F482542

General Info

Members Datasets Scaffolds Average Seq Length
828 279 828 115

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10071448|Ga0070658_100714482
Length 132
Sequence MSSSQHSTSRNNAEKDEMAQPTIDQTTFDELKETAGAEFVGELVDTFLGEAPAMLDELRRSLDAGDADRFRRAAHSLKSNSHTFGAMTLGAMARELELGGIASVRNAGAAPLDALTTEYSRVAAALTALKNA

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
103 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
212 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
213 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 3.38
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10018002 3300001991 Bacteria 1331
2 Ga0065715_10162868 3300005293 Bacteria 1613
3 Ga0065715_10274298 3300005293 Bacteria 1103
4 Ga0070658_10071448 3300005327 Bacteria 2843
5 Ga0070676_10000349 3300005328 Bacteria 21146
6 Ga0070676_10440632 3300005328 Bacteria 914
7 Ga0070676_10450540 3300005328 Bacteria 905
8 Ga0070676_10601232 3300005328 Bacteria 793
9 Ga0070683_100026175 3300005329 Bacteria 5249
10 Ga0070683_100348861 3300005329 Bacteria 1409
11 Ga0070690_100007721 3300005330 Bacteria 6167
12 Ga0070690_100009894 3300005330 Bacteria 5531
13 Ga0070690_100562678 3300005330 Bacteria 861
14 Ga0070670_100006222 3300005331 Bacteria 10096
15 Ga0070670_100023428 3300005331 Bacteria 5314
16 Ga0070670_100033631 3300005331 Bacteria 4416
17 Ga0070670_100045157 3300005331 Bacteria 3787
18 Ga0070670_100080500 3300005331 Bacteria 2799
19 Ga0070670_100179110 3300005331 Bacteria 1840
20 Ga0070670_100364209 3300005331 Bacteria 1272
21 Ga0070670_101041813 3300005331 Bacteria 745
22 Ga0070670_101499920 3300005331 Bacteria 619
23 Ga0070677_10134529 3300005333 Bacteria 1133
24 Ga0070677_10138047 3300005333 Bacteria 1121
25 Ga0070677_10162955 3300005333 Bacteria 1048
26 Ga0070677_10592129 3300005333 Bacteria 613
27 Ga0068869_100004464 3300005334 Bacteria 8699
28 Ga0068869_100014013 3300005334 Bacteria 5348
29 Ga0068869_100022675 3300005334 Bacteria 4329
30 Ga0068869_100287042 3300005334 Bacteria 1325
31 Ga0068869_100345635 3300005334 Bacteria 1211
32 Ga0068869_100499826 3300005334 Bacteria 1015
33 Ga0068869_100835847 3300005334 Bacteria 793
34 Ga0070666_10002690 3300005335 Bacteria 10723
35 Ga0070666_11128251 3300005335 Bacteria 583
36 Ga0070682_100338523 3300005337 Bacteria 1118
37 Ga0068868_100028854 3300005338 Bacteria 4246
38 Ga0068868_100080132 3300005338 Bacteria 2616
39 Ga0068868_100148605 3300005338 Bacteria 1928
40 Ga0068868_100221540 3300005338 Bacteria 1584
41 Ga0068868_100277865 3300005338 Bacteria 1417
42 Ga0068868_100299338 3300005338 Bacteria 1366
43 Ga0068868_100502025 3300005338 Bacteria 1063
44 Ga0070660_100274962 3300005339 Bacteria 1377
45 Ga0070689_100039446 3300005340 Bacteria 3616
46 Ga0070689_100053248 3300005340 Bacteria 3131
47 Ga0070691_10026265 3300005341 Bacteria 2714
48 Ga0070691_10180114 3300005341 Bacteria 1100
49 Ga0070687_100204325 3300005343 Bacteria 1199
50 Ga0070687_100663840 3300005343 Bacteria 724
51 Ga0070661_100018929 3300005344 Bacteria 4903
52 Ga0070661_100093927 3300005344 Bacteria 2222
53 Ga0070661_101431450 3300005344 Bacteria 582
54 Ga0070692_10503040 3300005345 Bacteria 786
55 Ga0070668_100004358 3300005347 Bacteria 10499
56 Ga0070668_100004660 3300005347 Bacteria 10158
57 Ga0070668_100166973 3300005347 Bacteria 1789
58 Ga0070668_100248223 3300005347 Bacteria 1476
59 Ga0070669_100001355 3300005353 Bacteria 17636
60 Ga0070669_100081074 3300005353 Bacteria 2416
61 Ga0070669_100416313 3300005353 Bacteria 1102
62 Ga0070669_100700816 3300005353 Bacteria 855
63 Ga0070669_101158564 3300005353 Bacteria 667
64 Ga0070669_101524307 3300005353 Bacteria 581
65 Ga0070675_100004937 3300005354 Bacteria 10172
66 Ga0070675_100006916 3300005354 Bacteria 8709
67 Ga0070675_100010885 3300005354 Bacteria 7115
68 Ga0070675_100605760 3300005354 Bacteria 994
69 Ga0070675_101243166 3300005354 Bacteria 686
70 Ga0070671_100006007 3300005355 Bacteria 9676
71 Ga0070671_100043601 3300005355 Bacteria 3728
72 Ga0070671_100057656 3300005355 Bacteria 3232
73 Ga0070671_100152775 3300005355 Bacteria 1950
74 Ga0070671_100178282 3300005355 Bacteria 1798
75 Ga0070671_101411866 3300005355 Bacteria 615
76 Ga0070671_101597486 3300005355 Bacteria 578
77 Ga0070674_100024685 3300005356 Bacteria 3905
78 Ga0070674_100027999 3300005356 Bacteria 3698
79 Ga0070674_100312655 3300005356 Bacteria 1256
80 Ga0070674_100558454 3300005356 Bacteria 962
81 Ga0070673_100002494 3300005364 Bacteria 11228
82 Ga0070673_100007378 3300005364 Bacteria 7245
83 Ga0070673_100010065 3300005364 Bacteria 6384
84 Ga0070673_100213008 3300005364 Bacteria 1669
85 Ga0070673_100769326 3300005364 Bacteria 887
86 Ga0070673_100886824 3300005364 Bacteria 827
87 Ga0070688_100003186 3300005365 Bacteria 8407
88 Ga0070688_100031098 3300005365 Bacteria 3209
89 Ga0070688_101000563 3300005365 Bacteria 664
90 Ga0070659_100226456 3300005366 Bacteria 1544
91 Ga0070659_101158084 3300005366 Bacteria 683
92 Ga0070667_100003589 3300005367 Bacteria 13206
93 Ga0070667_100011330 3300005367 Bacteria 7375
94 Ga0070667_100093357 3300005367 Bacteria 2591
95 Ga0070667_100191955 3300005367 Bacteria 1810
96 Ga0070667_100226560 3300005367 Bacteria 1665
97 Ga0070667_100911236 3300005367 Bacteria 818
98 Ga0070667_101451928 3300005367 Bacteria 644
99 Ga0070667_101507323 3300005367 Bacteria 631
100 Ga0070667_101592799 3300005367 Bacteria 614
101 Ga0070703_10327459 3300005406 Bacteria 647
102 Ga0070709_10399805 3300005434 Bacteria 1025
103 Ga0070709_10461027 3300005434 Bacteria 959
104 Ga0070713_100018564 3300005436 Bacteria 5286
105 Ga0070713_100034755 3300005436 Bacteria 4053
106 Ga0070710_10071601 3300005437 Bacteria 2000
107 Ga0070701_10285146 3300005438 Bacteria 1010
108 Ga0070701_10948080 3300005438 Bacteria 597
109 Ga0070711_100127872 3300005439 Bacteria 1888
110 Ga0070711_100152100 3300005439 Bacteria 1746
111 Ga0070711_100158359 3300005439 Bacteria 1714
112 Ga0070711_101871591 3300005439 Bacteria 527
113 Ga0070705_101843414 3300005440 Bacteria 514
114 Ga0070700_100285337 3300005441 Bacteria 1199
115 Ga0070700_101818524 3300005441 Bacteria 525
116 Ga0070694_100046133 3300005444 Bacteria 2924
117 Ga0070694_100104044 3300005444 Bacteria 2012
118 Ga0070694_100343881 3300005444 Bacteria 1154
119 Ga0070708_100061431 3300005445 Bacteria 3356
120 Ga0070708_100607106 3300005445 Bacteria 1031
121 Ga0070663_100062189 3300005455 Bacteria 2690
122 Ga0070663_100525309 3300005455 Bacteria 986
123 Ga0070663_100607662 3300005455 Bacteria 920
124 Ga0070678_100000200 3300005456 Bacteria 26391
125 Ga0070678_100003150 3300005456 Bacteria 9133
126 Ga0070678_100004438 3300005456 Bacteria 7962
127 Ga0070678_101491961 3300005456 Bacteria 633
128 Ga0070662_100004299 3300005457 Bacteria 8994
129 Ga0070662_100093657 3300005457 Bacteria 2260
130 Ga0070662_101234033 3300005457 Bacteria 643
131 Ga0068867_100001816 3300005459 Bacteria 14866
132 Ga0068867_100143599 3300005459 Bacteria 1868
133 Ga0068867_100177915 3300005459 Bacteria 1689
134 Ga0068867_100181723 3300005459 Bacteria 1673
135 Ga0068867_100239919 3300005459 Bacteria 1469
136 Ga0068867_100255407 3300005459 Bacteria 1427
137 Ga0068867_101460794 3300005459 Bacteria 636
138 Ga0068867_101715684 3300005459 Bacteria 589
139 Ga0070685_10002346 3300005466 Bacteria 9760
140 Ga0070685_10048537 3300005466 Bacteria 2445
141 Ga0070685_11126423 3300005466 Bacteria 594
142 Ga0070706_100002177 3300005467 Bacteria 19930
143 Ga0070706_100041664 3300005467 Bacteria 4239
144 Ga0070706_100433500 3300005467 Bacteria 1223
145 Ga0070706_100644013 3300005467 Bacteria 984
146 Ga0070707_100343726 3300005468 Bacteria 1449
147 Ga0070707_100937715 3300005468 Bacteria 830
148 Ga0070698_100242679 3300005471 Bacteria 1735
149 Ga0070698_101261175 3300005471 Bacteria 689
150 Ga0070698_101474148 3300005471 Bacteria 632
151 Ga0070699_100016620 3300005518 Bacteria 6316
152 Ga0070679_100721745 3300005530 Bacteria 939
153 Ga0070679_101026724 3300005530 Bacteria 769
154 Ga0070684_100067833 3300005535 Bacteria 3134
155 Ga0070684_100119444 3300005535 Bacteria 2371
156 Ga0070697_100003955 3300005536 Bacteria 11386
157 Ga0070697_100170785 3300005536 Bacteria 1840
158 Ga0068853_100424614 3300005539 Bacteria 1247
159 Ga0068853_100830807 3300005539 Bacteria 885
160 Ga0068853_101996566 3300005539 Bacteria 562
161 Ga0070672_100002480 3300005543 Bacteria 11730
162 Ga0070672_100003516 3300005543 Bacteria 10157
163 Ga0070672_100006345 3300005543 Bacteria 7939
164 Ga0070672_100042381 3300005543 Bacteria 3504
165 Ga0070672_100126052 3300005543 Bacteria 2100
166 Ga0070672_100219926 3300005543 Bacteria 1593
167 Ga0070672_100605558 3300005543 Bacteria 954
168 Ga0070672_100906554 3300005543 Bacteria 779
169 Ga0070686_100010668 3300005544 Bacteria 5191
170 Ga0070686_100617603 3300005544 Bacteria 856
171 Ga0070695_100066156 3300005545 Bacteria 2355
172 Ga0070695_100343605 3300005545 Bacteria 1116
173 Ga0070696_100029617 3300005546 Bacteria 3743
174 Ga0070696_100092412 3300005546 Bacteria 2156
175 Ga0070696_100391251 3300005546 Bacteria 1085
176 Ga0070693_100003470 3300005547 Bacteria 7360
177 Ga0070693_100051136 3300005547 Bacteria 2365
178 Ga0070665_100001447 3300005548 Bacteria 27820
179 Ga0070665_100010890 3300005548 Bacteria 9200
180 Ga0070665_100156748 3300005548 Bacteria 2279
181 Ga0070665_100221361 3300005548 Bacteria 1893
182 Ga0070704_100919340 3300005549 Bacteria 788
183 Ga0070704_102131119 3300005549 Bacteria 521
184 Ga0068855_100242196 3300005563 Bacteria 2015
185 Ga0068855_100481762 3300005563 Bacteria 1350
186 Ga0070664_100011186 3300005564 Bacteria 7279
187 Ga0070664_100123786 3300005564 Bacteria 2266
188 Ga0070664_100141413 3300005564 Bacteria 2119
189 Ga0070664_100327808 3300005564 Bacteria 1388
190 Ga0070664_101385159 3300005564 Bacteria 665
191 Ga0068857_100060502 3300005577 Bacteria 3364
192 Ga0068857_100536073 3300005577 Bacteria 1101
193 Ga0068857_100809218 3300005577 Bacteria 895
194 Ga0068857_101376830 3300005577 Bacteria 686
195 Ga0068854_100021313 3300005578 Bacteria 4396
196 Ga0068854_100067017 3300005578 Bacteria 2614
197 Ga0068854_100247147 3300005578 Bacteria 1423
198 Ga0068854_100293136 3300005578 Bacteria 1313
199 Ga0068856_100109894 3300005614 Bacteria 2754
200 Ga0068856_100381326 3300005614 Bacteria 1429
201 Ga0068856_100553063 3300005614 Bacteria 1172
202 Ga0068856_100657540 3300005614 Bacteria 1068
203 Ga0068856_101299534 3300005614 Bacteria 743
204 Ga0070702_100089340 3300005615 Bacteria 1865
205 Ga0070702_100141044 3300005615 Bacteria 1535
206 Ga0068852_100002870 3300005616 Bacteria 11950
207 Ga0068852_100236526 3300005616 Bacteria 1744
208 Ga0068852_101583450 3300005616 Bacteria 677
209 Ga0068859_100004763 3300005617 Bacteria 13795
210 Ga0068859_100217140 3300005617 Bacteria 2000
211 Ga0068859_100282454 3300005617 Bacteria 1753
212 Ga0068859_100298536 3300005617 Bacteria 1704
213 Ga0068859_100354840 3300005617 Unclassified 1561
214 Ga0068859_100372233 3300005617 Bacteria 1524
215 Ga0068859_101647599 3300005617 Bacteria 709
216 Ga0068864_100003322 3300005618 Bacteria 13294
217 Ga0068864_100004826 3300005618 Bacteria 11049
218 Ga0068864_100013280 3300005618 Bacteria 6822
219 Ga0068864_100388533 3300005618 Bacteria 1324
220 Ga0068864_100453194 3300005618 Bacteria 1227
221 Ga0068866_10004240 3300005718 Bacteria 5886
222 Ga0068866_10009601 3300005718 Bacteria 4113
223 Ga0068866_10511994 3300005718 Bacteria 796
224 Ga0068866_10559427 3300005718 Bacteria 766
225 Ga0068861_100005340 3300005719 Bacteria 8680
226 Ga0068861_100185450 3300005719 Bacteria 1735
227 Ga0068861_100238683 3300005719 Bacteria 1545
228 Ga0068861_100728712 3300005719 Bacteria 924
229 Ga0068861_101312261 3300005719 Bacteria 704
230 Ga0068861_101501743 3300005719 Bacteria 661
231 Ga0068851_10004503 3300005834 Bacteria 6287
232 Ga0068851_10009674 3300005834 Bacteria 4488
233 Ga0068851_10025530 3300005834 Bacteria 2899
234 Ga0068851_10086276 3300005834 Bacteria 1646
235 Ga0068851_10295793 3300005834 Bacteria 929
236 Ga0068851_10726881 3300005834 Bacteria 613
237 Ga0068870_10190692 3300005840 Bacteria 1236
238 Ga0068863_100003437 3300005841 Bacteria 15608
239 Ga0068863_100057019 3300005841 Bacteria 3697
240 Ga0068863_100131898 3300005841 Bacteria 2386
241 Ga0068863_100256330 3300005841 Bacteria 1690
242 Ga0068863_101085467 3300005841 Bacteria 805
243 Ga0068863_101224542 3300005841 Bacteria 757
244 Ga0068863_101576436 3300005841 Bacteria 666
245 Ga0068858_100004492 3300005842 Bacteria 13669
246 Ga0068858_100005455 3300005842 Bacteria 12452
247 Ga0068858_100098322 3300005842 Bacteria 2729
248 Ga0068858_100157766 3300005842 Bacteria 2135
249 Ga0068858_100292875 3300005842 Bacteria 1552
250 Ga0068858_101289726 3300005842 Bacteria 719
251 Ga0068860_100008213 3300005843 Bacteria 10390
252 Ga0068860_100043728 3300005843 Bacteria 4271
253 Ga0068860_100050725 3300005843 Bacteria 3949
254 Ga0068860_100147875 3300005843 Bacteria 2261
255 Ga0068860_100594344 3300005843 Bacteria 1112
256 Ga0068860_100640253 3300005843 Bacteria 1071
257 Ga0068860_101247665 3300005843 Bacteria 764
258 Ga0068862_100218231 3300005844 Bacteria 1726
259 Ga0068862_100225149 3300005844 Bacteria 1699
260 Ga0068862_100258395 3300005844 Bacteria 1589
261 Ga0068862_100666164 3300005844 Bacteria 1005
262 Ga0068862_102541743 3300005844 Bacteria 524
263 Ga0070715_10204131 3300006163 Bacteria 1006
264 Ga0070715_10578935 3300006163 Bacteria 655
265 Ga0070716_100019244 3300006173 Bacteria 3566
266 Ga0070716_100070153 3300006173 Bacteria 2056
267 Ga0070712_100014681 3300006175 Bacteria 5028
268 Ga0070712_100407616 3300006175 Bacteria 1124
269 Ga0097621_100010446 3300006237 Bacteria 6798
270 Ga0097621_100015171 3300006237 Bacteria 5789
271 Ga0097621_100046162 3300006237 Bacteria 3523
272 Ga0097621_100090046 3300006237 Bacteria 2566
273 Ga0097621_100391017 3300006237 Bacteria 1244
274 Ga0075370_10981170 3300006353 Bacteria 517
275 Ga0068871_100001041 3300006358 Bacteria 18568
276 Ga0068871_100012102 3300006358 Bacteria 6350
277 Ga0068871_100033591 3300006358 Bacteria 4064
278 Ga0068871_100100279 3300006358 Bacteria 2425
279 Ga0068871_100468078 3300006358 Bacteria 1132
280 Ga0068871_100672595 3300006358 Bacteria 947
281 Ga0068871_101496881 3300006358 Bacteria 638
282 Ga0075428_100906408 3300006844 Bacteria 935
283 Ga0075428_102348646 3300006844 Bacteria 548
284 Ga0075433_10051439 3300006852 Bacteria 3587
285 Ga0075434_100009598 3300006871 Bacteria 9034
286 Ga0075434_100367914 3300006871 Bacteria 1459
287 Ga0068865_100001927 3300006881 Bacteria 12209
288 Ga0068865_100033555 3300006881 Bacteria 3437
289 Ga0068865_100172820 3300006881 Bacteria 1658
290 Ga0068865_100225712 3300006881 Bacteria 1466
291 Ga0068865_100349449 3300006881 Bacteria 1197
292 Ga0075436_100019321 3300006914 Bacteria 4670
293 Ga0075436_100046702 3300006914 Bacteria 2987
294 Ga0097620_100004763 3300006931 Bacteria 13795
295 Ga0097620_100217143 3300006931 Bacteria 2000
296 Ga0097620_100282441 3300006931 Bacteria 1753
297 Ga0097620_100298535 3300006931 Bacteria 1704
298 Ga0097620_100354849 3300006931 Unclassified 1561
299 Ga0097620_100372214 3300006931 Bacteria 1524
300 Ga0097620_101647571 3300006931 Bacteria 709
301 Ga0075435_100106617 3300007076 Bacteria 2327
302 Ga0075435_100503143 3300007076 Bacteria 1048
303 Ga0075435_100596340 3300007076 Bacteria 958
304 Ga0105251_10244730 3300009011 Bacteria 808
305 Ga0105240_10105340 3300009093 Bacteria 3424
306 Ga0111539_10530712 3300009094 Bacteria 1371
307 Ga0105245_10002094 3300009098 Bacteria 18092
308 Ga0105245_10082037 3300009098 Bacteria 2949
309 Ga0105245_10106808 3300009098 Bacteria 2598
310 Ga0105245_10129798 3300009098 Bacteria 2363
311 Ga0105245_10165119 3300009098 Bacteria 2104
312 Ga0105245_12195210 3300009098 Bacteria 606
313 Ga0105245_13240144 3300009098 Unclassified 504
314 Ga0105247_10189803 3300009101 Bacteria 1375
315 Ga0105247_11759754 3300009101 Unclassified 514
316 Ga0105243_10117042 3300009148 Bacteria 2240
317 Ga0105241_10028850 3300009174 Bacteria 4135
318 Ga0105241_10734094 3300009174 Bacteria 904
319 Ga0105241_11290246 3300009174 Bacteria 695
320 Ga0105241_11310377 3300009174 Bacteria 690
321 Ga0105242_10113265 3300009176 Bacteria 2316
322 Ga0105242_10238169 3300009176 Bacteria 1635
323 Ga0105242_11081074 3300009176 Bacteria 815
324 Ga0105242_11094402 3300009176 Bacteria 810
325 Ga0105248_10001701 3300009177 Bacteria 24486
326 Ga0105248_10745552 3300009177 Bacteria 1105
327 Ga0105248_11004560 3300009177 Bacteria 942
328 Ga0105237_10069691 3300009545 Bacteria 3512
329 Ga0105237_10121692 3300009545 Bacteria 2604
330 Ga0105237_11151428 3300009545 Bacteria 782
331 Ga0105238_10068737 3300009551 Bacteria 3543
332 Ga0105238_10193408 3300009551 Bacteria 2010
333 Ga0105238_10213369 3300009551 Bacteria 1907
334 Ga0105238_12108389 3300009551 Bacteria 598
335 Ga0105249_10172220 3300009553 Bacteria 2100
336 Ga0105249_10434427 3300009553 Bacteria 1349
337 Ga0105249_10977131 3300009553 Bacteria 915
338 Ga0105239_10508872 3300010375 Bacteria 1369
339 Ga0105239_11981226 3300010375 Bacteria 676
340 Ga0105246_10015253 3300011119 Bacteria 4848
341 Ga0105246_10343005 3300011119 Bacteria 1221
342 Ga0157335_1038528 3300012492 Bacteria 530
343 Ga0157319_1031713 3300012497 Bacteria 575
344 Ga0157373_10132472 3300013100 Bacteria 1753
345 Ga0157373_10831315 3300013100 Bacteria 682
346 Ga0157371_10146774 3300013102 Bacteria 1681
347 Ga0157370_10054056 3300013104 Bacteria 3828
348 Ga0157370_10089239 3300013104 Bacteria 2896
349 Ga0157369_10189005 3300013105 Bacteria 2164
350 Ga0157369_10272367 3300013105 Bacteria 1764
351 Ga0157369_11044279 3300013105 Bacteria 836
352 Ga0157369_11605096 3300013105 Bacteria 661
353 Ga0157374_10004890 3300013296 Bacteria 11242
354 Ga0157374_10012603 3300013296 Bacteria 7361
355 Ga0157374_10029804 3300013296 Bacteria 4949
356 Ga0157374_12459234 3300013296 Unclassified 548
357 Ga0157378_10019423 3300013297 Bacteria 5974
358 Ga0157378_10065242 3300013297 Bacteria 3259
359 Ga0157378_10484180 3300013297 Bacteria 1233
360 Ga0157378_10515479 3300013297 Bacteria 1196
361 Ga0163162_10002112 3300013306 Bacteria 18669
362 Ga0163162_10002653 3300013306 Bacteria 16955
363 Ga0163162_10118524 3300013306 Bacteria 2749
364 Ga0163162_10981542 3300013306 Bacteria 955
365 Ga0163162_11159014 3300013306 Bacteria 877
366 Ga0163162_12072307 3300013306 Bacteria 652
367 Ga0157372_10098133 3300013307 Bacteria 3342
368 Ga0157372_10170779 3300013307 Bacteria 2516
369 Ga0157372_13098919 3300013307 Unclassified 531
370 Ga0157375_10006548 3300013308 Bacteria 10137
371 Ga0157375_10053422 3300013308 Bacteria 3975
372 Ga0157375_10116475 3300013308 Bacteria 2776
373 Ga0157375_10334481 3300013308 Bacteria 1680
374 Ga0157375_10457352 3300013308 Bacteria 1442
375 Ga0157375_10854959 3300013308 Bacteria 1056
376 Ga0157375_11900538 3300013308 Bacteria 707
377 Ga0157375_12444959 3300013308 Bacteria 623
378 Ga0163163_10284778 3300014325 Bacteria 1704
379 Ga0163163_12073768 3300014325 Bacteria 628
380 Ga0157380_10025430 3300014326 Bacteria 4489
381 Ga0157380_10507686 3300014326 Bacteria 1173
382 Ga0157380_10650702 3300014326 Bacteria 1051
383 Ga0157380_11080427 3300014326 Bacteria 840
384 Ga0157380_11166477 3300014326 Bacteria 812
385 Ga0157380_11842347 3300014326 Bacteria 665
386 Ga0157377_10026156 3300014745 Bacteria 3120
387 Ga0157377_10114776 3300014745 Bacteria 1624
388 Ga0157377_11743835 3300014745 Bacteria 504
389 Ga0157379_10001106 3300014968 Bacteria 22048
390 Ga0157379_10050312 3300014968 Bacteria 3719
391 Ga0157379_10995373 3300014968 Bacteria 799
392 Ga0157376_10001970 3300014969 Bacteria 13739
393 Ga0157376_10131535 3300014969 Bacteria 2233
394 Ga0157376_10165860 3300014969 Bacteria 2007
395 Ga0157376_10218321 3300014969 Bacteria 1764
396 Ga0157376_11790699 3300014969 Bacteria 650
397 Ga0163161_10009441 3300017792 Bacteria 6750
398 Ga0163161_10035466 3300017792 Bacteria 3570
399 Ga0207697_10035786 3300025315 Bacteria 2033
400 Ga0207697_10041299 3300025315 Bacteria 1894
401 Ga0207697_10119606 3300025315 Bacteria 1133
402 Ga0207656_10017342 3300025321 Bacteria 2819
403 Ga0207656_10224135 3300025321 Bacteria 914
404 Ga0207653_10203298 3300025885 Bacteria 747
405 Ga0207682_10073588 3300025893 Bacteria 1451
406 Ga0207682_10102713 3300025893 Bacteria 1251
407 Ga0207682_10115407 3300025893 Bacteria 1186
408 Ga0207682_10291255 3300025893 Bacteria 764
409 Ga0207692_10014177 3300025898 Bacteria 3478
410 Ga0207692_10170454 3300025898 Bacteria 1261
411 Ga0207692_10851231 3300025898 Bacteria 598
412 Ga0207642_10000974 3300025899 Bacteria 8944
413 Ga0207642_10036785 3300025899 Bacteria 2104
414 Ga0207642_10647038 3300025899 Bacteria 662
415 Ga0207688_10045458 3300025901 Bacteria 2449
416 Ga0207680_10001982 3300025903 Bacteria 9581
417 Ga0207680_10218988 3300025903 Bacteria 1304
418 Ga0207680_10264823 3300025903 Bacteria 1191
419 Ga0207680_10443012 3300025903 Bacteria 921
420 Ga0207680_10829842 3300025903 Bacteria 663
421 Ga0207685_10006487 3300025905 Bacteria 3189
422 Ga0207685_10061182 3300025905 Bacteria 1492
423 Ga0207685_10632267 3300025905 Bacteria 577
424 Ga0207699_10066559 3300025906 Bacteria 2187
425 Ga0207645_10001058 3300025907 Bacteria 22793
426 Ga0207645_10011861 3300025907 Bacteria 5931
427 Ga0207645_10024055 3300025907 Bacteria 3953
428 Ga0207645_10067652 3300025907 Bacteria 2283
429 Ga0207645_10184954 3300025907 Bacteria 1368
430 Ga0207643_10661220 3300025908 Bacteria 674
431 Ga0207705_10078861 3300025909 Bacteria 2398
432 Ga0207705_10415746 3300025909 Bacteria 1041
433 Ga0207684_10037844 3300025910 Bacteria 4093
434 Ga0207684_10101330 3300025910 Bacteria 2461
435 Ga0207684_10106282 3300025910 Bacteria 2401
436 Ga0207654_10064933 3300025911 Bacteria 2148
437 Ga0207654_10125505 3300025911 Bacteria 1618
438 Ga0207654_10311393 3300025911 Bacteria 1073
439 Ga0207707_10061036 3300025912 Bacteria 3280
440 Ga0207695_10419839 3300025913 Bacteria 1222
441 Ga0207693_10002975 3300025915 Bacteria 14675
442 Ga0207693_10059619 3300025915 Bacteria 2989
443 Ga0207663_10083523 3300025916 Bacteria 2098
444 Ga0207663_10599683 3300025916 Bacteria 865
445 Ga0207663_11088797 3300025916 Bacteria 642
446 Ga0207660_10082588 3300025917 Bacteria 2364
447 Ga0207662_10055703 3300025918 Bacteria 2360
448 Ga0207662_10080367 3300025918 Bacteria 1988
449 Ga0207662_10092022 3300025918 Bacteria 1866
450 Ga0207662_10229232 3300025918 Bacteria 1212
451 Ga0207657_10004934 3300025919 Bacteria 14029
452 Ga0207657_10014119 3300025919 Bacteria 7814
453 Ga0207657_11090432 3300025919 Bacteria 610
454 Ga0207649_10368293 3300025920 Bacteria 1068
455 Ga0207652_10111575 3300025921 Bacteria 2425
456 Ga0207646_10017711 3300025922 Bacteria 6657
457 Ga0207646_10038017 3300025922 Bacteria 4338
458 Ga0207646_10118233 3300025922 Bacteria 2381
459 Ga0207646_10620375 3300025922 Bacteria 970
460 Ga0207681_10009784 3300025923 Bacteria 5864
461 Ga0207681_10067279 3300025923 Bacteria 2483
462 Ga0207681_10115981 3300025923 Bacteria 1956
463 Ga0207681_10125092 3300025923 Bacteria 1892
464 Ga0207681_10186940 3300025923 Bacteria 1582
465 Ga0207681_10467351 3300025923 Bacteria 1028
466 Ga0207681_10619399 3300025923 Bacteria 895
467 Ga0207681_11379166 3300025923 Bacteria 592
468 Ga0207694_10082798 3300025924 Bacteria 2522
469 Ga0207694_10360232 3300025924 Bacteria 1205
470 Ga0207650_10021570 3300025925 Bacteria 4551
471 Ga0207650_10028783 3300025925 Bacteria 3987
472 Ga0207650_10034275 3300025925 Bacteria 3681
473 Ga0207650_10067697 3300025925 Bacteria 2680
474 Ga0207650_10075850 3300025925 Bacteria 2539
475 Ga0207650_10185592 3300025925 Bacteria 1659
476 Ga0207650_10224883 3300025925 Bacteria 1512
477 Ga0207650_10230724 3300025925 Bacteria 1493
478 Ga0207650_10255416 3300025925 Bacteria 1420
479 Ga0207650_10885078 3300025925 Bacteria 758
480 Ga0207659_10000739 3300025926 Bacteria 19339
481 Ga0207659_10013667 3300025926 Bacteria 5209
482 Ga0207659_10083054 3300025926 Bacteria 2373
483 Ga0207659_10155121 3300025926 Bacteria 1792
484 Ga0207659_10279706 3300025926 Bacteria 1364
485 Ga0207659_10528908 3300025926 Bacteria 1000
486 Ga0207659_11347804 3300025926 Bacteria 612
487 Ga0207687_10023872 3300025927 Bacteria 4080
488 Ga0207687_10024630 3300025927 Bacteria 4023
489 Ga0207687_10480488 3300025927 Bacteria 1034
490 Ga0207687_10848735 3300025927 Bacteria 780
491 Ga0207700_10075216 3300025928 Bacteria 2616
492 Ga0207700_10106194 3300025928 Bacteria 2250
493 Ga0207644_10004900 3300025931 Bacteria 8726
494 Ga0207644_10030901 3300025931 Bacteria 3728
495 Ga0207644_10040621 3300025931 Bacteria 3288
496 Ga0207644_10043213 3300025931 Bacteria 3197
497 Ga0207644_10043560 3300025931 Bacteria 3186
498 Ga0207644_11279485 3300025931 Bacteria 616
499 Ga0207644_11354346 3300025931 Bacteria 598
500 Ga0207690_10153753 3300025932 Bacteria 1708
501 Ga0207690_10607480 3300025932 Bacteria 893
502 Ga0207706_10036136 3300025933 Bacteria 4389
503 Ga0207706_10099578 3300025933 Bacteria 2557
504 Ga0207706_10473777 3300025933 Bacteria 1082
505 Ga0207706_10553112 3300025933 Bacteria 991
506 Ga0207706_10966485 3300025933 Bacteria 717
507 Ga0207686_10000315 3300025934 Bacteria 34957
508 Ga0207686_10355449 3300025934 Bacteria 1104
509 Ga0207686_10831284 3300025934 Bacteria 742
510 Ga0207709_10240072 3300025935 Bacteria 1318
511 Ga0207709_10463935 3300025935 Bacteria 981
512 Ga0207709_10492946 3300025935 Bacteria 955
513 Ga0207709_10777763 3300025935 Bacteria 771
514 Ga0207670_10007822 3300025936 Bacteria 5998
515 Ga0207670_10129703 3300025936 Bacteria 1845
516 Ga0207669_10040819 3300025937 Bacteria 2695
517 Ga0207669_10056737 3300025937 Bacteria 2380
518 Ga0207669_10080594 3300025937 Bacteria 2082
519 Ga0207669_10096515 3300025937 Bacteria 1941
520 Ga0207704_10001306 3300025938 Bacteria 11152
521 Ga0207704_10031604 3300025938 Bacteria 2985
522 Ga0207704_10289057 3300025938 Bacteria 1250
523 Ga0207704_10395589 3300025938 Bacteria 1089
524 Ga0207704_10622089 3300025938 Bacteria 886
525 Ga0207665_10013218 3300025939 Bacteria 5429
526 Ga0207665_10017508 3300025939 Bacteria 4710
527 Ga0207691_10000041 3300025940 Bacteria 106275
528 Ga0207691_10002908 3300025940 Bacteria 16703
529 Ga0207691_10004381 3300025940 Bacteria 13683
530 Ga0207691_10012171 3300025940 Bacteria 8248
531 Ga0207691_10018599 3300025940 Bacteria 6585
532 Ga0207691_10298931 3300025940 Bacteria 1383
533 Ga0207691_10372734 3300025940 Bacteria 1219
534 Ga0207691_10615661 3300025940 Bacteria 919
535 Ga0207711_10000934 3300025941 Bacteria 28177
536 Ga0207711_10001347 3300025941 Bacteria 23185
537 Ga0207711_11923641 3300025941 Bacteria 534
538 Ga0207689_10003613 3300025942 Bacteria 14131
539 Ga0207689_10004127 3300025942 Bacteria 13200
540 Ga0207689_10044332 3300025942 Bacteria 3677
541 Ga0207689_10049582 3300025942 Bacteria 3463
542 Ga0207689_10078702 3300025942 Bacteria 2709
543 Ga0207689_10079763 3300025942 Bacteria 2690
544 Ga0207689_10457072 3300025942 Bacteria 1067
545 Ga0207661_10181883 3300025944 Bacteria 1837
546 Ga0207679_10030361 3300025945 Bacteria 3773
547 Ga0207679_10078728 3300025945 Bacteria 2511
548 Ga0207679_10295574 3300025945 Bacteria 1394
549 Ga0207679_10405293 3300025945 Bacteria 1200
550 Ga0207679_11264173 3300025945 Bacteria 677
551 Ga0207667_10150534 3300025949 Bacteria 2395
552 Ga0207667_10530075 3300025949 Bacteria 1192
553 Ga0207651_10002868 3300025960 Bacteria 8318
554 Ga0207651_10008943 3300025960 Bacteria 5440
555 Ga0207651_10016042 3300025960 Bacteria 4374
556 Ga0207651_10096420 3300025960 Bacteria 2181
557 Ga0207651_10240883 3300025960 Bacteria 1474
558 Ga0207712_10117167 3300025961 Bacteria 2008
559 Ga0207712_10163879 3300025961 Bacteria 1731
560 Ga0207712_10313564 3300025961 Bacteria 1291
561 Ga0207668_10022678 3300025972 Bacteria 4023
562 Ga0207668_10049202 3300025972 Bacteria 2896
563 Ga0207668_10067191 3300025972 Bacteria 2544
564 Ga0207640_10097190 3300025981 Bacteria 2055
565 Ga0207640_10149059 3300025981 Bacteria 1716
566 Ga0207640_10226403 3300025981 Bacteria 1435
567 Ga0207640_10513554 3300025981 Bacteria 1000
568 Ga0207640_10861516 3300025981 Bacteria 789
569 Ga0207658_10007536 3300025986 Bacteria 7413
570 Ga0207658_10011830 3300025986 Bacteria 5945
571 Ga0207658_10096819 3300025986 Bacteria 2302
572 Ga0207658_10132053 3300025986 Bacteria 2007
573 Ga0207658_10167107 3300025986 Bacteria 1808
574 Ga0207658_10222288 3300025986 Bacteria 1589
575 Ga0207658_10674105 3300025986 Bacteria 933
576 Ga0207658_10712375 3300025986 Bacteria 907
577 Ga0207677_10000112 3300026023 Bacteria 66499
578 Ga0207677_10000232 3300026023 Bacteria 43610
579 Ga0207677_10003482 3300026023 Bacteria 8344
580 Ga0207677_10004436 3300026023 Bacteria 7536
581 Ga0207677_10066752 3300026023 Bacteria 2517
582 Ga0207677_10285207 3300026023 Bacteria 1357
583 Ga0207677_10531928 3300026023 Bacteria 1021
584 Ga0207677_10884018 3300026023 Bacteria 805
585 Ga0207703_10004690 3300026035 Bacteria 11165
586 Ga0207703_10010253 3300026035 Bacteria 7339
587 Ga0207703_10072886 3300026035 Bacteria 2839
588 Ga0207703_10490667 3300026035 Bacteria 1152
589 Ga0207703_10492621 3300026035 Bacteria 1149
590 Ga0207639_10047156 3300026041 Bacteria 3255
591 Ga0207639_10236768 3300026041 Bacteria 1585
592 Ga0207639_10884014 3300026041 Bacteria 835
593 Ga0207639_10890362 3300026041 Bacteria 832
594 Ga0207639_11128705 3300026041 Bacteria 735
595 Ga0207678_10036749 3300026067 Bacteria 4264
596 Ga0207678_10124494 3300026067 Bacteria 2199
597 Ga0207678_10169095 3300026067 Bacteria 1866
598 Ga0207678_10235436 3300026067 Bacteria 1568
599 Ga0207708_10117884 3300026075 Bacteria 2067
600 Ga0207708_11549259 3300026075 Bacteria 582
601 Ga0207702_10071215 3300026078 Bacteria 2993
602 Ga0207702_10181329 3300026078 Bacteria 1939
603 Ga0207702_10391842 3300026078 Bacteria 1338
604 Ga0207702_11230919 3300026078 Bacteria 743
605 Ga0207702_11472166 3300026078 Bacteria 674
606 Ga0207641_10009275 3300026088 Bacteria 8114
607 Ga0207641_10018659 3300026088 Bacteria 5686
608 Ga0207641_10192991 3300026088 Bacteria 1873
609 Ga0207641_10217212 3300026088 Bacteria 1771
610 Ga0207641_10307698 3300026088 Bacteria 1499
611 Ga0207641_10583447 3300026088 Bacteria 1093
612 Ga0207648_10000601 3300026089 Bacteria 40481
613 Ga0207648_10006033 3300026089 Bacteria 12082
614 Ga0207648_10016691 3300026089 Bacteria 6699
615 Ga0207648_10082693 3300026089 Bacteria 2800
616 Ga0207648_10333556 3300026089 Bacteria 1365
617 Ga0207648_10540499 3300026089 Bacteria 1069
618 Ga0207648_11378201 3300026089 Bacteria 663
619 Ga0207676_10001973 3300026095 Bacteria 14942
620 Ga0207676_10002815 3300026095 Bacteria 12373
621 Ga0207676_10005593 3300026095 Bacteria 8893
622 Ga0207676_10743469 3300026095 Bacteria 953
623 Ga0207676_11535339 3300026095 Unclassified 663
624 Ga0207674_10028821 3300026116 Bacteria 5854
625 Ga0207674_10064451 3300026116 Bacteria 3696
626 Ga0207674_10569533 3300026116 Bacteria 1094
627 Ga0207674_11292503 3300026116 Bacteria 699
628 Ga0207675_100023855 3300026118 Bacteria 5689
629 Ga0207675_100065421 3300026118 Bacteria 3398
630 Ga0207675_100124674 3300026118 Bacteria 2439
631 Ga0207675_100440651 3300026118 Bacteria 1289
632 Ga0207675_100931854 3300026118 Bacteria 885
633 Ga0207675_100949358 3300026118 Bacteria 877
634 Ga0207675_101720273 3300026118 Bacteria 647
635 Ga0207683_10000011 3300026121 Bacteria 140261
636 Ga0207683_10001380 3300026121 Bacteria 21898
637 Ga0207683_10029643 3300026121 Bacteria 4738
638 Ga0207683_10350736 3300026121 Bacteria 1354
639 Ga0207683_10932688 3300026121 Bacteria 806
640 Ga0207683_11149815 3300026121 Bacteria 720
641 Ga0207698_10146733 3300026142 Bacteria 2041
642 Ga0207698_10596915 3300026142 Bacteria 1088
643 Ga0207698_12177500 3300026142 Unclassified 567
644 Ga0268266_10022303 3300028379 Bacteria 5396
645 Ga0268266_10041420 3300028379 Bacteria 3929
646 Ga0268266_10129710 3300028379 Bacteria 2254
647 Ga0268266_10356093 3300028379 Bacteria 1376
648 Ga0268265_10037462 3300028380 Bacteria 3560
649 Ga0268265_10313581 3300028380 Bacteria 1417
650 Ga0268265_10857027 3300028380 Bacteria 889
651 Ga0268265_11239606 3300028380 Bacteria 744
652 Ga0268264_10001396 3300028381 Bacteria 22573
653 Ga0268264_10009610 3300028381 Bacteria 8012
654 Ga0268264_10048228 3300028381 Bacteria 3542
655 Ga0268264_10183238 3300028381 Bacteria 1903
656 Ga0268264_10236073 3300028381 Bacteria 1691
657 Ga0268264_10722200 3300028381 Bacteria 991
658 Ga0268264_10736117 3300028381 Bacteria 981
659 Ga0307406_11230033 3300031901 Bacteria 651
660 Ga0307407_10062716 3300031903 Bacteria 2178
661 Ga0373926_0030153 3300035083 Bacteria 1909
662 Ga0373926_0036616 3300035083 Bacteria 1744
663 Ga0373928_0024020 3300035084 Bacteria 1304
664 Ga0373928_0133372 3300035084 Bacteria 675
665 Ga0373928_0260454 3300035084 Bacteria 519
666 Ga0373934_0015891 3300035086 Bacteria 2859
667 Ga0373951_0140500 3300035091 Bacteria 670
668 Ga0373923_0011822 3300035111 Bacteria 3213
669 Ga0373932_0012687 3300035112 Bacteria 2080
670 Ga0373939_0384012 3300035114 Bacteria 579
671 Ga0373945_0007255 3300035116 Bacteria 3589
672 Ga0373945_0091816 3300035116 Bacteria 1176
673 Ga0373954_0001619 3300035118 Bacteria 9205
674 Ga0373956_0009565 3300035119 Bacteria 3948
675 Ga0373957_0098387 3300035120 Bacteria 1169
676 Ga0373943_0007593 3300035170 Bacteria 4869
677 Ga0373943_0154262 3300035170 Bacteria 1246
678 Ga0373946_0052500 3300035171 Bacteria 1710
679 Ga0373946_0084357 3300035171 Bacteria 1397
680 Ga0373946_0300027 3300035171 Bacteria 794
681 Ga0373955_0049502 3300035172 Bacteria 2281
682 Ga0373955_0362219 3300035172 Bacteria 879
683 Ga0373962_0182455 3300035242 Bacteria 702
684 Ga0373924_0008951 3300035410 Bacteria 3657
685 Ga0373924_0209304 3300035410 Bacteria 861
686 Ga0373924_0249169 3300035410 Bacteria 786
687 Ga0373931_0030884 3300035691 Bacteria 2760
688 Ga0373931_0151210 3300035691 Bacteria 1353
689 Ga0373935_0026452 3300035692 Bacteria 3581
690 Ga0373935_0094455 3300035692 Bacteria 1962
691 Ga0373935_0257832 3300035692 Bacteria 1222
692 Ga0373935_0479087 3300035692 Bacteria 901
693 Ga0373935_0529367 3300035692 Bacteria 858
694 Ga0373935_0867380 3300035692 Bacteria 668
695 Ga0373927_0006222 3300035695 Bacteria 8149
696 Ga0373927_0031549 3300035695 Bacteria 3453
697 Ga0373927_0064743 3300035695 Bacteria 2365
698 Ga0373927_0080199 3300035695 Bacteria 2115
699 Ga0373927_0133697 3300035695 Bacteria 1621
700 Ga0373927_0309310 3300035695 Bacteria 1040
701 Ga0373933_0045591 3300035724 Bacteria 2600
702 Ga0373947_0003277 3300035725 Bacteria 9599
703 Ga0373947_0016537 3300035725 Bacteria 4239
704 Ga0373947_0349811 3300035725 Bacteria 991
705 Ga0373947_0431673 3300035725 Bacteria 891
706 Ga0373947_0506047 3300035725 Bacteria 821
707 Ga0373947_0549110 3300035725 Bacteria 786
708 Ga0373937_0006916 3300036401 Bacteria 9792
709 Ga0373937_0148509 3300036401 Bacteria 2195
710 Ga0373937_0234752 3300036401 Bacteria 1727
711 Ga0373937_0298820 3300036401 Bacteria 1521
712 Ga0373937_0335210 3300036401 Bacteria 1432
713 Ga0373937_0828763 3300036401 Bacteria 873
714 Ga0373937_0969690 3300036401 Bacteria 799
715 Ga0373925_0021569 3300037068 Bacteria 4694
716 Ga0373925_0049097 3300037068 Bacteria 3145
717 Ga0373925_0057184 3300037068 Bacteria 2923
718 Ga0373925_0244101 3300037068 Bacteria 1439
719 Ga0373925_0249700 3300037068 Bacteria 1422
720 Ga0373925_0314705 3300037068 Bacteria 1266
721 Ga0373925_0407639 3300037068 Bacteria 1109
722 Ga0451804_0049404 3300041463 Bacteria 531
723 Ga0451833_0352810 3300041491 Bacteria 570
724 Ga0451835_1159940 3300041492 Bacteria 585
725 Ga0451853_3538724 3300041512 Bacteria 1441
726 Ga0451577_0022341 3300042876 Bacteria 5775
727 Ga0451577_1088562 3300042876 Bacteria 715
728 Ga0453684_0398230 3300044712 Bacteria 1542
729 Ga0453684_1962515 3300044712 Bacteria 590
730 Ga0451576_0654171 3300045051 Bacteria 1104
731 Ga0495592_0139344 3300046454 Bacteria 1689
732 Ga0495592_0813422 3300046454 Bacteria 554
733 Ga0495629_0012122 3300046459 Bacteria 6247
734 Ga0495651_0060828 3300046462 Bacteria 2892
735 Ga0495653_0063020 3300046463 Bacteria 2800
736 Ga0495653_0314156 3300046463 Bacteria 1018
737 Ga0495580_0008291 3300046472 Bacteria 8271
738 Ga0495580_0063574 3300046472 Bacteria 2588
739 Ga0495580_0099455 3300046472 Bacteria 2023
740 Ga0495639_0018538 3300046475 Bacteria 3031
741 Ga0495639_0225656 3300046475 Bacteria 922
742 Ga0495664_0001368 3300046477 Bacteria 12878
743 Ga0495608_0084344 3300046511 Bacteria 2061
744 Ga0495628_0048104 3300046516 Bacteria 3381
745 Ga0495628_0340472 3300046516 Bacteria 1104
746 Ga0495630_0147262 3300046517 Bacteria 1791
747 Ga0495630_0530143 3300046517 Bacteria 903
748 Ga0495630_0856958 3300046517 Bacteria 693
749 Ga0495663_0391655 3300046525 Bacteria 510
750 Ga0495642_0232570 3300046528 Bacteria 805
751 Ga0495665_0128445 3300046531 Bacteria 1327
752 Ga0495587_0085390 3300046536 Bacteria 1827
753 Ga0495621_0080875 3300046539 Bacteria 1211
754 Ga0495645_0018538 3300046543 Bacteria 5001
755 Ga0495645_0078781 3300046543 Bacteria 2368
756 Ga0495667_0099190 3300046559 Unclassified 1886
757 Ga0495634_0328463 3300046642 Bacteria 919
758 Ga0495635_0004423 3300046663 Bacteria 9734
759 Ga0495635_0034435 3300046663 Bacteria 3512
760 Ga0495635_0087081 3300046663 Bacteria 2137
761 Ga0495657_0069280 3300046675 Bacteria 2309
762 Ga0495599_0060718 3300046678 Bacteria 2364
763 Ga0495623_0065629 3300046679 Bacteria 2269
764 Ga0495646_0199259 3300046680 Bacteria 1091
765 Ga0495647_0001693 3300046681 Bacteria 6829
766 Ga0495647_0008363 3300046681 Bacteria 3477
767 Ga0495647_0027972 3300046681 Bacteria 2076
768 Ga0495658_0169422 3300046683 Bacteria 1351
769 Ga0495613_0005266 3300046689 Bacteria 9717
770 Ga0495613_0043094 3300046689 Bacteria 3339
771 Ga0495624_0117773 3300046690 Bacteria 1632
772 Ga0495600_0007268 3300046809 Bacteria 6765
773 Ga0495581_0431839 3300047315 Bacteria 767
774 Ga0495604_0108186 3300047317 Bacteria 2031
775 Ga0495604_0401207 3300047317 Bacteria 903
776 Ga0495636_0212059 3300047318 Bacteria 887
777 Ga0495636_0388524 3300047318 Bacteria 663
778 Ga0495674_0283799 3300047319 Bacteria 1356
779 Ga0495674_0523878 3300047319 Bacteria 946
780 Ga0495676_0482969 3300047321 Bacteria 815
781 Ga0495680_0037844 3300047322 Bacteria 3862
782 Ga0495680_0172619 3300047322 Bacteria 1565
783 Ga0495675_0097950 3300047444 Bacteria 1837
784 Ga0495684_0003986 3300047471 Bacteria 11515
785 Ga0495684_0127643 3300047471 Bacteria 1912
786 Ga0496101_0114222 3300048904 Bacteria 2036
787 Ga0496101_0198031 3300048904 Bacteria 1552
788 Ga0496101_1632892 3300048904 Bacteria 500
789 Ga0496102_0117571 3300048905 Bacteria 2481
790 Ga0496102_1475025 3300048905 Bacteria 599
791 Ga0496103_0372255 3300048906 Bacteria 918
792 Ga0496104_0005138 3300048907 Bacteria 11430
793 Ga0496104_0343427 3300048907 Bacteria 1406
794 Ga0496105_0102754 3300048908 Bacteria 2360
795 Ga0496105_0303123 3300048908 Bacteria 1284
796 Ga0496106_0082298 3300048909 Bacteria 2474
797 Ga0496106_0538310 3300048909 Bacteria 937
798 Ga0496107_0100631 3300048910 Bacteria 2119
799 Ga0496108_0592699 3300048911 Bacteria 966
800 Ga0496109_0015328 3300048912 Bacteria 6677
801 Ga0496109_0209102 3300048912 Bacteria 1835
802 Ga0496109_1325199 3300048912 Bacteria 656
803 Ga0496110_0203925 3300048913 Bacteria 1797
804 Ga0496110_0335575 3300048913 Bacteria 1377
805 Ga0496111_0096310 3300048914 Bacteria 2172
806 Ga0496112_0023091 3300048915 Bacteria 5937
807 Ga0496112_0166917 3300048915 Unclassified 2167
808 Ga0496112_0402385 3300048915 Bacteria 1309
809 Ga0496112_0603714 3300048915 Bacteria 1029
810 Ga0496114_0398708 3300048917 Bacteria 1218
811 Ga0496115_0115084 3300048918 Bacteria 2211
812 Ga0496115_0644781 3300048918 Bacteria 838
813 Ga0496123_0097698 3300048926 Bacteria 1720
814 nmdc:mga0k408_470241_c1 3300050493 Bacteria 746
815 nmdc:mga07m45_300048_c1 3300050496 Bacteria 934
816 nmdc:mga08y16_476060_c1 3300050511 Bacteria 1271
817 nmdc:mga0n895_1729430_c1 3300050512 Bacteria 587
818 nmdc:mga0n895_500669_c1 3300050512 Bacteria 1224
819 nmdc:mga0n895_506034_c1 3300050512 Bacteria 1216
820 nmdc:mga0n895_63697_c1 3300050512 Bacteria 3646
821 nmdc:mga0rr50_108671_c1 3300050513 Bacteria 2191
822 nmdc:mga08x19_230358_c1 3300050514 Bacteria 1275
823 nmdc:mga0a205_438124_c1 3300050515 Bacteria 1168
824 Ga0495601_0068845 3300053077 Bacteria 2257
825 Ga0495601_0374901 3300053077 Bacteria 924
826 Ga0495612_0026148 3300053078 Bacteria 2346
827 Ga0495595_0450360 3300053084 Bacteria 654
828 Ga0495619_0004347 3300053085 Bacteria 9040

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026041 Ga0207639_10884014 Ga0207639_108840141 108
2 3300005331 Ga0070670_100033631 Ga0070670_1000336312 109
3 3300005334 Ga0068869_100022675 Ga0068869_1000226752 109
4 3300005335 Ga0070666_11128251 Ga0070666_111282512 109
5 3300005343 Ga0070687_100663840 Ga0070687_1006638402 109
6 3300005353 Ga0070669_100700816 Ga0070669_1007008162 109
7 3300005354 Ga0070675_100010885 Ga0070675_1000108853 109
8 3300005355 Ga0070671_100043601 Ga0070671_1000436013 109
9 3300005364 Ga0070673_100002494 Ga0070673_1000024942 109
10 3300005365 Ga0070688_101000563 Ga0070688_1010005632 109
11 3300005366 Ga0070659_101158084 Ga0070659_1011580842 109
12 3300005367 Ga0070667_100191955 Ga0070667_1001919552 109
13 3300005439 Ga0070711_101871591 Ga0070711_1018715911 109
14 3300005444 Ga0070694_100046133 Ga0070694_1000461331 109
15 3300005456 Ga0070678_101491961 Ga0070678_1014919612 109
16 3300005459 Ga0068867_100143599 Ga0068867_1001435992 109
17 3300005543 Ga0070672_100006345 Ga0070672_1000063452 109
18 3300005577 Ga0068857_100060502 Ga0068857_1000605022 109
19 3300005617 Ga0068859_100217140 Ga0068859_1002171402 109
20 3300005617 Ga0068859_100372233 Ga0068859_1003722332 109
21 3300005718 Ga0068866_10559427 Ga0068866_105594272 109
22 3300005719 Ga0068861_100728712 Ga0068861_1007287122 109
23 3300005719 Ga0068861_101501743 Ga0068861_1015017432 109
24 3300005842 Ga0068858_100098322 Ga0068858_1000983223 109
25 3300006353 Ga0075370_10981170 Ga0075370_109811702 109
26 3300006931 Ga0097620_100217143 Ga0097620_1002171432 109
27 3300006931 Ga0097620_100372214 Ga0097620_1003722142 109
28 3300009098 Ga0105245_10165119 Ga0105245_101651192 109
29 3300009101 Ga0105247_11759754 Ga0105247_117597542 109
30 3300009545 Ga0105237_11151428 Ga0105237_111514281 109
31 3300009553 Ga0105249_10434427 Ga0105249_104344272 109
32 3300013306 Ga0163162_11159014 Ga0163162_111590141 109
33 3300013308 Ga0157375_10053422 Ga0157375_100534222 109
34 3300014325 Ga0163163_10284778 Ga0163163_102847782 109
35 3300014326 Ga0157380_11080427 Ga0157380_110804272 109
36 3300014745 Ga0157377_10114776 Ga0157377_101147762 109
37 3300025903 Ga0207680_10829842 Ga0207680_108298421 109
38 3300025907 Ga0207645_10011861 Ga0207645_100118615 109
39 3300025908 Ga0207643_10661220 Ga0207643_106612202 109
40 3300025918 Ga0207662_10092022 Ga0207662_100920222 109
41 3300025918 Ga0207662_10229232 Ga0207662_102292322 109
42 3300025923 Ga0207681_10186940 Ga0207681_101869402 109
43 3300025925 Ga0207650_10067697 Ga0207650_100676972 109
44 3300025926 Ga0207659_10083054 Ga0207659_100830542 109
45 3300025931 Ga0207644_10030901 Ga0207644_100309013 109
46 3300025934 Ga0207686_10831284 Ga0207686_108312841 109
47 3300025935 Ga0207709_10492946 Ga0207709_104929462 109
48 3300025940 Ga0207691_10002908 Ga0207691_100029086 109
49 3300025942 Ga0207689_10004127 Ga0207689_1000412713 109
50 3300025945 Ga0207679_10295574 Ga0207679_102955741 109
51 3300025960 Ga0207651_10016042 Ga0207651_100160422 109
52 3300025981 Ga0207640_10861516 Ga0207640_108615161 109
53 3300025986 Ga0207658_10167107 Ga0207658_101671072 109
54 3300026023 Ga0207677_10285207 Ga0207677_102852072 109
55 3300026035 Ga0207703_10072886 Ga0207703_100728862 109
56 3300026089 Ga0207648_10006033 Ga0207648_1000603311 109
57 3300026116 Ga0207674_10064451 Ga0207674_100644512 109
58 3300026118 Ga0207675_100931854 Ga0207675_1009318542 109
59 3300026118 Ga0207675_101720273 Ga0207675_1017202732 109
60 3300026121 Ga0207683_11149815 Ga0207683_111498152 109
61 3300035084 Ga0373928_0133372 Ga0373928_0133372_319_651 109
62 3300035171 Ga0373946_0300027 Ga0373946_0300027_434_766 109
63 3300035695 Ga0373927_0064743 Ga0373927_0064743_852_1184 109
64 3300035725 Ga0373947_0506047 Ga0373947_0506047_390_722 109
65 3300037068 Ga0373925_0049097 Ga0373925_0049097_2456_2788 109
66 3300048905 Ga0496102_1475025 Ga0496102_1475025_232_570 109
67 3300050493 nmdc:mga0k408_470241_c1 nmdc:mga0k408_470241_c1_146_484 109
68 3300050496 nmdc:mga07m45_300048_c1 nmdc:mga07m45_300048_c1_96_434 109
69 3300005347 Ga0070668_100166973 Ga0070668_1001669731 110
70 3300005354 Ga0070675_100605760 Ga0070675_1006057602 110
71 3300005843 Ga0068860_100050725 Ga0068860_1000507253 110
72 3300005844 Ga0068862_100225149 Ga0068862_1002251492 110
73 3300013306 Ga0163162_12072307 Ga0163162_120723072 110
74 3300013308 Ga0157375_12444959 Ga0157375_124449592 110
75 3300025923 Ga0207681_10125092 Ga0207681_101250922 110
76 3300025926 Ga0207659_10528908 Ga0207659_105289082 110
77 3300026118 Ga0207675_100440651 Ga0207675_1004406511 110
78 3300028380 Ga0268265_11239606 Ga0268265_112396062 110
79 3300028381 Ga0268264_10183238 Ga0268264_101832383 110
80 3300035084 Ga0373928_0024020 Ga0373928_0024020_404_739 111
81 3300035112 Ga0373932_0012687 Ga0373932_0012687_1076_1411 111
82 3300035114 Ga0373939_0384012 Ga0373939_0384012_68_403 111
83 3300035691 Ga0373931_0030884 Ga0373931_0030884_556_891 111
84 3300037068 Ga0373925_0314705 Ga0373925_0314705_907_1242 111
85 3300047317 Ga0495604_0401207 Ga0495604_0401207_315_650 111
86 3300048907 Ga0496104_0343427 Ga0496104_0343427_973_1308 111
87 3300048915 Ga0496112_0603714 Ga0496112_0603714_527_862 111
88 3300048926 Ga0496123_0097698 Ga0496123_0097698_342_677 111
89 3300005330 Ga0070690_100562678 Ga0070690_1005626781 112
90 3300005334 Ga0068869_100499826 Ga0068869_1004998261 112
91 3300005353 Ga0070669_101524307 Ga0070669_1015243072 112
92 3300005438 Ga0070701_10948080 Ga0070701_109480802 112
93 3300005549 Ga0070704_102131119 Ga0070704_1021311192 112
94 3300005577 Ga0068857_100809218 Ga0068857_1008092182 112
95 3300005617 Ga0068859_100354840 Ga0068859_1003548402 112
96 3300005618 Ga0068864_100453194 Ga0068864_1004531942 112
97 3300006844 Ga0075428_102348646 Ga0075428_1023486461 112
98 3300006871 Ga0075434_100367914 Ga0075434_1003679142 112
99 3300006931 Ga0097620_100354849 Ga0097620_1003548492 112
100 3300007076 Ga0075435_100106617 Ga0075435_1001066172 112
101 3300009098 Ga0105245_10129798 Ga0105245_101297982 112
102 3300010375 Ga0105239_11981226 Ga0105239_119812262 112
103 3300013296 Ga0157374_12459234 Ga0157374_124592341 112
104 3300013297 Ga0157378_10515479 Ga0157378_105154792 112
105 3300014968 Ga0157379_10995373 Ga0157379_109953732 112
106 3300025923 Ga0207681_11379166 Ga0207681_113791662 112
107 3300025927 Ga0207687_10848735 Ga0207687_108487352 112
108 3300025942 Ga0207689_10078702 Ga0207689_100787022 112
109 3300026095 Ga0207676_11535339 Ga0207676_115353391 112
110 3300031901 Ga0307406_11230033 Ga0307406_112300332 112
111 3300031903 Ga0307407_10062716 Ga0307407_100627163 112
112 3300035083 Ga0373926_0030153 Ga0373926_0030153_1145_1483 112
113 3300048915 Ga0496112_0166917 Ga0496112_0166917_74_412 112
114 3300050512 nmdc:mga0n895_500669_c1 nmdc:mga0n895_500669_c1_848_1186 112
115 3300050512 nmdc:mga0n895_506034_c1 nmdc:mga0n895_506034_c1_727_1065 112
116 3300050513 nmdc:mga0rr50_108671_c1 nmdc:mga0rr50_108671_c1_1365_1703 112
117 3300005331 Ga0070670_100045157 Ga0070670_1000451572 113
118 3300005331 Ga0070670_100364209 Ga0070670_1003642092 113
119 3300005333 Ga0070677_10134529 Ga0070677_101345292 113
120 3300005333 Ga0070677_10138047 Ga0070677_101380472 113
121 3300005334 Ga0068869_100287042 Ga0068869_1002870421 113
122 3300005338 Ga0068868_100299338 Ga0068868_1002993382 113
123 3300005338 Ga0068868_100502025 Ga0068868_1005020252 113
124 3300005347 Ga0070668_100248223 Ga0070668_1002482232 113
125 3300005353 Ga0070669_100081074 Ga0070669_1000810742 113
126 3300005354 Ga0070675_100006916 Ga0070675_1000069162 113
127 3300005354 Ga0070675_101243166 Ga0070675_1012431661 113
128 3300005355 Ga0070671_100178282 Ga0070671_1001782822 113
129 3300005356 Ga0070674_100312655 Ga0070674_1003126552 113
130 3300005356 Ga0070674_100558454 Ga0070674_1005584542 113
131 3300005364 Ga0070673_100010065 Ga0070673_1000100655 113
132 3300005364 Ga0070673_100769326 Ga0070673_1007693262 113
133 3300005364 Ga0070673_100886824 Ga0070673_1008868242 113
134 3300005367 Ga0070667_100093357 Ga0070667_1000933572 113
135 3300005367 Ga0070667_100226560 Ga0070667_1002265602 113
136 3300005367 Ga0070667_100911236 Ga0070667_1009112362 113
137 3300005438 Ga0070701_10285146 Ga0070701_102851462 113
138 3300005441 Ga0070700_100285337 Ga0070700_1002853372 113
139 3300005441 Ga0070700_101818524 Ga0070700_1018185242 113
140 3300005455 Ga0070663_100062189 Ga0070663_1000621892 113
141 3300005456 Ga0070678_100004438 Ga0070678_1000044382 113
142 3300005457 Ga0070662_100093657 Ga0070662_1000936572 113
143 3300005459 Ga0068867_100177915 Ga0068867_1001779152 113
144 3300005459 Ga0068867_100239919 Ga0068867_1002399192 113
145 3300005459 Ga0068867_100255407 Ga0068867_1002554072 113
146 3300005459 Ga0068867_101715684 Ga0068867_1017156842 113
147 3300005466 Ga0070685_11126423 Ga0070685_111264231 113
148 3300005543 Ga0070672_100002480 Ga0070672_1000024803 113
149 3300005543 Ga0070672_100042381 Ga0070672_1000423814 113
150 3300005543 Ga0070672_100126052 Ga0070672_1001260522 113
151 3300005543 Ga0070672_100605558 Ga0070672_1006055582 113
152 3300005544 Ga0070686_100617603 Ga0070686_1006176031 113
153 3300005548 Ga0070665_100156748 Ga0070665_1001567482 113
154 3300005564 Ga0070664_100141413 Ga0070664_1001414132 113
155 3300005564 Ga0070664_100327808 Ga0070664_1003278082 113
156 3300005578 Ga0068854_100293136 Ga0068854_1002931362 113
157 3300005617 Ga0068859_100282454 Ga0068859_1002824543 113
158 3300005618 Ga0068864_100003322 Ga0068864_10000332212 113
159 3300005718 Ga0068866_10009601 Ga0068866_100096012 113
160 3300005719 Ga0068861_100005340 Ga0068861_1000053408 113
161 3300005834 Ga0068851_10086276 Ga0068851_100862762 113
162 3300005834 Ga0068851_10295793 Ga0068851_102957932 113
163 3300005840 Ga0068870_10190692 Ga0068870_101906922 113
164 3300005841 Ga0068863_100256330 Ga0068863_1002563302 113
165 3300005841 Ga0068863_101224542 Ga0068863_1012245422 113
166 3300005842 Ga0068858_100157766 Ga0068858_1001577662 113
167 3300005842 Ga0068858_100292875 Ga0068858_1002928752 113
168 3300005843 Ga0068860_100594344 Ga0068860_1005943442 113
169 3300005844 Ga0068862_100218231 Ga0068862_1002182312 113
170 3300005844 Ga0068862_102541743 Ga0068862_1025417431 113
171 3300006163 Ga0070715_10204131 Ga0070715_102041311 113
172 3300006237 Ga0097621_100010446 Ga0097621_1000104462 113
173 3300006358 Ga0068871_100012102 Ga0068871_1000121024 113
174 3300006358 Ga0068871_101496881 Ga0068871_1014968812 113
175 3300006881 Ga0068865_100033555 Ga0068865_1000335552 113
176 3300006931 Ga0097620_100282441 Ga0097620_1002824412 113
177 3300009094 Ga0111539_10530712 Ga0111539_105307122 113
178 3300009098 Ga0105245_13240144 Ga0105245_132401441 113
179 3300009148 Ga0105243_10117042 Ga0105243_101170422 113
180 3300009176 Ga0105242_11081074 Ga0105242_110810741 113
181 3300009177 Ga0105248_10745552 Ga0105248_107455522 113
182 3300013306 Ga0163162_10981542 Ga0163162_109815421 113
183 3300013308 Ga0157375_10334481 Ga0157375_103344812 113
184 3300013308 Ga0157375_10854959 Ga0157375_108549592 113
185 3300014326 Ga0157380_10025430 Ga0157380_100254306 113
186 3300014326 Ga0157380_10507686 Ga0157380_105076862 113
187 3300014326 Ga0157380_11842347 Ga0157380_118423471 113
188 3300014969 Ga0157376_10218321 Ga0157376_102183212 113
189 3300017792 Ga0163161_10035466 Ga0163161_100354664 113
190 3300025315 Ga0207697_10035786 Ga0207697_100357862 113
191 3300025315 Ga0207697_10119606 Ga0207697_101196062 113
192 3300025893 Ga0207682_10073588 Ga0207682_100735882 113
193 3300025893 Ga0207682_10102713 Ga0207682_101027132 113
194 3300025893 Ga0207682_10115407 Ga0207682_101154072 113
195 3300025899 Ga0207642_10036785 Ga0207642_100367852 113
196 3300025901 Ga0207688_10045458 Ga0207688_100454582 113
197 3300025903 Ga0207680_10264823 Ga0207680_102648232 113
198 3300025903 Ga0207680_10443012 Ga0207680_104430122 113
199 3300025905 Ga0207685_10061182 Ga0207685_100611822 113
200 3300025907 Ga0207645_10024055 Ga0207645_100240552 113
201 3300025907 Ga0207645_10067652 Ga0207645_100676522 113
202 3300025909 Ga0207705_10415746 Ga0207705_104157461 113
203 3300025918 Ga0207662_10055703 Ga0207662_100557032 113
204 3300025923 Ga0207681_10067279 Ga0207681_100672791 113
205 3300025923 Ga0207681_10467351 Ga0207681_104673512 113
206 3300025925 Ga0207650_10224883 Ga0207650_102248832 113
207 3300025926 Ga0207659_10013667 Ga0207659_100136672 113
208 3300025926 Ga0207659_10155121 Ga0207659_101551212 113
209 3300025926 Ga0207659_11347804 Ga0207659_113478042 113
210 3300025931 Ga0207644_10043213 Ga0207644_100432132 113
211 3300025933 Ga0207706_10036136 Ga0207706_100361362 113
212 3300025933 Ga0207706_10473777 Ga0207706_104737772 113
213 3300025935 Ga0207709_10240072 Ga0207709_102400722 113
214 3300025935 Ga0207709_10463935 Ga0207709_104639352 113
215 3300025937 Ga0207669_10080594 Ga0207669_100805942 113
216 3300025937 Ga0207669_10096515 Ga0207669_100965152 113
217 3300025938 Ga0207704_10031604 Ga0207704_100316042 113
218 3300025940 Ga0207691_10004381 Ga0207691_100043813 113
219 3300025940 Ga0207691_10012171 Ga0207691_100121712 113
220 3300025940 Ga0207691_10018599 Ga0207691_100185992 113
221 3300025941 Ga0207711_11923641 Ga0207711_119236412 113
222 3300025942 Ga0207689_10457072 Ga0207689_104570722 113
223 3300025945 Ga0207679_10078728 Ga0207679_100787282 113
224 3300025960 Ga0207651_10096420 Ga0207651_100964202 113
225 3300025960 Ga0207651_10240883 Ga0207651_102408832 113
226 3300025961 Ga0207712_10163879 Ga0207712_101638792 113
227 3300025972 Ga0207668_10049202 Ga0207668_100492022 113
228 3300025981 Ga0207640_10513554 Ga0207640_105135542 113
229 3300025986 Ga0207658_10096819 Ga0207658_100968192 113
230 3300025986 Ga0207658_10132053 Ga0207658_101320532 113
231 3300025986 Ga0207658_10712375 Ga0207658_107123751 113
232 3300026023 Ga0207677_10066752 Ga0207677_100667522 113
233 3300026023 Ga0207677_10531928 Ga0207677_105319282 113
234 3300026035 Ga0207703_10492621 Ga0207703_104926212 113
235 3300026067 Ga0207678_10036749 Ga0207678_100367492 113
236 3300026075 Ga0207708_10117884 Ga0207708_101178842 113
237 3300026075 Ga0207708_11549259 Ga0207708_115492592 113
238 3300026088 Ga0207641_10018659 Ga0207641_100186592 113
239 3300026088 Ga0207641_10217212 Ga0207641_102172122 113
240 3300026088 Ga0207641_10583447 Ga0207641_105834472 113
241 3300026089 Ga0207648_10016691 Ga0207648_100166912 113
242 3300026089 Ga0207648_10082693 Ga0207648_100826932 113
243 3300026095 Ga0207676_10002815 Ga0207676_100028153 113
244 3300026116 Ga0207674_10569533 Ga0207674_105695332 113
245 3300026118 Ga0207675_100124674 Ga0207675_1001246742 113
246 3300026121 Ga0207683_10029643 Ga0207683_100296433 113
247 3300026121 Ga0207683_10350736 Ga0207683_103507362 113
248 3300026142 Ga0207698_10596915 Ga0207698_105969152 113
249 3300028379 Ga0268266_10129710 Ga0268266_101297102 113
250 3300028380 Ga0268265_10857027 Ga0268265_108570272 113
251 3300028381 Ga0268264_10009610 Ga0268264_100096102 113
252 3300028381 Ga0268264_10236073 Ga0268264_102360732 113
253 3300028381 Ga0268264_10722200 Ga0268264_107222002 113
254 3300035692 Ga0373935_0529367 Ga0373935_0529367_150_491 113
255 3300035725 Ga0373947_0431673 Ga0373947_0431673_32_373 113
256 3300036401 Ga0373937_0335210 Ga0373937_0335210_678_1019 113
257 3300037068 Ga0373925_0407639 Ga0373925_0407639_95_436 113
258 3300041512 Ga0451853_3538724 Ga0451853_3538724_21_362 113
259 3300042876 Ga0451577_0022341 Ga0451577_0022341_2573_2914 113
260 3300042876 Ga0451577_1088562 Ga0451577_1088562_263_604 113
261 3300044712 Ga0453684_0398230 Ga0453684_0398230_132_473 113
262 3300044712 Ga0453684_1962515 Ga0453684_1962515_59_400 113
263 3300045051 Ga0451576_0654171 Ga0451576_0654171_318_659 113
264 3300046454 Ga0495592_0139344 Ga0495592_0139344_719_1060 113
265 3300046463 Ga0495653_0314156 Ga0495653_0314156_241_582 113
266 3300046475 Ga0495639_0225656 Ga0495639_0225656_160_501 113
267 3300046516 Ga0495628_0340472 Ga0495628_0340472_641_982 113
268 3300046517 Ga0495630_0856958 Ga0495630_0856958_35_376 113
269 3300046681 Ga0495647_0027972 Ga0495647_0027972_953_1294 113
270 3300046683 Ga0495658_0169422 Ga0495658_0169422_901_1242 113
271 3300046689 Ga0495613_0043094 Ga0495613_0043094_2096_2437 113
272 3300047319 Ga0495674_0283799 Ga0495674_0283799_812_1153 113
273 3300047321 Ga0495676_0482969 Ga0495676_0482969_68_409 113
274 3300047322 Ga0495680_0172619 Ga0495680_0172619_381_722 113
275 3300048912 Ga0496109_1325199 Ga0496109_1325199_27_368 113
276 3300050511 nmdc:mga08y16_476060_c1 nmdc:mga08y16_476060_c1_463_804 113
277 3300053077 Ga0495601_0374901 Ga0495601_0374901_191_532 113
278 3300005331 Ga0070670_101041813 Ga0070670_1010418132 114
279 3300005530 Ga0070679_101026724 Ga0070679_1010267242 114
280 3300005543 Ga0070672_100906554 Ga0070672_1009065542 114
281 3300005834 Ga0068851_10726881 Ga0068851_107268812 114
282 3300006358 Ga0068871_100468078 Ga0068871_1004680782 114
283 3300009551 Ga0105238_12108389 Ga0105238_121083892 114
284 3300013104 Ga0157370_10089239 Ga0157370_100892392 114
285 3300013105 Ga0157369_10189005 Ga0157369_101890052 114
286 3300025919 Ga0207657_10014119 Ga0207657_100141192 114
287 3300025925 Ga0207650_10075850 Ga0207650_100758502 114
288 3300025940 Ga0207691_10615661 Ga0207691_106156612 114
289 3300026041 Ga0207639_10890362 Ga0207639_108903622 114
290 3300036401 Ga0373937_0148509 Ga0373937_0148509_1088_1432 114
291 3300041463 Ga0451804_0049404 Ga0451804_0049404_127_471 114
292 3300041491 Ga0451833_0352810 Ga0451833_0352810_177_521 114
293 3300047318 Ga0495636_0212059 Ga0495636_0212059_166_516 114
294 3300050512 nmdc:mga0n895_1729430_c1 nmdc:mga0n895_1729430_c1_79_423 114
295 3300001991 JGI24743J22301_10018002 JGI24743J22301_100180022 115
296 3300005293 Ga0065715_10162868 Ga0065715_101628682 115
297 3300005293 Ga0065715_10274298 Ga0065715_102742982 115
298 3300005327 Ga0070658_10071448 Ga0070658_100714482 115
299 3300005328 Ga0070676_10000349 Ga0070676_100003498 115
300 3300005328 Ga0070676_10440632 Ga0070676_104406322 115
301 3300005328 Ga0070676_10450540 Ga0070676_104505402 115
302 3300005328 Ga0070676_10601232 Ga0070676_106012322 115
303 3300005329 Ga0070683_100026175 Ga0070683_1000261752 115
304 3300005329 Ga0070683_100348861 Ga0070683_1003488612 115
305 3300005330 Ga0070690_100007721 Ga0070690_1000077212 115
306 3300005330 Ga0070690_100009894 Ga0070690_1000098942 115
307 3300005331 Ga0070670_100006222 Ga0070670_1000062223 115
308 3300005331 Ga0070670_100023428 Ga0070670_1000234283 115
309 3300005331 Ga0070670_100080500 Ga0070670_1000805003 115
310 3300005331 Ga0070670_100179110 Ga0070670_1001791102 115
311 3300005331 Ga0070670_101499920 Ga0070670_1014999202 115
312 3300005333 Ga0070677_10162955 Ga0070677_101629552 115
313 3300005333 Ga0070677_10592129 Ga0070677_105921292 115
314 3300005334 Ga0068869_100004464 Ga0068869_1000044642 115
315 3300005334 Ga0068869_100014013 Ga0068869_1000140132 115
316 3300005334 Ga0068869_100345635 Ga0068869_1003456352 115
317 3300005334 Ga0068869_100835847 Ga0068869_1008358472 115
318 3300005335 Ga0070666_10002690 Ga0070666_100026902 115
319 3300005337 Ga0070682_100338523 Ga0070682_1003385232 115
320 3300005338 Ga0068868_100028854 Ga0068868_1000288544 115
321 3300005338 Ga0068868_100080132 Ga0068868_1000801322 115
322 3300005338 Ga0068868_100148605 Ga0068868_1001486052 115
323 3300005338 Ga0068868_100221540 Ga0068868_1002215402 115
324 3300005338 Ga0068868_100277865 Ga0068868_1002778652 115
325 3300005339 Ga0070660_100274962 Ga0070660_1002749622 115
326 3300005340 Ga0070689_100039446 Ga0070689_1000394462 115
327 3300005340 Ga0070689_100053248 Ga0070689_1000532483 115
328 3300005341 Ga0070691_10026265 Ga0070691_100262653 115
329 3300005341 Ga0070691_10180114 Ga0070691_101801142 115
330 3300005343 Ga0070687_100204325 Ga0070687_1002043251 115
331 3300005344 Ga0070661_100018929 Ga0070661_1000189294 115
332 3300005344 Ga0070661_100093927 Ga0070661_1000939273 115
333 3300005344 Ga0070661_101431450 Ga0070661_1014314501 115
334 3300005345 Ga0070692_10503040 Ga0070692_105030402 115
335 3300005347 Ga0070668_100004358 Ga0070668_1000043582 115
336 3300005347 Ga0070668_100004660 Ga0070668_10000466010 115
337 3300005353 Ga0070669_100001355 Ga0070669_1000013555 115
338 3300005353 Ga0070669_100416313 Ga0070669_1004163132 115
339 3300005353 Ga0070669_101158564 Ga0070669_1011585641 115
340 3300005354 Ga0070675_100004937 Ga0070675_1000049372 115
341 3300005355 Ga0070671_100006007 Ga0070671_1000060072 115
342 3300005355 Ga0070671_100057656 Ga0070671_1000576562 115
343 3300005355 Ga0070671_100152775 Ga0070671_1001527752 115
344 3300005355 Ga0070671_101411866 Ga0070671_1014118662 115
345 3300005355 Ga0070671_101597486 Ga0070671_1015974862 115
346 3300005356 Ga0070674_100024685 Ga0070674_1000246854 115
347 3300005356 Ga0070674_100027999 Ga0070674_1000279993 115
348 3300005364 Ga0070673_100007378 Ga0070673_1000073782 115
349 3300005364 Ga0070673_100213008 Ga0070673_1002130082 115
350 3300005365 Ga0070688_100003186 Ga0070688_1000031863 115
351 3300005365 Ga0070688_100031098 Ga0070688_1000310981 115
352 3300005366 Ga0070659_100226456 Ga0070659_1002264562 115
353 3300005367 Ga0070667_100003589 Ga0070667_1000035895 115
354 3300005367 Ga0070667_100011330 Ga0070667_1000113305 115
355 3300005367 Ga0070667_101451928 Ga0070667_1014519282 115
356 3300005367 Ga0070667_101507323 Ga0070667_1015073232 115
357 3300005367 Ga0070667_101592799 Ga0070667_1015927992 115
358 3300005406 Ga0070703_10327459 Ga0070703_103274591 115
359 3300005434 Ga0070709_10399805 Ga0070709_103998051 115
360 3300005434 Ga0070709_10461027 Ga0070709_104610272 115
361 3300005436 Ga0070713_100018564 Ga0070713_1000185644 115
362 3300005436 Ga0070713_100034755 Ga0070713_1000347552 115
363 3300005437 Ga0070710_10071601 Ga0070710_100716012 115
364 3300005439 Ga0070711_100127872 Ga0070711_1001278722 115
365 3300005439 Ga0070711_100152100 Ga0070711_1001521002 115
366 3300005439 Ga0070711_100158359 Ga0070711_1001583592 115
367 3300005440 Ga0070705_101843414 Ga0070705_1018434141 115
368 3300005444 Ga0070694_100104044 Ga0070694_1001040441 115
369 3300005444 Ga0070694_100343881 Ga0070694_1003438812 115
370 3300005445 Ga0070708_100061431 Ga0070708_1000614312 115
371 3300005445 Ga0070708_100607106 Ga0070708_1006071061 115
372 3300005455 Ga0070663_100525309 Ga0070663_1005253092 115
373 3300005455 Ga0070663_100607662 Ga0070663_1006076622 115
374 3300005456 Ga0070678_100000200 Ga0070678_1000002006 115
375 3300005456 Ga0070678_100003150 Ga0070678_1000031503 115
376 3300005457 Ga0070662_100004299 Ga0070662_1000042999 115
377 3300005457 Ga0070662_101234033 Ga0070662_1012340331 115
378 3300005459 Ga0068867_100001816 Ga0068867_1000018162 115
379 3300005459 Ga0068867_100181723 Ga0068867_1001817232 115
380 3300005459 Ga0068867_101460794 Ga0068867_1014607942 115
381 3300005466 Ga0070685_10002346 Ga0070685_100023462 115
382 3300005466 Ga0070685_10048537 Ga0070685_100485374 115
383 3300005467 Ga0070706_100002177 Ga0070706_10000217710 115
384 3300005467 Ga0070706_100041664 Ga0070706_1000416642 115
385 3300005467 Ga0070706_100433500 Ga0070706_1004335001 115
386 3300005467 Ga0070706_100644013 Ga0070706_1006440132 115
387 3300005468 Ga0070707_100343726 Ga0070707_1003437262 115
388 3300005468 Ga0070707_100937715 Ga0070707_1009377152 115
389 3300005471 Ga0070698_100242679 Ga0070698_1002426793 115
390 3300005471 Ga0070698_101261175 Ga0070698_1012611751 115
391 3300005471 Ga0070698_101474148 Ga0070698_1014741481 115
392 3300005518 Ga0070699_100016620 Ga0070699_1000166204 115
393 3300005530 Ga0070679_100721745 Ga0070679_1007217452 115
394 3300005535 Ga0070684_100067833 Ga0070684_1000678332 115
395 3300005535 Ga0070684_100119444 Ga0070684_1001194442 115
396 3300005536 Ga0070697_100003955 Ga0070697_1000039552 115
397 3300005536 Ga0070697_100170785 Ga0070697_1001707852 115
398 3300005539 Ga0068853_100424614 Ga0068853_1004246141 115
399 3300005539 Ga0068853_100830807 Ga0068853_1008308072 115
400 3300005539 Ga0068853_101996566 Ga0068853_1019965661 115
401 3300005543 Ga0070672_100003516 Ga0070672_1000035162 115
402 3300005543 Ga0070672_100219926 Ga0070672_1002199262 115
403 3300005544 Ga0070686_100010668 Ga0070686_1000106683 115
404 3300005545 Ga0070695_100066156 Ga0070695_1000661563 115
405 3300005545 Ga0070695_100343605 Ga0070695_1003436051 115
406 3300005546 Ga0070696_100029617 Ga0070696_1000296172 115
407 3300005546 Ga0070696_100092412 Ga0070696_1000924122 115
408 3300005546 Ga0070696_100391251 Ga0070696_1003912512 115
409 3300005547 Ga0070693_100003470 Ga0070693_1000034705 115
410 3300005547 Ga0070693_100051136 Ga0070693_1000511362 115
411 3300005548 Ga0070665_100001447 Ga0070665_10000144713 115
412 3300005548 Ga0070665_100010890 Ga0070665_1000108902 115
413 3300005548 Ga0070665_100221361 Ga0070665_1002213612 115
414 3300005549 Ga0070704_100919340 Ga0070704_1009193402 115
415 3300005563 Ga0068855_100242196 Ga0068855_1002421962 115
416 3300005563 Ga0068855_100481762 Ga0068855_1004817622 115
417 3300005564 Ga0070664_100011186 Ga0070664_1000111864 115
418 3300005564 Ga0070664_100123786 Ga0070664_1001237862 115
419 3300005564 Ga0070664_101385159 Ga0070664_1013851592 115
420 3300005577 Ga0068857_100536073 Ga0068857_1005360732 115
421 3300005577 Ga0068857_101376830 Ga0068857_1013768302 115
422 3300005578 Ga0068854_100021313 Ga0068854_1000213133 115
423 3300005578 Ga0068854_100067017 Ga0068854_1000670172 115
424 3300005578 Ga0068854_100247147 Ga0068854_1002471472 115
425 3300005614 Ga0068856_100109894 Ga0068856_1001098942 115
426 3300005614 Ga0068856_100381326 Ga0068856_1003813262 115
427 3300005614 Ga0068856_100553063 Ga0068856_1005530632 115
428 3300005614 Ga0068856_100657540 Ga0068856_1006575402 115
429 3300005614 Ga0068856_101299534 Ga0068856_1012995342 115
430 3300005615 Ga0070702_100089340 Ga0070702_1000893402 115
431 3300005615 Ga0070702_100141044 Ga0070702_1001410442 115
432 3300005616 Ga0068852_100002870 Ga0068852_1000028704 115
433 3300005616 Ga0068852_100236526 Ga0068852_1002365262 115
434 3300005616 Ga0068852_101583450 Ga0068852_1015834502 115
435 3300005617 Ga0068859_100004763 Ga0068859_1000047633 115
436 3300005617 Ga0068859_100298536 Ga0068859_1002985362 115
437 3300005617 Ga0068859_101647599 Ga0068859_1016475991 115
438 3300005618 Ga0068864_100004826 Ga0068864_1000048262 115
439 3300005618 Ga0068864_100013280 Ga0068864_1000132803 115
440 3300005618 Ga0068864_100388533 Ga0068864_1003885332 115
441 3300005718 Ga0068866_10004240 Ga0068866_100042402 115
442 3300005718 Ga0068866_10511994 Ga0068866_105119942 115
443 3300005719 Ga0068861_100185450 Ga0068861_1001854502 115
444 3300005719 Ga0068861_100238683 Ga0068861_1002386832 115
445 3300005719 Ga0068861_101312261 Ga0068861_1013122612 115
446 3300005834 Ga0068851_10004503 Ga0068851_100045033 115
447 3300005834 Ga0068851_10009674 Ga0068851_100096742 115
448 3300005834 Ga0068851_10025530 Ga0068851_100255302 115
449 3300005841 Ga0068863_100003437 Ga0068863_1000034375 115
450 3300005841 Ga0068863_100057019 Ga0068863_1000570192 115
451 3300005841 Ga0068863_100131898 Ga0068863_1001318982 115
452 3300005841 Ga0068863_101085467 Ga0068863_1010854672 115
453 3300005841 Ga0068863_101576436 Ga0068863_1015764362 115
454 3300005842 Ga0068858_100004492 Ga0068858_1000044925 115
455 3300005842 Ga0068858_100005455 Ga0068858_1000054557 115
456 3300005842 Ga0068858_101289726 Ga0068858_1012897262 115
457 3300005843 Ga0068860_100008213 Ga0068860_1000082133 115
458 3300005843 Ga0068860_100043728 Ga0068860_1000437283 115
459 3300005843 Ga0068860_100147875 Ga0068860_1001478752 115
460 3300005843 Ga0068860_100640253 Ga0068860_1006402532 115
461 3300005843 Ga0068860_101247665 Ga0068860_1012476652 115
462 3300005844 Ga0068862_100258395 Ga0068862_1002583952 115
463 3300005844 Ga0068862_100666164 Ga0068862_1006661642 115
464 3300006163 Ga0070715_10578935 Ga0070715_105789352 115
465 3300006173 Ga0070716_100019244 Ga0070716_1000192442 115
466 3300006173 Ga0070716_100070153 Ga0070716_1000701532 115
467 3300006175 Ga0070712_100014681 Ga0070712_1000146812 115
468 3300006175 Ga0070712_100407616 Ga0070712_1004076162 115
469 3300006237 Ga0097621_100015171 Ga0097621_1000151715 115
470 3300006237 Ga0097621_100046162 Ga0097621_1000461622 115
471 3300006237 Ga0097621_100090046 Ga0097621_1000900463 115
472 3300006237 Ga0097621_100391017 Ga0097621_1003910172 115
473 3300006358 Ga0068871_100001041 Ga0068871_1000010415 115
474 3300006358 Ga0068871_100033591 Ga0068871_1000335913 115
475 3300006358 Ga0068871_100100279 Ga0068871_1001002793 115
476 3300006358 Ga0068871_100672595 Ga0068871_1006725952 115
477 3300006844 Ga0075428_100906408 Ga0075428_1009064082 115
478 3300006852 Ga0075433_10051439 Ga0075433_100514394 115
479 3300006871 Ga0075434_100009598 Ga0075434_1000095988 115
480 3300006881 Ga0068865_100001927 Ga0068865_1000019272 115
481 3300006881 Ga0068865_100172820 Ga0068865_1001728202 115
482 3300006881 Ga0068865_100225712 Ga0068865_1002257122 115
483 3300006881 Ga0068865_100349449 Ga0068865_1003494492 115
484 3300006914 Ga0075436_100019321 Ga0075436_1000193214 115
485 3300006914 Ga0075436_100046702 Ga0075436_1000467022 115
486 3300006931 Ga0097620_100004763 Ga0097620_1000047633 115
487 3300006931 Ga0097620_100298535 Ga0097620_1002985352 115
488 3300006931 Ga0097620_101647571 Ga0097620_1016475711 115
489 3300007076 Ga0075435_100503143 Ga0075435_1005031432 115
490 3300007076 Ga0075435_100596340 Ga0075435_1005963402 115
491 3300009011 Ga0105251_10244730 Ga0105251_102447302 115
492 3300009093 Ga0105240_10105340 Ga0105240_101053402 115
493 3300009098 Ga0105245_10002094 Ga0105245_100020942 115
494 3300009098 Ga0105245_10082037 Ga0105245_100820373 115
495 3300009098 Ga0105245_10106808 Ga0105245_101068082 115
496 3300009098 Ga0105245_12195210 Ga0105245_121952102 115
497 3300009101 Ga0105247_10189803 Ga0105247_101898032 115
498 3300009174 Ga0105241_10028850 Ga0105241_100288502 115
499 3300009174 Ga0105241_10734094 Ga0105241_107340942 115
500 3300009174 Ga0105241_11290246 Ga0105241_112902462 115
501 3300009174 Ga0105241_11310377 Ga0105241_113103772 115
502 3300009176 Ga0105242_10113265 Ga0105242_101132652 115
503 3300009176 Ga0105242_10238169 Ga0105242_102381692 115
504 3300009176 Ga0105242_11094402 Ga0105242_110944022 115
505 3300009177 Ga0105248_10001701 Ga0105248_100017017 115
506 3300009177 Ga0105248_11004560 Ga0105248_110045602 115
507 3300009545 Ga0105237_10069691 Ga0105237_100696915 115
508 3300009545 Ga0105237_10121692 Ga0105237_101216923 115
509 3300009551 Ga0105238_10068737 Ga0105238_100687372 115
510 3300009551 Ga0105238_10193408 Ga0105238_101934082 115
511 3300009551 Ga0105238_10213369 Ga0105238_102133692 115
512 3300009553 Ga0105249_10172220 Ga0105249_101722202 115
513 3300009553 Ga0105249_10977131 Ga0105249_109771312 115
514 3300010375 Ga0105239_10508872 Ga0105239_105088722 115
515 3300011119 Ga0105246_10015253 Ga0105246_100152535 115
516 3300011119 Ga0105246_10343005 Ga0105246_103430052 115
517 3300012492 Ga0157335_1038528 Ga0157335_10385282 115
518 3300012497 Ga0157319_1031713 Ga0157319_10317132 115
519 3300013100 Ga0157373_10132472 Ga0157373_101324722 115
520 3300013100 Ga0157373_10831315 Ga0157373_108313152 115
521 3300013102 Ga0157371_10146774 Ga0157371_101467742 115
522 3300013104 Ga0157370_10054056 Ga0157370_100540562 115
523 3300013105 Ga0157369_10272367 Ga0157369_102723672 115
524 3300013105 Ga0157369_11044279 Ga0157369_110442792 115
525 3300013105 Ga0157369_11605096 Ga0157369_116050961 115
526 3300013296 Ga0157374_10004890 Ga0157374_100048902 115
527 3300013296 Ga0157374_10012603 Ga0157374_100126035 115
528 3300013296 Ga0157374_10029804 Ga0157374_100298044 115
529 3300013297 Ga0157378_10019423 Ga0157378_100194232 115
530 3300013297 Ga0157378_10065242 Ga0157378_100652422 115
531 3300013297 Ga0157378_10484180 Ga0157378_104841802 115
532 3300013306 Ga0163162_10002112 Ga0163162_100021122 115
533 3300013306 Ga0163162_10002653 Ga0163162_100026536 115
534 3300013306 Ga0163162_10118524 Ga0163162_101185242 115
535 3300013307 Ga0157372_10098133 Ga0157372_100981332 115
536 3300013307 Ga0157372_10170779 Ga0157372_101707792 115
537 3300013307 Ga0157372_13098919 Ga0157372_130989192 115
538 3300013308 Ga0157375_10006548 Ga0157375_100065484 115
539 3300013308 Ga0157375_10116475 Ga0157375_101164752 115
540 3300013308 Ga0157375_10457352 Ga0157375_104573522 115
541 3300013308 Ga0157375_11900538 Ga0157375_119005382 115
542 3300014325 Ga0163163_12073768 Ga0163163_120737682 115
543 3300014326 Ga0157380_10650702 Ga0157380_106507022 115
544 3300014326 Ga0157380_11166477 Ga0157380_111664772 115
545 3300014745 Ga0157377_10026156 Ga0157377_100261562 115
546 3300014745 Ga0157377_11743835 Ga0157377_117438351 115
547 3300014968 Ga0157379_10001106 Ga0157379_100011062 115
548 3300014968 Ga0157379_10050312 Ga0157379_100503122 115
549 3300014969 Ga0157376_10001970 Ga0157376_100019702 115
550 3300014969 Ga0157376_10131535 Ga0157376_101315352 115
551 3300014969 Ga0157376_10165860 Ga0157376_101658603 115
552 3300014969 Ga0157376_11790699 Ga0157376_117906992 115
553 3300017792 Ga0163161_10009441 Ga0163161_100094412 115
554 3300025315 Ga0207697_10041299 Ga0207697_100412993 115
555 3300025321 Ga0207656_10017342 Ga0207656_100173422 115
556 3300025321 Ga0207656_10224135 Ga0207656_102241351 115
557 3300025885 Ga0207653_10203298 Ga0207653_102032981 115
558 3300025893 Ga0207682_10291255 Ga0207682_102912552 115
559 3300025898 Ga0207692_10014177 Ga0207692_100141772 115
560 3300025898 Ga0207692_10170454 Ga0207692_101704542 115
561 3300025898 Ga0207692_10851231 Ga0207692_108512312 115
562 3300025899 Ga0207642_10000974 Ga0207642_100009742 115
563 3300025899 Ga0207642_10647038 Ga0207642_106470382 115
564 3300025903 Ga0207680_10001982 Ga0207680_100019826 115
565 3300025903 Ga0207680_10218988 Ga0207680_102189882 115
566 3300025905 Ga0207685_10006487 Ga0207685_100064872 115
567 3300025905 Ga0207685_10632267 Ga0207685_106322672 115
568 3300025906 Ga0207699_10066559 Ga0207699_100665592 115
569 3300025907 Ga0207645_10001058 Ga0207645_1000105820 115
570 3300025907 Ga0207645_10184954 Ga0207645_101849542 115
571 3300025909 Ga0207705_10078861 Ga0207705_100788613 115
572 3300025910 Ga0207684_10037844 Ga0207684_100378442 115
573 3300025910 Ga0207684_10101330 Ga0207684_101013302 115
574 3300025910 Ga0207684_10106282 Ga0207684_101062822 115
575 3300025911 Ga0207654_10064933 Ga0207654_100649332 115
576 3300025911 Ga0207654_10125505 Ga0207654_101255052 115
577 3300025911 Ga0207654_10311393 Ga0207654_103113932 115
578 3300025912 Ga0207707_10061036 Ga0207707_100610362 115
579 3300025913 Ga0207695_10419839 Ga0207695_104198392 115
580 3300025915 Ga0207693_10002975 Ga0207693_100029756 115
581 3300025915 Ga0207693_10059619 Ga0207693_100596193 115
582 3300025916 Ga0207663_10083523 Ga0207663_100835232 115
583 3300025916 Ga0207663_10599683 Ga0207663_105996832 115
584 3300025916 Ga0207663_11088797 Ga0207663_110887972 115
585 3300025917 Ga0207660_10082588 Ga0207660_100825882 115
586 3300025918 Ga0207662_10080367 Ga0207662_100803672 115
587 3300025919 Ga0207657_10004934 Ga0207657_100049342 115
588 3300025919 Ga0207657_11090432 Ga0207657_110904322 115
589 3300025920 Ga0207649_10368293 Ga0207649_103682932 115
590 3300025921 Ga0207652_10111575 Ga0207652_101115752 115
591 3300025922 Ga0207646_10017711 Ga0207646_100177114 115
592 3300025922 Ga0207646_10038017 Ga0207646_100380172 115
593 3300025922 Ga0207646_10118233 Ga0207646_101182332 115
594 3300025922 Ga0207646_10620375 Ga0207646_106203752 115
595 3300025923 Ga0207681_10009784 Ga0207681_100097846 115
596 3300025923 Ga0207681_10115981 Ga0207681_101159812 115
597 3300025923 Ga0207681_10619399 Ga0207681_106193992 115
598 3300025924 Ga0207694_10082798 Ga0207694_100827982 115
599 3300025924 Ga0207694_10360232 Ga0207694_103602322 115
600 3300025925 Ga0207650_10021570 Ga0207650_100215704 115
601 3300025925 Ga0207650_10028783 Ga0207650_100287833 115
602 3300025925 Ga0207650_10034275 Ga0207650_100342752 115
603 3300025925 Ga0207650_10185592 Ga0207650_101855922 115
604 3300025925 Ga0207650_10230724 Ga0207650_102307243 115
605 3300025925 Ga0207650_10255416 Ga0207650_102554161 115
606 3300025925 Ga0207650_10885078 Ga0207650_108850782 115
607 3300025926 Ga0207659_10000739 Ga0207659_100007396 115
608 3300025926 Ga0207659_10279706 Ga0207659_102797062 115
609 3300025927 Ga0207687_10023872 Ga0207687_100238722 115
610 3300025927 Ga0207687_10024630 Ga0207687_100246302 115
611 3300025927 Ga0207687_10480488 Ga0207687_104804882 115
612 3300025928 Ga0207700_10075216 Ga0207700_100752162 115
613 3300025928 Ga0207700_10106194 Ga0207700_101061942 115
614 3300025931 Ga0207644_10004900 Ga0207644_100049002 115
615 3300025931 Ga0207644_10040621 Ga0207644_100406213 115
616 3300025931 Ga0207644_10043560 Ga0207644_100435603 115
617 3300025931 Ga0207644_11279485 Ga0207644_112794852 115
618 3300025931 Ga0207644_11354346 Ga0207644_113543462 115
619 3300025932 Ga0207690_10153753 Ga0207690_101537532 115
620 3300025932 Ga0207690_10607480 Ga0207690_106074802 115
621 3300025933 Ga0207706_10099578 Ga0207706_100995782 115
622 3300025933 Ga0207706_10553112 Ga0207706_105531122 115
623 3300025933 Ga0207706_10966485 Ga0207706_109664852 115
624 3300025934 Ga0207686_10000315 Ga0207686_1000031518 115
625 3300025934 Ga0207686_10355449 Ga0207686_103554492 115
626 3300025935 Ga0207709_10777763 Ga0207709_107777632 115
627 3300025936 Ga0207670_10007822 Ga0207670_100078222 115
628 3300025936 Ga0207670_10129703 Ga0207670_101297032 115
629 3300025937 Ga0207669_10040819 Ga0207669_100408192 115
630 3300025937 Ga0207669_10056737 Ga0207669_100567373 115
631 3300025938 Ga0207704_10001306 Ga0207704_100013064 115
632 3300025938 Ga0207704_10289057 Ga0207704_102890572 115
633 3300025938 Ga0207704_10395589 Ga0207704_103955892 115
634 3300025938 Ga0207704_10622089 Ga0207704_106220892 115
635 3300025939 Ga0207665_10013218 Ga0207665_100132182 115
636 3300025939 Ga0207665_10017508 Ga0207665_100175084 115
637 3300025940 Ga0207691_10000041 Ga0207691_1000004168 115
638 3300025940 Ga0207691_10298931 Ga0207691_102989312 115
639 3300025940 Ga0207691_10372734 Ga0207691_103727342 115
640 3300025941 Ga0207711_10000934 Ga0207711_100009342 115
641 3300025941 Ga0207711_10001347 Ga0207711_100013476 115
642 3300025942 Ga0207689_10003613 Ga0207689_100036134 115
643 3300025942 Ga0207689_10044332 Ga0207689_100443322 115
644 3300025942 Ga0207689_10049582 Ga0207689_100495822 115
645 3300025942 Ga0207689_10079763 Ga0207689_100797632 115
646 3300025944 Ga0207661_10181883 Ga0207661_101818832 115
647 3300025945 Ga0207679_10030361 Ga0207679_100303612 115
648 3300025945 Ga0207679_10405293 Ga0207679_104052932 115
649 3300025945 Ga0207679_11264173 Ga0207679_112641732 115
650 3300025949 Ga0207667_10150534 Ga0207667_101505342 115
651 3300025949 Ga0207667_10530075 Ga0207667_105300752 115
652 3300025960 Ga0207651_10002868 Ga0207651_100028686 115
653 3300025960 Ga0207651_10008943 Ga0207651_100089435 115
654 3300025961 Ga0207712_10117167 Ga0207712_101171672 115
655 3300025961 Ga0207712_10313564 Ga0207712_103135642 115
656 3300025972 Ga0207668_10022678 Ga0207668_100226783 115
657 3300025972 Ga0207668_10067191 Ga0207668_100671912 115
658 3300025981 Ga0207640_10097190 Ga0207640_100971902 115
659 3300025981 Ga0207640_10149059 Ga0207640_101490592 115
660 3300025981 Ga0207640_10226403 Ga0207640_102264032 115
661 3300025986 Ga0207658_10007536 Ga0207658_100075362 115
662 3300025986 Ga0207658_10011830 Ga0207658_100118305 115
663 3300025986 Ga0207658_10222288 Ga0207658_102222882 115
664 3300025986 Ga0207658_10674105 Ga0207658_106741052 115
665 3300026023 Ga0207677_10000112 Ga0207677_1000011240 115
666 3300026023 Ga0207677_10000232 Ga0207677_1000023212 115
667 3300026023 Ga0207677_10003482 Ga0207677_100034822 115
668 3300026023 Ga0207677_10004436 Ga0207677_100044365 115
669 3300026023 Ga0207677_10884018 Ga0207677_108840182 115
670 3300026035 Ga0207703_10004690 Ga0207703_100046902 115
671 3300026035 Ga0207703_10010253 Ga0207703_100102533 115
672 3300026035 Ga0207703_10490667 Ga0207703_104906672 115
673 3300026041 Ga0207639_10047156 Ga0207639_100471564 115
674 3300026041 Ga0207639_10236768 Ga0207639_102367682 115
675 3300026041 Ga0207639_11128705 Ga0207639_111287052 115
676 3300026067 Ga0207678_10124494 Ga0207678_101244943 115
677 3300026067 Ga0207678_10169095 Ga0207678_101690952 115
678 3300026067 Ga0207678_10235436 Ga0207678_102354362 115
679 3300026078 Ga0207702_10071215 Ga0207702_100712152 115
680 3300026078 Ga0207702_10181329 Ga0207702_101813292 115
681 3300026078 Ga0207702_10391842 Ga0207702_103918422 115
682 3300026078 Ga0207702_11230919 Ga0207702_112309191 115
683 3300026078 Ga0207702_11472166 Ga0207702_114721661 115
684 3300026088 Ga0207641_10009275 Ga0207641_100092752 115
685 3300026088 Ga0207641_10192991 Ga0207641_101929912 115
686 3300026088 Ga0207641_10307698 Ga0207641_103076982 115
687 3300026089 Ga0207648_10000601 Ga0207648_1000060115 115
688 3300026089 Ga0207648_10333556 Ga0207648_103335562 115
689 3300026089 Ga0207648_10540499 Ga0207648_105404992 115
690 3300026089 Ga0207648_11378201 Ga0207648_113782012 115
691 3300026095 Ga0207676_10001973 Ga0207676_100019735 115
692 3300026095 Ga0207676_10005593 Ga0207676_100055932 115
693 3300026095 Ga0207676_10743469 Ga0207676_107434692 115
694 3300026116 Ga0207674_10028821 Ga0207674_100288212 115
695 3300026116 Ga0207674_11292503 Ga0207674_112925032 115
696 3300026118 Ga0207675_100023855 Ga0207675_1000238552 115
697 3300026118 Ga0207675_100065421 Ga0207675_1000654212 115
698 3300026118 Ga0207675_100949358 Ga0207675_1009493582 115
699 3300026121 Ga0207683_10000011 Ga0207683_1000001149 115
700 3300026121 Ga0207683_10001380 Ga0207683_1000138019 115
701 3300026121 Ga0207683_10932688 Ga0207683_109326881 115
702 3300026142 Ga0207698_10146733 Ga0207698_101467332 115
703 3300026142 Ga0207698_12177500 Ga0207698_121775002 115
704 3300028379 Ga0268266_10022303 Ga0268266_100223033 115
705 3300028379 Ga0268266_10041420 Ga0268266_100414202 115
706 3300028379 Ga0268266_10356093 Ga0268266_103560932 115
707 3300028380 Ga0268265_10037462 Ga0268265_100374622 115
708 3300028380 Ga0268265_10313581 Ga0268265_103135812 115
709 3300028381 Ga0268264_10001396 Ga0268264_100013969 115
710 3300028381 Ga0268264_10048228 Ga0268264_100482282 115
711 3300028381 Ga0268264_10736117 Ga0268264_107361172 115
712 3300035083 Ga0373926_0036616 Ga0373926_0036616_1066_1416 115
713 3300035084 Ga0373928_0260454 Ga0373928_0260454_124_474 115
714 3300035086 Ga0373934_0015891 Ga0373934_0015891_743_1093 115
715 3300035091 Ga0373951_0140500 Ga0373951_0140500_284_634 115
716 3300035111 Ga0373923_0011822 Ga0373923_0011822_2835_3185 115
717 3300035116 Ga0373945_0007255 Ga0373945_0007255_1143_1490 115
718 3300035116 Ga0373945_0091816 Ga0373945_0091816_809_1159 115
719 3300035118 Ga0373954_0001619 Ga0373954_0001619_1831_2181 115
720 3300035119 Ga0373956_0009565 Ga0373956_0009565_1137_1487 115
721 3300035120 Ga0373957_0098387 Ga0373957_0098387_174_521 115
722 3300035170 Ga0373943_0007593 Ga0373943_0007593_1981_2331 115
723 3300035170 Ga0373943_0154262 Ga0373943_0154262_208_555 115
724 3300035171 Ga0373946_0052500 Ga0373946_0052500_412_762 115
725 3300035171 Ga0373946_0084357 Ga0373946_0084357_701_1048 115
726 3300035172 Ga0373955_0049502 Ga0373955_0049502_737_1087 115
727 3300035172 Ga0373955_0362219 Ga0373955_0362219_515_862 115
728 3300035242 Ga0373962_0182455 Ga0373962_0182455_193_543 115
729 3300035410 Ga0373924_0008951 Ga0373924_0008951_1625_1975 115
730 3300035410 Ga0373924_0209304 Ga0373924_0209304_325_675 115
731 3300035410 Ga0373924_0249169 Ga0373924_0249169_139_486 115
732 3300035691 Ga0373931_0151210 Ga0373931_0151210_382_732 115
733 3300035692 Ga0373935_0026452 Ga0373935_0026452_1066_1416 115
734 3300035692 Ga0373935_0094455 Ga0373935_0094455_1128_1475 115
735 3300035692 Ga0373935_0257832 Ga0373935_0257832_218_565 115
736 3300035692 Ga0373935_0479087 Ga0373935_0479087_380_730 115
737 3300035692 Ga0373935_0867380 Ga0373935_0867380_21_368 115
738 3300035695 Ga0373927_0006222 Ga0373927_0006222_3583_3930 115
739 3300035695 Ga0373927_0031549 Ga0373927_0031549_2500_2850 115
740 3300035695 Ga0373927_0080199 Ga0373927_0080199_1073_1420 115
741 3300035695 Ga0373927_0133697 Ga0373927_0133697_758_1105 115
742 3300035695 Ga0373927_0309310 Ga0373927_0309310_426_773 115
743 3300035724 Ga0373933_0045591 Ga0373933_0045591_1692_2042 115
744 3300035725 Ga0373947_0003277 Ga0373947_0003277_6264_6611 115
745 3300035725 Ga0373947_0016537 Ga0373947_0016537_59_409 115
746 3300035725 Ga0373947_0349811 Ga0373947_0349811_397_747 115
747 3300035725 Ga0373947_0549110 Ga0373947_0549110_27_374 115
748 3300036401 Ga0373937_0006916 Ga0373937_0006916_1059_1406 115
749 3300036401 Ga0373937_0234752 Ga0373937_0234752_28_375 115
750 3300036401 Ga0373937_0298820 Ga0373937_0298820_11_361 115
751 3300036401 Ga0373937_0828763 Ga0373937_0828763_407_754 115
752 3300036401 Ga0373937_0969690 Ga0373937_0969690_145_492 115
753 3300037068 Ga0373925_0021569 Ga0373925_0021569_3168_3515 115
754 3300037068 Ga0373925_0057184 Ga0373925_0057184_537_884 115
755 3300037068 Ga0373925_0244101 Ga0373925_0244101_876_1223 115
756 3300037068 Ga0373925_0249700 Ga0373925_0249700_890_1240 115
757 3300041492 Ga0451835_1159940 Ga0451835_1159940_160_510 115
758 3300046454 Ga0495592_0813422 Ga0495592_0813422_52_402 115
759 3300046459 Ga0495629_0012122 Ga0495629_0012122_2916_3263 115
760 3300046462 Ga0495651_0060828 Ga0495651_0060828_1157_1504 115
761 3300046463 Ga0495653_0063020 Ga0495653_0063020_1605_1952 115
762 3300046472 Ga0495580_0008291 Ga0495580_0008291_6472_6819 115
763 3300046472 Ga0495580_0063574 Ga0495580_0063574_1753_2100 115
764 3300046472 Ga0495580_0099455 Ga0495580_0099455_59_409 115
765 3300046475 Ga0495639_0018538 Ga0495639_0018538_1422_1769 115
766 3300046477 Ga0495664_0001368 Ga0495664_0001368_7823_8170 115
767 3300046511 Ga0495608_0084344 Ga0495608_0084344_277_627 115
768 3300046516 Ga0495628_0048104 Ga0495628_0048104_1508_1855 115
769 3300046517 Ga0495630_0147262 Ga0495630_0147262_1064_1414 115
770 3300046517 Ga0495630_0530143 Ga0495630_0530143_237_584 115
771 3300046525 Ga0495663_0391655 Ga0495663_0391655_62_409 115
772 3300046528 Ga0495642_0232570 Ga0495642_0232570_156_509 115
773 3300046531 Ga0495665_0128445 Ga0495665_0128445_625_975 115
774 3300046536 Ga0495587_0085390 Ga0495587_0085390_1229_1579 115
775 3300046539 Ga0495621_0080875 Ga0495621_0080875_682_1029 115
776 3300046543 Ga0495645_0018538 Ga0495645_0018538_3083_3430 115
777 3300046543 Ga0495645_0078781 Ga0495645_0078781_459_809 115
778 3300046559 Ga0495667_0099190 Ga0495667_0099190_15_362 115
779 3300046642 Ga0495634_0328463 Ga0495634_0328463_218_565 115
780 3300046663 Ga0495635_0004423 Ga0495635_0004423_9165_9512 115
781 3300046663 Ga0495635_0034435 Ga0495635_0034435_30_377 115
782 3300046663 Ga0495635_0087081 Ga0495635_0087081_1596_1946 115
783 3300046675 Ga0495657_0069280 Ga0495657_0069280_750_1100 115
784 3300046678 Ga0495599_0060718 Ga0495599_0060718_866_1216 115
785 3300046679 Ga0495623_0065629 Ga0495623_0065629_1752_2102 115
786 3300046680 Ga0495646_0199259 Ga0495646_0199259_36_386 115
787 3300046681 Ga0495647_0001693 Ga0495647_0001693_3763_4110 115
788 3300046681 Ga0495647_0008363 Ga0495647_0008363_92_439 115
789 3300046689 Ga0495613_0005266 Ga0495613_0005266_9021_9368 115
790 3300046690 Ga0495624_0117773 Ga0495624_0117773_1143_1490 115
791 3300046809 Ga0495600_0007268 Ga0495600_0007268_4799_5146 115
792 3300047315 Ga0495581_0431839 Ga0495581_0431839_372_722 115
793 3300047317 Ga0495604_0108186 Ga0495604_0108186_1666_2016 115
794 3300047318 Ga0495636_0388524 Ga0495636_0388524_44_403 115
795 3300047319 Ga0495674_0523878 Ga0495674_0523878_353_703 115
796 3300047322 Ga0495680_0037844 Ga0495680_0037844_1835_2182 115
797 3300047444 Ga0495675_0097950 Ga0495675_0097950_101_451 115
798 3300047471 Ga0495684_0003986 Ga0495684_0003986_144_491 115
799 3300047471 Ga0495684_0127643 Ga0495684_0127643_1288_1638 115
800 3300048904 Ga0496101_0114222 Ga0496101_0114222_535_885 115
801 3300048904 Ga0496101_0198031 Ga0496101_0198031_111_458 115
802 3300048904 Ga0496101_1632892 Ga0496101_1632892_121_471 115
803 3300048905 Ga0496102_0117571 Ga0496102_0117571_1238_1588 115
804 3300048906 Ga0496103_0372255 Ga0496103_0372255_454_804 115
805 3300048907 Ga0496104_0005138 Ga0496104_0005138_2781_3131 115
806 3300048908 Ga0496105_0102754 Ga0496105_0102754_150_500 115
807 3300048908 Ga0496105_0303123 Ga0496105_0303123_853_1203 115
808 3300048909 Ga0496106_0082298 Ga0496106_0082298_1711_2061 115
809 3300048909 Ga0496106_0538310 Ga0496106_0538310_220_567 115
810 3300048910 Ga0496107_0100631 Ga0496107_0100631_1004_1354 115
811 3300048911 Ga0496108_0592699 Ga0496108_0592699_33_380 115
812 3300048912 Ga0496109_0015328 Ga0496109_0015328_3164_3514 115
813 3300048912 Ga0496109_0209102 Ga0496109_0209102_725_1072 115
814 3300048913 Ga0496110_0203925 Ga0496110_0203925_1058_1408 115
815 3300048913 Ga0496110_0335575 Ga0496110_0335575_262_609 115
816 3300048914 Ga0496111_0096310 Ga0496111_0096310_1765_2115 115
817 3300048915 Ga0496112_0023091 Ga0496112_0023091_2525_2875 115
818 3300048915 Ga0496112_0402385 Ga0496112_0402385_334_684 115
819 3300048917 Ga0496114_0398708 Ga0496114_0398708_551_901 115
820 3300048918 Ga0496115_0115084 Ga0496115_0115084_1526_1876 115
821 3300048918 Ga0496115_0644781 Ga0496115_0644781_165_515 115
822 3300050512 nmdc:mga0n895_63697_c1 nmdc:mga0n895_63697_c1_2305_2664 115
823 3300050514 nmdc:mga08x19_230358_c1 nmdc:mga08x19_230358_c1_818_1177 115
824 3300050515 nmdc:mga0a205_438124_c1 nmdc:mga0a205_438124_c1_577_936 115
825 3300053077 Ga0495601_0068845 Ga0495601_0068845_38_385 115
826 3300053078 Ga0495612_0026148 Ga0495612_0026148_861_1211 115
827 3300053084 Ga0495595_0450360 Ga0495595_0450360_37_384 115
828 3300053085 Ga0495619_0004347 Ga0495619_0004347_1538_1885 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01627

Hpt

Hpt domain

42

132

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c1i-assembly2.cif.gz_E crystal structure of histidine-containing phosphotransfer protein b (hptb) from pseudomonas aeruginosa pao1 0.9004 2 114
1qsp-assembly2.cif.gz_B crystal structure of the yeast phosphorelay protein ypd1 0.8992 5 83
1oxk-assembly1.cif.gz_A complex between ypd1 and sln1 response regulator domain in space group p3(2) 0.8927 5 83
5kbx-assembly1.cif.gz_A co-crystal structure of the saccharomyces cerevisiae histidine phosphotransfer signaling protein ypd1 and the receiver domain of its downstream response regulator ssk1 0.8845 5 83
1c02-assembly1.cif.gz_B crystal structure of yeast ypd1p 0.8539 1 83
ID Description Score Start End Superfamily
af_P39453_805_912_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.9102 5 114 1.20.120.160
5kbxA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.8843 5 83 1.20.120.160
af_Q54RR8_9_125_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.8782 1 114 1.20.120.160
af_Q59WC6_9_184_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.8673 5 83 1.20.120.160
af_Q54RR8_9_125_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.857 1 114 1.20.120.160
ID Description Score Start End GO Terms
AF-A0A537A203-F1-model_v4 Hpt domain-containing protein 0.9611 1 115 GO:0000160
GO:0004672
AF-A0A363U2T6-F1-model_v4 Histidine kinase 0.954 4 113 GO:0000160
GO:0016301
AF-A0A0Q6WMZ3-F1-model_v4 HPt domain-containing protein 0.9533 5 115 GO:0000160
GO:0004672
AF-A0A363TDN0-F1-model_v4 HPt domain-containing protein 0.9517 1 113 GO:0000160
AF-A0A2W5F749-F1-model_v4 HPt domain-containing protein 0.9508 1 115 GO:0000160
GO:0004672

Feature Viewer

pLDDT pTM Quality
93.77 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map