 | Ga0105241_107340942 | 115 |
| 500 | 3300009174 | Ga0105241_11290246 | Ga0105241_112902462 | 115 |
| 501 | 3300009174 | Ga0105241_11310377 | Ga0105241_113103772 | 115 |
| 502 | 3300009176 | Ga0105242_10113265 | Ga0105242_101132652 | 115 |
| 503 | 3300009176 | Ga0105242_10238169 | Ga0105242_102381692 | 115 |
| 504 | 3300009176 | Ga0105242_11094402 | Ga0105242_110944022 | 115 |
| 505 | 3300009177 | Ga0105248_10001701 | Ga0105248_100017017 | 115 |
| 506 | 3300009177 | Ga0105248_11004560 | Ga0105248_110045602 | 115 |
| 507 | 3300009545 | Ga0105237_10069691 | Ga0105237_100696915 | 115 |
| 508 | 3300009545 | Ga0105237_10121692 | Ga0105237_101216923 | 115 |
| 509 | 3300009551 | Ga0105238_10068737 | Ga0105238_100687372 | 115 |
| 510 | 3300009551 | Ga0105238_10193408 | Ga0105238_101934082 | 115 |
| 511 | 3300009551 | Ga0105238_10213369 | Ga0105238_102133692 | 115 |
| 512 | 3300009553 | Ga0105249_10172220 | Ga0105249_101722202 | 115 |
| 513 | 3300009553 | Ga0105249_10977131 | Ga0105249_109771312 | 115 |
| 514 | 3300010375 | Ga0105239_10508872 | Ga0105239_105088722 | 115 |
| 515 | 3300011119 | Ga0105246_10015253 | Ga0105246_100152535 | 115 |
| 516 | 3300011119 | Ga0105246_10343005 | Ga0105246_103430052 | 115 |
| 517 | 3300012492 | Ga0157335_1038528 | Ga0157335_10385282 | 115 |
| 518 | 3300012497 | Ga0157319_1031713 | Ga0157319_10317132 | 115 |
| 519 | 3300013100 | Ga0157373_10132472 | Ga0157373_101324722 | 115 |
| 520 | 3300013100 | Ga0157373_10831315 | Ga0157373_108313152 | 115 |
| 521 | 3300013102 | Ga0157371_10146774 | Ga0157371_101467742 | 115 |
| 522 | 3300013104 | Ga0157370_10054056 | Ga0157370_100540562 | 115 |
| 523 | 3300013105 | Ga0157369_10272367 | Ga0157369_102723672 | 115 |
| 524 | 3300013105 | Ga0157369_11044279 | Ga0157369_110442792 | 115 |
| 525 | 3300013105 | Ga0157369_11605096 | Ga0157369_116050961 | 115 |
| 526 | 3300013296 | Ga0157374_10004890 | Ga0157374_100048902 | 115 |
| 527 | 3300013296 | Ga0157374_10012603 | Ga0157374_100126035 | 115 |
| 528 | 3300013296 | Ga0157374_10029804 | Ga0157374_100298044 | 115 |
| 529 | 3300013297 | Ga0157378_10019423 | Ga0157378_100194232 | 115 |
| 530 | 3300013297 | Ga0157378_10065242 | Ga0157378_100652422 | 115 |
| 531 | 3300013297 | Ga0157378_10484180 | Ga0157378_104841802 | 115 |
| 532 | 3300013306 | Ga0163162_10002112 | Ga0163162_100021122 | 115 |
| 533 | 3300013306 | Ga0163162_10002653 | Ga0163162_100026536 | 115 |
| 534 | 3300013306 | Ga0163162_10118524 | Ga0163162_101185242 | 115 |
| 535 | 3300013307 | Ga0157372_10098133 | Ga0157372_100981332 | 115 |
| 536 | 3300013307 | Ga0157372_10170779 | Ga0157372_101707792 | 115 |
| 537 | 3300013307 | Ga0157372_13098919 | Ga0157372_130989192 | 115 |
| 538 | 3300013308 | Ga0157375_10006548 | Ga0157375_100065484 | 115 |
| 539 | 3300013308 | Ga0157375_10116475 | Ga0157375_101164752 | 115 |
| 540 | 3300013308 | Ga0157375_10457352 | Ga0157375_104573522 | 115 |
| 541 | 3300013308 | Ga0157375_11900538 | Ga0157375_119005382 | 115 |
| 542 | 3300014325 | Ga0163163_12073768 | Ga0163163_120737682 | 115 |
| 543 | 3300014326 | Ga0157380_10650702 | Ga0157380_106507022 | 115 |
| 544 | 3300014326 | Ga0157380_11166477 | Ga0157380_111664772 | 115 |
| 545 | 3300014745 | Ga0157377_10026156 | Ga0157377_100261562 | 115 |
| 546 | 3300014745 | Ga0157377_11743835 | Ga0157377_117438351 | 115 |
| 547 | 3300014968 | Ga0157379_10001106 | Ga0157379_100011062 | 115 |
| 548 | 3300014968 | Ga0157379_10050312 | Ga0157379_100503122 | 115 |
| 549 | 3300014969 | Ga0157376_10001970 | Ga0157376_100019702 | 115 |
| 550 | 3300014969 | Ga0157376_10131535 | Ga0157376_101315352 | 115 |
| 551 | 3300014969 | Ga0157376_10165860 | Ga0157376_101658603 | 115 |
| 552 | 3300014969 | Ga0157376_11790699 | Ga0157376_117906992 | 115 |
| 553 | 3300017792 | Ga0163161_10009441 | Ga0163161_100094412 | 115 |
| 554 | 3300025315 | Ga0207697_10041299 | Ga0207697_100412993 | 115 |
| 555 | 3300025321 | Ga0207656_10017342 | Ga0207656_100173422 | 115 |
| 556 | 3300025321 | Ga0207656_10224135 | Ga0207656_102241351 | 115 |
| 557 | 3300025885 | Ga0207653_10203298 | Ga0207653_102032981 | 115 |
| 558 | 3300025893 | Ga0207682_10291255 | Ga0207682_102912552 | 115 |
| 559 | 3300025898 | Ga0207692_10014177 | Ga0207692_100141772 | 115 |
| 560 | 3300025898 | Ga0207692_10170454 | Ga0207692_101704542 | 115 |
| 561 | 3300025898 | Ga0207692_10851231 | Ga0207692_108512312 | 115 |
| 562 | 3300025899 | Ga0207642_10000974 | Ga0207642_100009742 | 115 |
| 563 | 3300025899 | Ga0207642_10647038 | Ga0207642_106470382 | 115 |
| 564 | 3300025903 | Ga0207680_10001982 | Ga0207680_100019826 | 115 |
| 565 | 3300025903 | Ga0207680_10218988 | Ga0207680_102189882 | 115 |
| 566 | 3300025905 | Ga0207685_10006487 | Ga0207685_100064872 | 115 |
| 567 | 3300025905 | Ga0207685_10632267 | Ga0207685_106322672 | 115 |
| 568 | 3300025906 | Ga0207699_10066559 | Ga0207699_100665592 | 115 |
| 569 | 3300025907 | Ga0207645_10001058 | Ga0207645_1000105820 | 115 |
| 570 | 3300025907 | Ga0207645_10184954 | Ga0207645_101849542 | 115 |
| 571 | 3300025909 | Ga0207705_10078861 | Ga0207705_100788613 | 115 |
| 572 | 3300025910 | Ga0207684_10037844 | Ga0207684_100378442 | 115 |
| 573 | 3300025910 | Ga0207684_10101330 | Ga0207684_101013302 | 115 |
| 574 | 3300025910 | Ga0207684_10106282 | Ga0207684_101062822 | 115 |
| 575 | 3300025911 | Ga0207654_10064933 | Ga0207654_100649332 | 115 |
| 576 | 3300025911 | Ga0207654_10125505 | Ga0207654_101255052 | 115 |
| 577 | 3300025911 | Ga0207654_10311393 | Ga0207654_103113932 | 115 |
| 578 | 3300025912 | Ga0207707_10061036 | Ga0207707_100610362 | 115 |
| 579 | 3300025913 | Ga0207695_10419839 | Ga0207695_104198392 | 115 |
| 580 | 3300025915 | Ga0207693_10002975 | Ga0207693_100029756 | 115 |
| 581 | 3300025915 | Ga0207693_10059619 | Ga0207693_100596193 | 115 |
| 582 | 3300025916 | Ga0207663_10083523 | Ga0207663_100835232 | 115 |
| 583 | 3300025916 | Ga0207663_10599683 | Ga0207663_105996832 | 115 |
| 584 | 3300025916 | Ga0207663_11088797 | Ga0207663_110887972 | 115 |
| 585 | 3300025917 | Ga0207660_10082588 | Ga0207660_100825882 | 115 |
| 586 | 3300025918 | Ga0207662_10080367 | Ga0207662_100803672 | 115 |
| 587 | 3300025919 | Ga0207657_10004934 | Ga0207657_100049342 | 115 |
| 588 | 3300025919 | Ga0207657_11090432 | Ga0207657_110904322 | 115 |
| 589 | 3300025920 | Ga0207649_10368293 | Ga0207649_103682932 | 115 |
| 590 | 3300025921 | Ga0207652_10111575 | Ga0207652_101115752 | 115 |
| 591 | 3300025922 | Ga0207646_10017711 | Ga0207646_100177114 | 115 |
| 592 | 3300025922 | Ga0207646_10038017 | Ga0207646_100380172 | 115 |
| 593 | 3300025922 | Ga0207646_10118233 | Ga0207646_101182332 | 115 |
| 594 | 3300025922 | Ga0207646_10620375 | Ga0207646_106203752 | 115 |
| 595 | 3300025923 | Ga0207681_10009784 | Ga0207681_100097846 | 115 |
| 596 | 3300025923 | Ga0207681_10115981 | Ga0207681_101159812 | 115 |
| 597 | 3300025923 | Ga0207681_10619399 | Ga0207681_106193992 | 115 |
| 598 | 3300025924 | Ga0207694_10082798 | Ga0207694_100827982 | 115 |
| 599 | 3300025924 | Ga0207694_10360232 | Ga0207694_103602322 | 115 |
| 600 | 3300025925 | Ga0207650_10021570 | Ga0207650_100215704 | 115 |
| 601 | 3300025925 | Ga0207650_10028783 | Ga0207650_100287833 | 115 |
| 602 | 3300025925 | Ga0207650_10034275 | Ga0207650_100342752 | 115 |
| 603 | 3300025925 | Ga0207650_10185592 | Ga0207650_101855922 | 115 |
| 604 | 3300025925 | Ga0207650_10230724 | Ga0207650_102307243 | 115 |
| 605 | 3300025925 | Ga0207650_10255416 | Ga0207650_102554161 | 115 |
| 606 | 3300025925 | Ga0207650_10885078 | Ga0207650_108850782 | 115 |
| 607 | 3300025926 | Ga0207659_10000739 | Ga0207659_100007396 | 115 |
| 608 | 3300025926 | Ga0207659_10279706 | Ga0207659_102797062 | 115 |
| 609 | 3300025927 | Ga0207687_10023872 | Ga0207687_100238722 | 115 |
| 610 | 3300025927 | Ga0207687_10024630 | Ga0207687_100246302 | 115 |
| 611 | 3300025927 | Ga0207687_10480488 | Ga0207687_104804882 | 115 |
| 612 | 3300025928 | Ga0207700_10075216 | Ga0207700_100752162 | 115 |
| 613 | 3300025928 | Ga0207700_10106194 | Ga0207700_101061942 | 115 |
| 614 | 3300025931 | Ga0207644_10004900 | Ga0207644_100049002 | 115 |
| 615 | 3300025931 | Ga0207644_10040621 | Ga0207644_100406213 | 115 |
| 616 | 3300025931 | Ga0207644_10043560 | Ga0207644_100435603 | 115 |
| 617 | 3300025931 | Ga0207644_11279485 | Ga0207644_112794852 | 115 |
| 618 | 3300025931 | Ga0207644_11354346 | Ga0207644_113543462 | 115 |
| 619 | 3300025932 | Ga0207690_10153753 | Ga0207690_101537532 | 115 |
| 620 | 3300025932 | Ga0207690_10607480 | Ga0207690_106074802 | 115 |
| 621 | 3300025933 | Ga0207706_10099578 | Ga0207706_100995782 | 115 |
| 622 | 3300025933 | Ga0207706_10553112 | Ga0207706_105531122 | 115 |
| 623 | 3300025933 | Ga0207706_10966485 | Ga0207706_109664852 | 115 |
| 624 | 3300025934 | Ga0207686_10000315 | Ga0207686_1000031518 | 115 |
| 625 | 3300025934 | Ga0207686_10355449 | Ga0207686_103554492 | 115 |
| 626 | 3300025935 | Ga0207709_10777763 | Ga0207709_107777632 | 115 |
| 627 | 3300025936 | Ga0207670_10007822 | Ga0207670_100078222 | 115 |
| 628 | 3300025936 | Ga0207670_10129703 | Ga0207670_101297032 | 115 |
| 629 | 3300025937 | Ga0207669_10040819 | Ga0207669_100408192 | 115 |
| 630 | 3300025937 | Ga0207669_10056737 | Ga0207669_100567373 | 115 |
| 631 | 3300025938 | Ga0207704_10001306 | Ga0207704_100013064 | 115 |
| 632 | 3300025938 | Ga0207704_10289057 | Ga0207704_102890572 | 115 |
| 633 | 3300025938 | Ga0207704_10395589 | Ga0207704_103955892 | 115 |
| 634 | 3300025938 | Ga0207704_10622089 | Ga0207704_106220892 | 115 |
| 635 | 3300025939 | Ga0207665_10013218 | Ga0207665_100132182 | 115 |
| 636 | 3300025939 | Ga0207665_10017508 | Ga0207665_100175084 | 115 |
| 637 | 3300025940 | Ga0207691_10000041 | Ga0207691_1000004168 | 115 |
| 638 | 3300025940 | Ga0207691_10298931 | Ga0207691_102989312 | 115 |
| 639 | 3300025940 | Ga0207691_10372734 | Ga0207691_103727342 | 115 |
| 640 | 3300025941 | Ga0207711_10000934 | Ga0207711_100009342 | 115 |
| 641 | 3300025941 | Ga0207711_10001347 | Ga0207711_100013476 | 115 |
| 642 | 3300025942 | Ga0207689_10003613 | Ga0207689_100036134 | 115 |
| 643 | 3300025942 | Ga0207689_10044332 | Ga0207689_100443322 | 115 |
| 644 | 3300025942 | Ga0207689_10049582 | Ga0207689_100495822 | 115 |
| 645 | 3300025942 | Ga0207689_10079763 | Ga0207689_100797632 | 115 |
| 646 | 3300025944 | Ga0207661_10181883 | Ga0207661_101818832 | 115 |
| 647 | 3300025945 | Ga0207679_10030361 | Ga0207679_100303612 | 115 |
| 648 | 3300025945 | Ga0207679_10405293 | Ga0207679_104052932 | 115 |
| 649 | 3300025945 | Ga0207679_11264173 | Ga0207679_112641732 | 115 |
| 650 | 3300025949 | Ga0207667_10150534 | Ga0207667_101505342 | 115 |
| 651 | 3300025949 | Ga0207667_10530075 | Ga0207667_105300752 | 115 |
| 652 | 3300025960 | Ga0207651_10002868 | Ga0207651_100028686 | 115 |
| 653 | 3300025960 | Ga0207651_10008943 | Ga0207651_100089435 | 115 |
| 654 | 3300025961 | Ga0207712_10117167 | Ga0207712_101171672 | 115 |
| 655 | 3300025961 | Ga0207712_10313564 | Ga0207712_103135642 | 115 |
| 656 | 3300025972 | Ga0207668_10022678 | Ga0207668_100226783 | 115 |
| 657 | 3300025972 | Ga0207668_10067191 | Ga0207668_100671912 | 115 |
| 658 | 3300025981 | Ga0207640_10097190 | Ga0207640_100971902 | 115 |
| 659 | 3300025981 | Ga0207640_10149059 | Ga0207640_101490592 | 115 |
| 660 | 3300025981 | Ga0207640_10226403 | Ga0207640_102264032 | 115 |
| 661 | 3300025986 | Ga0207658_10007536 | Ga0207658_100075362 | 115 |
| 662 | 3300025986 | Ga0207658_10011830 | Ga0207658_100118305 | 115 |
| 663 | 3300025986 | Ga0207658_10222288 | Ga0207658_102222882 | 115 |
| 664 | 3300025986 | Ga0207658_10674105 | Ga0207658_106741052 | 115 |
| 665 | 3300026023 | Ga0207677_10000112 | Ga0207677_1000011240 | 115 |
| 666 | 3300026023 | Ga0207677_10000232 | Ga0207677_1000023212 | 115 |
| 667 | 3300026023 | Ga0207677_10003482 | Ga0207677_100034822 | 115 |
| 668 | 3300026023 | Ga0207677_10004436 | Ga0207677_100044365 | 115 |
| 669 | 3300026023 | Ga0207677_10884018 | Ga0207677_108840182 | 115 |
| 670 | 3300026035 | Ga0207703_10004690 | Ga0207703_100046902 | 115 |
| 671 | 3300026035 | Ga0207703_10010253 | Ga0207703_100102533 | 115 |
| 672 | 3300026035 | Ga0207703_10490667 | Ga0207703_104906672 | 115 |
| 673 | 3300026041 | Ga0207639_10047156 | Ga0207639_100471564 | 115 |
| 674 | 3300026041 | Ga0207639_10236768 | Ga0207639_102367682 | 115 |
| 675 | 3300026041 | Ga0207639_11128705 | Ga0207639_111287052 | 115 |
| 676 | 3300026067 | Ga0207678_10124494 | Ga0207678_101244943 | 115 |
| 677 | 3300026067 | Ga0207678_10169095 | Ga0207678_101690952 | 115 |
| 678 | 3300026067 | Ga0207678_10235436 | Ga0207678_102354362 | 115 |
| 679 | 3300026078 | Ga0207702_10071215 | Ga0207702_100712152 | 115 |
| 680 | 3300026078 | Ga0207702_10181329 | Ga0207702_101813292 | 115 |
| 681 | 3300026078 | Ga0207702_10391842 | Ga0207702_103918422 | 115 |
| 682 | 3300026078 | Ga0207702_11230919 | Ga0207702_112309191 | 115 |
| 683 | 3300026078 | Ga0207702_11472166 | Ga0207702_114721661 | 115 |
| 684 | 3300026088 | Ga0207641_10009275 | Ga0207641_100092752 | 115 |
| 685 | 3300026088 | Ga0207641_10192991 | Ga0207641_101929912 | 115 |
| 686 | 3300026088 | Ga0207641_10307698 | Ga0207641_103076982 | 115 |
| 687 | 3300026089 | Ga0207648_10000601 | Ga0207648_1000060115 | 115 |
| 688 | 3300026089 | Ga0207648_10333556 | Ga0207648_103335562 | 115 |
| 689 | 3300026089 | Ga0207648_10540499 | Ga0207648_105404992 | 115 |
| 690 | 3300026089 | Ga0207648_11378201 | Ga0207648_113782012 | 115 |
| 691 | 3300026095 | Ga0207676_10001973 | Ga0207676_100019735 | 115 |
| 692 | 3300026095 | Ga0207676_10005593 | Ga0207676_100055932 | 115 |
| 693 | 3300026095 | Ga0207676_10743469 | Ga0207676_107434692 | 115 |
| 694 | 3300026116 | Ga0207674_10028821 | Ga0207674_100288212 | 115 |
| 695 | 3300026116 | Ga0207674_11292503 | Ga0207674_112925032 | 115 |
| 696 | 3300026118 | Ga0207675_100023855 | Ga0207675_1000238552 | 115 |
| 697 | 3300026118 | Ga0207675_100065421 | Ga0207675_1000654212 | 115 |
| 698 | 3300026118 | Ga0207675_100949358 | Ga0207675_1009493582 | 115 |
| 699 | 3300026121 | Ga0207683_10000011 | Ga0207683_1000001149 | 115 |
| 700 | 3300026121 | Ga0207683_10001380 | Ga0207683_1000138019 | 115 |
| 701 | 3300026121 | Ga0207683_10932688 | Ga0207683_109326881 | 115 |
| 702 | 3300026142 | Ga0207698_10146733 | Ga0207698_101467332 | 115 |
| 703 | 3300026142 | Ga0207698_12177500 | Ga0207698_121775002 | 115 |
| 704 | 3300028379 | Ga0268266_10022303 | Ga0268266_100223033 | 115 |
| 705 | 3300028379 | Ga0268266_10041420 | Ga0268266_100414202 | 115 |
| 706 | 3300028379 | Ga0268266_10356093 | Ga0268266_103560932 | 115 |
| 707 | 3300028380 | Ga0268265_10037462 | Ga0268265_100374622 | 115 |
| 708 | 3300028380 | Ga0268265_10313581 | Ga0268265_103135812 | 115 |
| 709 | 3300028381 | Ga0268264_10001396 | Ga0268264_100013969 | 115 |
| 710 | 3300028381 | Ga0268264_10048228 | Ga0268264_100482282 | 115 |
| 711 | 3300028381 | Ga0268264_10736117 | Ga0268264_107361172 | 115 |
| 712 | 3300035083 | Ga0373926_0036616 | Ga0373926_0036616_1066_1416 | 115 |
| 713 | 3300035084 | Ga0373928_0260454 | Ga0373928_0260454_124_474 | 115 |
| 714 | 3300035086 | Ga0373934_0015891 | Ga0373934_0015891_743_1093 | 115 |
| 715 | 3300035091 | Ga0373951_0140500 | Ga0373951_0140500_284_634 | 115 |
| 716 | 3300035111 | Ga0373923_0011822 | Ga0373923_0011822_2835_3185 | 115 |
| 717 | 3300035116 | Ga0373945_0007255 | Ga0373945_0007255_1143_1490 | 115 |
| 718 | 3300035116 | Ga0373945_0091816 | Ga0373945_0091816_809_1159 | 115 |
| 719 | 3300035118 | Ga0373954_0001619 | Ga0373954_0001619_1831_2181 | 115 |
| 720 | 3300035119 | Ga0373956_0009565 | Ga0373956_0009565_1137_1487 | 115 |
| 721 | 3300035120 | Ga0373957_0098387 | Ga0373957_0098387_174_521 | 115 |
| 722 | 3300035170 | Ga0373943_0007593 | Ga0373943_0007593_1981_2331 | 115 |
| 723 | 3300035170 | Ga0373943_0154262 | Ga0373943_0154262_208_555 | 115 |
| 724 | 3300035171 | Ga0373946_0052500 | Ga0373946_0052500_412_762 | 115 |
| 725 | 3300035171 | Ga0373946_0084357 | Ga0373946_0084357_701_1048 | 115 |
| 726 | 3300035172 | Ga0373955_0049502 | Ga0373955_0049502_737_1087 | 115 |
| 727 | 3300035172 | Ga0373955_0362219 | Ga0373955_0362219_515_862 | 115 |
| 728 | 3300035242 | Ga0373962_0182455 | Ga0373962_0182455_193_543 | 115 |
| 729 | 3300035410 | Ga0373924_0008951 | Ga0373924_0008951_1625_1975 | 115 |
| 730 | 3300035410 | Ga0373924_0209304 | Ga0373924_0209304_325_675 | 115 |
| 731 | 3300035410 | Ga0373924_0249169 | Ga0373924_0249169_139_486 | 115 |
| 732 | 3300035691 | Ga0373931_0151210 | Ga0373931_0151210_382_732 | 115 |
| 733 | 3300035692 | Ga0373935_0026452 | Ga0373935_0026452_1066_1416 | 115 |
| 734 | 3300035692 | Ga0373935_0094455 | Ga0373935_0094455_1128_1475 | 115 |
| 735 | 3300035692 | Ga0373935_0257832 | Ga0373935_0257832_218_565 | 115 |
| 736 | 3300035692 | Ga0373935_0479087 | Ga0373935_0479087_380_730 | 115 |
| 737 | 3300035692 | Ga0373935_0867380 | Ga0373935_0867380_21_368 | 115 |
| 738 | 3300035695 | Ga0373927_0006222 | Ga0373927_0006222_3583_3930 | 115 |
| 739 | 3300035695 | Ga0373927_0031549 | Ga0373927_0031549_2500_2850 | 115 |
| 740 | 3300035695 | Ga0373927_0080199 | Ga0373927_0080199_1073_1420 | 115 |
| 741 | 3300035695 | Ga0373927_0133697 | Ga0373927_0133697_758_1105 | 115 |
| 742 | 3300035695 | Ga0373927_0309310 | Ga0373927_0309310_426_773 | 115 |
| 743 | 3300035724 | Ga0373933_0045591 | Ga0373933_0045591_1692_2042 | 115 |
| 744 | 3300035725 | Ga0373947_0003277 | Ga0373947_0003277_6264_6611 | 115 |
| 745 | 3300035725 | Ga0373947_0016537 | Ga0373947_0016537_59_409 | 115 |
| 746 | 3300035725 | Ga0373947_0349811 | Ga0373947_0349811_397_747 | 115 |
| 747 | 3300035725 | Ga0373947_0549110 | Ga0373947_0549110_27_374 | 115 |
| 748 | 3300036401 | Ga0373937_0006916 | Ga0373937_0006916_1059_1406 | 115 |
| 749 | 3300036401 | Ga0373937_0234752 | Ga0373937_0234752_28_375 | 115 |
| 750 | 3300036401 | Ga0373937_0298820 | Ga0373937_0298820_11_361 | 115 |
| 751 | 3300036401 | Ga0373937_0828763 | Ga0373937_0828763_407_754 | 115 |
| 752 | 3300036401 | Ga0373937_0969690 | Ga0373937_0969690_145_492 | 115 |
| 753 | 3300037068 | Ga0373925_0021569 | Ga0373925_0021569_3168_3515 | 115 |
| 754 | 3300037068 | Ga0373925_0057184 | Ga0373925_0057184_537_884 | 115 |
| 755 | 3300037068 | Ga0373925_0244101 | Ga0373925_0244101_876_1223 | 115 |
| 756 | 3300037068 | Ga0373925_0249700 | Ga0373925_0249700_890_1240 | 115 |
| 757 | 3300041492 | Ga0451835_1159940 | Ga0451835_1159940_160_510 | 115 |
| 758 | 3300046454 | Ga0495592_0813422 | Ga0495592_0813422_52_402 | 115 |
| 759 | 3300046459 | Ga0495629_0012122 | Ga0495629_0012122_2916_3263 | 115 |
| 760 | 3300046462 | Ga0495651_0060828 | Ga0495651_0060828_1157_1504 | 115 |
| 761 | 3300046463 | Ga0495653_0063020 | Ga0495653_0063020_1605_1952 | 115 |
| 762 | 3300046472 | Ga0495580_0008291 | Ga0495580_0008291_6472_6819 | 115 |
| 763 | 3300046472 | Ga0495580_0063574 | Ga0495580_0063574_1753_2100 | 115 |
| 764 | 3300046472 | Ga0495580_0099455 | Ga0495580_0099455_59_409 | 115 |
| 765 | 3300046475 | Ga0495639_0018538 | Ga0495639_0018538_1422_1769 | 115 |
| 766 | 3300046477 | Ga0495664_0001368 | Ga0495664_0001368_7823_8170 | 115 |
| 767 | 3300046511 | Ga0495608_0084344 | Ga0495608_0084344_277_627 | 115 |
| 768 | 3300046516 | Ga0495628_0048104 | Ga0495628_0048104_1508_1855 | 115 |
| 769 | 3300046517 | Ga0495630_0147262 | Ga0495630_0147262_1064_1414 | 115 |
| 770 | 3300046517 | Ga0495630_0530143 | Ga0495630_0530143_237_584 | 115 |
| 771 | 3300046525 | Ga0495663_0391655 | Ga0495663_0391655_62_409 | 115 |
| 772 | 3300046528 | Ga0495642_0232570 | Ga0495642_0232570_156_509 | 115 |
| 773 | 3300046531 | Ga0495665_0128445 | Ga0495665_0128445_625_975 | 115 |
| 774 | 3300046536 | Ga0495587_0085390 | Ga0495587_0085390_1229_1579 | 115 |
| 775 | 3300046539 | Ga0495621_0080875 | Ga0495621_0080875_682_1029 | 115 |
| 776 | 3300046543 | Ga0495645_0018538 | Ga0495645_0018538_3083_3430 | 115 |
| 777 | 3300046543 | Ga0495645_0078781 | Ga0495645_0078781_459_809 | 115 |
| 778 | 3300046559 | Ga0495667_0099190 | Ga0495667_0099190_15_362 | 115 |
| 779 | 3300046642 | Ga0495634_0328463 | Ga0495634_0328463_218_565 | 115 |
| 780 | 3300046663 | Ga0495635_0004423 | Ga0495635_0004423_9165_9512 | 115 |
| 781 | 3300046663 | Ga0495635_0034435 | Ga0495635_0034435_30_377 | 115 |
| 782 | 3300046663 | Ga0495635_0087081 | Ga0495635_0087081_1596_1946 | 115 |
| 783 | 3300046675 | Ga0495657_0069280 | Ga0495657_0069280_750_1100 | 115 |
| 784 | 3300046678 | Ga0495599_0060718 | Ga0495599_0060718_866_1216 | 115 |
| 785 | 3300046679 | Ga0495623_0065629 | Ga0495623_0065629_1752_2102 | 115 |
| 786 | 3300046680 | Ga0495646_0199259 | Ga0495646_0199259_36_386 | 115 |
| 787 | 3300046681 | Ga0495647_0001693 | Ga0495647_0001693_3763_4110 | 115 |
| 788 | 3300046681 | Ga0495647_0008363 | Ga0495647_0008363_92_439 | 115 |
| 789 | 3300046689 | Ga0495613_0005266 | Ga0495613_0005266_9021_9368 | 115 |
| 790 | 3300046690 | Ga0495624_0117773 | Ga0495624_0117773_1143_1490 | 115 |
| 791 | 3300046809 | Ga0495600_0007268 | Ga0495600_0007268_4799_5146 | 115 |
| 792 | 3300047315 | Ga0495581_0431839 | Ga0495581_0431839_372_722 | 115 |
| 793 | 3300047317 | Ga0495604_0108186 | Ga0495604_0108186_1666_2016 | 115 |
| 794 | 3300047318 | Ga0495636_0388524 | Ga0495636_0388524_44_403 | 115 |
| 795 | 3300047319 | Ga0495674_0523878 | Ga0495674_0523878_353_703 | 115 |
| 796 | 3300047322 | Ga0495680_0037844 | Ga0495680_0037844_1835_2182 | 115 |
| 797 | 3300047444 | Ga0495675_0097950 | Ga0495675_0097950_101_451 | 115 |
| 798 | 3300047471 | Ga0495684_0003986 | Ga0495684_0003986_144_491 | 115 |
| 799 | 3300047471 | Ga0495684_0127643 | Ga0495684_0127643_1288_1638 | 115 |
| 800 | 3300048904 | Ga0496101_0114222 | Ga0496101_0114222_535_885 | 115 |
| 801 | 3300048904 | Ga0496101_0198031 | Ga0496101_0198031_111_458 | 115 |
| 802 | 3300048904 | Ga0496101_1632892 | Ga0496101_1632892_121_471 | 115 |
| 803 | 3300048905 | Ga0496102_0117571 | Ga0496102_0117571_1238_1588 | 115 |
| 804 | 3300048906 | Ga0496103_0372255 | Ga0496103_0372255_454_804 | 115 |
| 805 | 3300048907 | Ga0496104_0005138 | Ga0496104_0005138_2781_3131 | 115 |
| 806 | 3300048908 | Ga0496105_0102754 | Ga0496105_0102754_150_500 | 115 |
| 807 | 3300048908 | Ga0496105_0303123 | Ga0496105_0303123_853_1203 | 115 |
| 808 | 3300048909 | Ga0496106_0082298 | Ga0496106_0082298_1711_2061 | 115 |
| 809 | 3300048909 | Ga0496106_0538310 | Ga0496106_0538310_220_567 | 115 |
| 810 | 3300048910 | Ga0496107_0100631 | Ga0496107_0100631_1004_1354 | 115 |
| 811 | 3300048911 | Ga0496108_0592699 | Ga0496108_0592699_33_380 | 115 |
| 812 | 3300048912 | Ga0496109_0015328 | Ga0496109_0015328_3164_3514 | 115 |
| 813 | 3300048912 | Ga0496109_0209102 | Ga0496109_0209102_725_1072 | 115 |
| 814 | 3300048913 | Ga0496110_0203925 | Ga0496110_0203925_1058_1408 | 115 |
| 815 | 3300048913 | Ga0496110_0335575 | Ga0496110_0335575_262_609 | 115 |
| 816 | 3300048914 | Ga0496111_0096310 | Ga0496111_0096310_1765_2115 | 115 |
| 817 | 3300048915 | Ga0496112_0023091 | Ga0496112_0023091_2525_2875 | 115 |
| 818 | 3300048915 | Ga0496112_0402385 | Ga0496112_0402385_334_684 | 115 |
| 819 | 3300048917 | Ga0496114_0398708 | Ga0496114_0398708_551_901 | 115 |
| 820 | 3300048918 | Ga0496115_0115084 | Ga0496115_0115084_1526_1876 | 115 |
| 821 | 3300048918 | Ga0496115_0644781 | Ga0496115_0644781_165_515 | 115 |
| 822 | 3300050512 | nmdc:mga0n895_63697_c1 | nmdc:mga0n895_63697_c1_2305_2664 | 115 |
| 823 | 3300050514 | nmdc:mga08x19_230358_c1 | nmdc:mga08x19_230358_c1_818_1177 | 115 |
| 824 | 3300050515 | nmdc:mga0a205_438124_c1 | nmdc:mga0a205_438124_c1_577_936 | 115 |
| 825 | 3300053077 | Ga0495601_0068845 | Ga0495601_0068845_38_385 | 115 |
| 826 | 3300053078 | Ga0495612_0026148 | Ga0495612_0026148_861_1211 | 115 |
| 827 | 3300053084 | Ga0495595_0450360 | Ga0495595_0450360_37_384 | 115 |
| 828 | 3300053085 | Ga0495619_0004347 | Ga0495619_0004347_1538_1885 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7c1i-assembly2.cif.gz_E | crystal structure of histidine-containing phosphotransfer protein b (hptb) from pseudomonas aeruginosa pao1 | 0.9004 | 2 | 114 |
| 1qsp-assembly2.cif.gz_B | crystal structure of the yeast phosphorelay protein ypd1 | 0.8992 | 5 | 83 |
| 1oxk-assembly1.cif.gz_A | complex between ypd1 and sln1 response regulator domain in space group p3(2) | 0.8927 | 5 | 83 |
| 5kbx-assembly1.cif.gz_A | co-crystal structure of the saccharomyces cerevisiae histidine phosphotransfer signaling protein ypd1 and the receiver domain of its downstream response regulator ssk1 | 0.8845 | 5 | 83 |
| 1c02-assembly1.cif.gz_B | crystal structure of yeast ypd1p | 0.8539 | 1 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39453_805_912_1.20.120.160 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.9102 | 5 | 114 | 1.20.120.160 |
| 5kbxA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.8843 | 5 | 83 | 1.20.120.160 |
| af_Q54RR8_9_125_1.20.120.160 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.8782 | 1 | 114 | 1.20.120.160 |
| af_Q59WC6_9_184_1.20.120.160 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.8673 | 5 | 83 | 1.20.120.160 |
| af_Q54RR8_9_125_1.20.120.160 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.857 | 1 | 114 | 1.20.120.160 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537A203-F1-model_v4 | Hpt domain-containing protein | 0.9611 | 1 | 115 |
GO:0000160
GO:0004672 |
| AF-A0A363U2T6-F1-model_v4 | Histidine kinase | 0.954 | 4 | 113 |
GO:0000160
GO:0016301 |
| AF-A0A0Q6WMZ3-F1-model_v4 | HPt domain-containing protein | 0.9533 | 5 | 115 |
GO:0000160
GO:0004672 |
| AF-A0A363TDN0-F1-model_v4 | HPt domain-containing protein | 0.9517 | 1 | 113 |
GO:0000160
|
| AF-A0A2W5F749-F1-model_v4 | HPt domain-containing protein | 0.9508 | 1 | 115 |
GO:0000160
GO:0004672 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar