F482462

General Info

Members Datasets Scaffolds Average Seq Length
826 239 1652 131

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10178445|JGI24737J22298_101784451
Length 135
Sequence MGGQMPIELKIAALGALLLFVHIFAATRFKTAQYGRAWNVGARDETLPPANPITGRMMRAQANFQETFPIAIVALLGVVLANKTSATTALGGWIWLGARVVYLPLYAAGVPVVRTVVWTVGTGGLVMVIWPLLVG

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 6.17
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10178445 3300001990 Bacteria 627
2 JGI24741J21665_1009536 3300001915 Bacteria 1779
3 JGI24752J21851_1010656 3300001976 Bacteria 1199
4 JGI24752J21851_1015669 3300001976 Bacteria 988
5 JGI24740J21852_10001858 3300001979 Bacteria 9669
6 JGI24740J21852_10003302 3300001979 Bacteria 7106
7 JGI24739J22299_10028526 3300001989 Bacteria 1946
8 JGI24739J22299_10041163 3300001989 Bacteria 1539
9 JGI24739J22299_10050607 3300001989 Bacteria 1343
10 JGI24737J22298_10013689 3300001990 Bacteria 2637
11 JGI24737J22298_10172996 3300001990 Unclassified 637
12 JGI24743J22301_10003697 3300001991 Bacteria 2442
13 JGI24743J22301_10026962 3300001991 Bacteria 1120
14 JGI24735J21928_10049420 3300002067 Bacteria 1215
15 JGI24738J21930_10007364 3300002075 Bacteria 2542
16 Ga0065704_10474278 3300005289 Bacteria 687
17 Ga0065712_10085702 3300005290 Bacteria 2680
18 Ga0065712_10323596 3300005290 Bacteria 824
19 Ga0065712_10352056 3300005290 Unclassified 786
20 Ga0065715_10191339 3300005293 Bacteria 1412
21 Ga0065715_10350595 3300005293 Bacteria 951
22 Ga0070658_10022301 3300005327 Bacteria 5081
23 Ga0070658_10034314 3300005327 Bacteria 4082
24 Ga0070658_10996407 3300005327 Bacteria 729
25 Ga0070676_10025571 3300005328 Bacteria 3338
26 Ga0070676_10028372 3300005328 Bacteria 3179
27 Ga0070676_10034317 3300005328 Bacteria 2914
28 Ga0070676_10102611 3300005328 Bacteria 1769
29 Ga0070676_10282097 3300005328 Bacteria 1120
30 Ga0070676_10679818 3300005328 Bacteria 750
31 Ga0070683_100330521 3300005329 Bacteria 1451
32 Ga0070683_100493296 3300005329 Bacteria 1170
33 Ga0070683_100936297 3300005329 Bacteria 831
34 Ga0070690_100022837 3300005330 Bacteria 3831
35 Ga0070690_100149858 3300005330 Bacteria 1591
36 Ga0070670_100008911 3300005331 Bacteria 8566
37 Ga0070670_100056767 3300005331 Bacteria 3361
38 Ga0070670_100120639 3300005331 Bacteria 2262
39 Ga0070670_100157309 3300005331 Bacteria 1969
40 Ga0070670_101914838 3300005331 Bacteria 546
41 Ga0070677_10180935 3300005333 Bacteria 1004
42 Ga0070677_10672320 3300005333 Bacteria 580
43 Ga0068869_100036955 3300005334 Bacteria 3470
44 Ga0068869_100559789 3300005334 Bacteria 961
45 Ga0070666_10000207 3300005335 Bacteria 40445
46 Ga0070666_10001711 3300005335 Bacteria 13383
47 Ga0070666_10055657 3300005335 Bacteria 2670
48 Ga0070666_10072348 3300005335 Bacteria 2347
49 Ga0070666_10143534 3300005335 Bacteria 1663
50 Ga0070666_10202230 3300005335 Bacteria 1398
51 Ga0070666_10864896 3300005335 Bacteria 668
52 Ga0070666_11020708 3300005335 Unclassified 614
53 Ga0070680_100131968 3300005336 Bacteria 2090
54 Ga0070682_100081931 3300005337 Bacteria 2090
55 Ga0068868_100004278 3300005338 Bacteria 9996
56 Ga0068868_100127610 3300005338 Bacteria 2079
57 Ga0068868_100163991 3300005338 Bacteria 1837
58 Ga0068868_100360881 3300005338 Bacteria 1246
59 Ga0068868_100381155 3300005338 Bacteria 1213
60 Ga0068868_100390634 3300005338 Bacteria 1199
61 Ga0068868_100403480 3300005338 Bacteria 1180
62 Ga0070660_100032148 3300005339 Bacteria 3947
63 Ga0070660_100040988 3300005339 Bacteria 3527
64 Ga0070660_100131159 3300005339 Bacteria 2005
65 Ga0070660_100250764 3300005339 Bacteria 1443
66 Ga0070660_100267330 3300005339 Bacteria 1397
67 Ga0070660_100284852 3300005339 Bacteria 1352
68 Ga0070660_100356050 3300005339 Unclassified 1206
69 Ga0070660_100598756 3300005339 Bacteria 921
70 Ga0070689_100338468 3300005340 Bacteria 1260
71 Ga0070689_100902147 3300005340 Bacteria 782
72 Ga0070691_10012259 3300005341 Bacteria 3924
73 Ga0070691_10415681 3300005341 Bacteria 761
74 Ga0070687_100121073 3300005343 Bacteria 1497
75 Ga0070687_100494132 3300005343 Bacteria 822
76 Ga0070687_100593020 3300005343 Bacteria 760
77 Ga0070661_100004957 3300005344 Bacteria 9168
78 Ga0070661_100033261 3300005344 Bacteria 3734
79 Ga0070661_100096557 3300005344 Bacteria 2193
80 Ga0070661_100300382 3300005344 Bacteria 1250
81 Ga0070661_100397130 3300005344 Bacteria 1090
82 Ga0070661_100496379 3300005344 Bacteria 976
83 Ga0070692_10001759 3300005345 Bacteria 8088
84 Ga0070668_100011746 3300005347 Bacteria 6521
85 Ga0070668_100443868 3300005347 Bacteria 1114
86 Ga0070668_101021612 3300005347 Bacteria 744
87 Ga0070669_100023723 3300005353 Bacteria 4395
88 Ga0070669_100077434 3300005353 Bacteria 2471
89 Ga0070669_100188025 3300005353 Bacteria 1619
90 Ga0070669_100345214 3300005353 Bacteria 1207
91 Ga0070669_100581412 3300005353 Bacteria 937
92 Ga0070669_101368387 3300005353 Bacteria 614
93 Ga0070669_101906457 3300005353 Bacteria 519
94 Ga0070675_100037906 3300005354 Bacteria 3928
95 Ga0070675_100100607 3300005354 Bacteria 2434
96 Ga0070675_100167292 3300005354 Bacteria 1894
97 Ga0070675_101565733 3300005354 Bacteria 608
98 Ga0070671_100001852 3300005355 Bacteria 16123
99 Ga0070671_100065997 3300005355 Bacteria 3015
100 Ga0070671_100072548 3300005355 Bacteria 2875
101 Ga0070671_100083912 3300005355 Bacteria 2664
102 Ga0070671_100158914 3300005355 Bacteria 1910
103 Ga0070671_100311673 3300005355 Bacteria 1340
104 Ga0070671_100691179 3300005355 Bacteria 884
105 Ga0070674_100043260 3300005356 Bacteria 3063
106 Ga0070674_100102372 3300005356 Bacteria 2088
107 Ga0070674_100111812 3300005356 Bacteria 2007
108 Ga0070674_100112251 3300005356 Bacteria 2003
109 Ga0070674_100180815 3300005356 Bacteria 1615
110 Ga0070674_100193752 3300005356 Bacteria 1565
111 Ga0070674_100199501 3300005356 Bacteria 1544
112 Ga0070674_100221699 3300005356 Bacteria 1471
113 Ga0070674_100431062 3300005356 Bacteria 1084
114 Ga0070674_102113571 3300005356 Bacteria 514
115 Ga0070673_100004288 3300005364 Bacteria 9003
116 Ga0070673_100016808 3300005364 Bacteria 5185
117 Ga0070673_100016995 3300005364 Bacteria 5162
118 Ga0070673_100050975 3300005364 Bacteria 3239
119 Ga0070673_100188882 3300005364 Bacteria 1768
120 Ga0070673_100567370 3300005364 Bacteria 1032
121 Ga0070673_101281061 3300005364 Unclassified 688
122 Ga0070673_101409524 3300005364 Unclassified 656
123 Ga0070659_100000790 3300005366 Bacteria 23055
124 Ga0070659_100019869 3300005366 Bacteria 5098
125 Ga0070659_100149709 3300005366 Bacteria 1903
126 Ga0070659_100185870 3300005366 Bacteria 1707
127 Ga0070659_100679062 3300005366 Bacteria 889
128 Ga0070659_100763375 3300005366 Bacteria 839
129 Ga0070659_101495571 3300005366 Unclassified 602
130 Ga0070667_100008602 3300005367 Bacteria 8460
131 Ga0070667_100010288 3300005367 Bacteria 7729
132 Ga0070667_100013410 3300005367 Bacteria 6774
133 Ga0070667_100021153 3300005367 Bacteria 5405
134 Ga0070667_100103321 3300005367 Bacteria 2463
135 Ga0070667_100179060 3300005367 Bacteria 1874
136 Ga0070667_100311690 3300005367 Bacteria 1418
137 Ga0070667_100519513 3300005367 Bacteria 1092
138 Ga0070667_100654076 3300005367 Unclassified 970
139 Ga0070667_100790402 3300005367 Unclassified 881
140 Ga0070667_101027821 3300005367 Unclassified 769
141 Ga0070713_100024818 3300005436 Bacteria 4677
142 Ga0070700_100811623 3300005441 Bacteria 754
143 Ga0070694_100000834 3300005444 Bacteria 17307
144 Ga0070663_100090984 3300005455 Bacteria 2260
145 Ga0070663_100291468 3300005455 Bacteria 1304
146 Ga0070663_100385542 3300005455 Bacteria 1142
147 Ga0070663_100668014 3300005455 Bacteria 880
148 Ga0070663_100864386 3300005455 Bacteria 779
149 Ga0070663_101374434 3300005455 Bacteria 625
150 Ga0070678_100003096 3300005456 Bacteria 9220
151 Ga0070678_100084867 3300005456 Bacteria 2411
152 Ga0070678_100128028 3300005456 Bacteria 2013
153 Ga0070678_100151141 3300005456 Bacteria 1870
154 Ga0070678_100408213 3300005456 Unclassified 1181
155 Ga0070662_100005759 3300005457 Bacteria 7942
156 Ga0070662_100013376 3300005457 Bacteria 5461
157 Ga0070662_100023820 3300005457 Bacteria 4210
158 Ga0070662_100056539 3300005457 Bacteria 2849
159 Ga0070662_100060048 3300005457 Bacteria 2771
160 Ga0070662_100076729 3300005457 Bacteria 2478
161 Ga0070662_100089376 3300005457 Bacteria 2310
162 Ga0070662_100130563 3300005457 Bacteria 1936
163 Ga0070662_100498560 3300005457 Bacteria 1015
164 Ga0070662_100880158 3300005457 Bacteria 764
165 Ga0070681_10468708 3300005458 Bacteria 1172
166 Ga0068867_100039988 3300005459 Bacteria 3420
167 Ga0068867_100121301 3300005459 Bacteria 2021
168 Ga0068867_100160102 3300005459 Bacteria 1775
169 Ga0068867_100540781 3300005459 Unclassified 1007
170 Ga0068867_100545759 3300005459 Bacteria 1003
171 Ga0070685_10355267 3300005466 Bacteria 1003
172 Ga0070685_10433274 3300005466 Bacteria 917
173 Ga0070706_101373809 3300005467 Unclassified 647
174 Ga0070684_100037938 3300005535 Bacteria 4136
175 Ga0068853_100061463 3300005539 Bacteria 3249
176 Ga0068853_100249979 3300005539 Bacteria 1627
177 Ga0068853_101465811 3300005539 Bacteria 661
178 Ga0068853_101636577 3300005539 Bacteria 624
179 Ga0070672_100007115 3300005543 Bacteria 7568
180 Ga0070672_100037782 3300005543 Bacteria 3685
181 Ga0070672_100099452 3300005543 Bacteria 2357
182 Ga0070672_100100505 3300005543 Bacteria 2346
183 Ga0070672_100267761 3300005543 Bacteria 1442
184 Ga0070672_100458795 3300005543 Bacteria 1098
185 Ga0070672_100699181 3300005543 Bacteria 888
186 Ga0070672_101236969 3300005543 Bacteria 666
187 Ga0070672_101690110 3300005543 Unclassified 569
188 Ga0070686_100085046 3300005544 Bacteria 2103
189 Ga0070686_100839494 3300005544 Bacteria 743
190 Ga0070695_100600091 3300005545 Bacteria 864
191 Ga0070696_100376705 3300005546 Bacteria 1105
192 Ga0070693_100309277 3300005547 Unclassified 1068
193 Ga0070665_100113415 3300005548 Bacteria 2713
194 Ga0070665_100139363 3300005548 Bacteria 2429
195 Ga0070665_100160529 3300005548 Bacteria 2250
196 Ga0070665_100206947 3300005548 Bacteria 1963
197 Ga0070665_100343182 3300005548 Bacteria 1498
198 Ga0068855_100110451 3300005563 Bacteria 3157
199 Ga0068855_100143287 3300005563 Bacteria 2722
200 Ga0068855_100796186 3300005563 Bacteria 1005
201 Ga0068855_101655203 3300005563 Bacteria 654
202 Ga0070664_100006485 3300005564 Bacteria 9431
203 Ga0070664_100033538 3300005564 Bacteria 4302
204 Ga0070664_100042270 3300005564 Bacteria 3848
205 Ga0070664_100048069 3300005564 Bacteria 3605
206 Ga0070664_100107825 3300005564 Bacteria 2428
207 Ga0070664_100134830 3300005564 Bacteria 2170
208 Ga0070664_100223437 3300005564 Bacteria 1685
209 Ga0070664_100535128 3300005564 Bacteria 1082
210 Ga0070664_100663624 3300005564 Bacteria 970
211 Ga0068857_100021397 3300005577 Bacteria 5693
212 Ga0068857_100022926 3300005577 Bacteria 5492
213 Ga0068857_100055828 3300005577 Bacteria 3504
214 Ga0068857_100166736 3300005577 Bacteria 2001
215 Ga0068857_100313978 3300005577 Bacteria 1446
216 Ga0068857_100433226 3300005577 Bacteria 1227
217 Ga0068854_100015391 3300005578 Bacteria 5066
218 Ga0068854_100174976 3300005578 Bacteria 1672
219 Ga0068854_100298394 3300005578 Bacteria 1303
220 Ga0068854_100905369 3300005578 Unclassified 776
221 Ga0068854_101021767 3300005578 Bacteria 733
222 Ga0068854_101500801 3300005578 Bacteria 612
223 Ga0068854_101756877 3300005578 Bacteria 568
224 Ga0068856_100150823 3300005614 Bacteria 2334
225 Ga0068856_100196661 3300005614 Bacteria 2030
226 Ga0068852_100040971 3300005616 Bacteria 3911
227 Ga0068852_100200572 3300005616 Bacteria 1888
228 Ga0068852_100238237 3300005616 Bacteria 1737
229 Ga0068852_100368072 3300005616 Bacteria 1407
230 Ga0068852_100375612 3300005616 Bacteria 1393
231 Ga0068852_101267016 3300005616 Bacteria 759
232 Ga0068859_100025365 3300005617 Bacteria 5948
233 Ga0068859_100044703 3300005617 Bacteria 4450
234 Ga0068859_100234365 3300005617 Unclassified 1924
235 Ga0068859_100444429 3300005617 Bacteria 1393
236 Ga0068859_100601331 3300005617 Bacteria 1193
237 Ga0068864_100024911 3300005618 Bacteria 5034
238 Ga0068864_100046535 3300005618 Bacteria 3723
239 Ga0068864_100091862 3300005618 Bacteria 2679
240 Ga0068864_100457585 3300005618 Unclassified 1221
241 Ga0068864_101460542 3300005618 Bacteria 686
242 Ga0068864_101663991 3300005618 Bacteria 643
243 Ga0068864_102281323 3300005618 Bacteria 548
244 Ga0068866_10051014 3300005718 Bacteria 2104
245 Ga0068866_10052223 3300005718 Bacteria 2085
246 Ga0068866_10080224 3300005718 Bacteria 1750
247 Ga0068866_10402763 3300005718 Bacteria 883
248 Ga0068866_10932508 3300005718 Bacteria 613
249 Ga0068861_101154463 3300005719 Bacteria 747
250 Ga0068851_10005270 3300005834 Bacteria 5869
251 Ga0068851_10102144 3300005834 Bacteria 1523
252 Ga0068851_10157052 3300005834 Bacteria 1247
253 Ga0068851_10832002 3300005834 Bacteria 575
254 Ga0068870_10081603 3300005840 Bacteria 1789
255 Ga0068870_10746782 3300005840 Unclassified 679
256 Ga0068863_100010267 3300005841 Bacteria 9103
257 Ga0068863_100056113 3300005841 Bacteria 3729
258 Ga0068863_100061720 3300005841 Bacteria 3544
259 Ga0068863_100457794 3300005841 Bacteria 1253
260 Ga0068863_101304574 3300005841 Bacteria 733
261 Ga0068858_100000537 3300005842 Bacteria 39482
262 Ga0068858_100001012 3300005842 Bacteria 28969
263 Ga0068858_100045809 3300005842 Bacteria 4054
264 Ga0068858_100053190 3300005842 Bacteria 3746
265 Ga0068858_100107150 3300005842 Bacteria 2608
266 Ga0068858_100310430 3300005842 Bacteria 1506
267 Ga0068860_100000674 3300005843 Bacteria 39467
268 Ga0068860_100079491 3300005843 Bacteria 3118
269 Ga0068860_100243706 3300005843 Bacteria 1749
270 Ga0068860_100394577 3300005843 Bacteria 1368
271 Ga0068860_100972837 3300005843 Bacteria 866
272 Ga0068860_101339171 3300005843 Bacteria 737
273 Ga0068862_100019864 3300005844 Bacteria 5610
274 Ga0068862_102488096 3300005844 Unclassified 529
275 Ga0070717_10002447 3300006028 Bacteria 13108
276 Ga0075432_10407817 3300006058 Bacteria 588
277 Ga0070716_100043503 3300006173 Bacteria 2512
278 Ga0097621_100001132 3300006237 Bacteria 18531
279 Ga0097621_100094431 3300006237 Bacteria 2507
280 Ga0097621_102094053 3300006237 Unclassified 541
281 Ga0068871_100009161 3300006358 Bacteria 7155
282 Ga0068871_100072168 3300006358 Bacteria 2842
283 Ga0068871_100549894 3300006358 Bacteria 1045
284 Ga0075431_101245217 3300006847 Bacteria 706
285 Ga0075433_10034113 3300006852 Bacteria 4369
286 Ga0068865_100028382 3300006881 Bacteria 3704
287 Ga0068865_100154000 3300006881 Bacteria 1747
288 Ga0068865_100295429 3300006881 Bacteria 1295
289 Ga0068865_100453685 3300006881 Bacteria 1061
290 Ga0068865_100515562 3300006881 Bacteria 999
291 Ga0097620_100025365 3300006931 Bacteria 5948
292 Ga0097620_100044701 3300006931 Bacteria 4450
293 Ga0097620_100234357 3300006931 Unclassified 1924
294 Ga0097620_100444419 3300006931 Bacteria 1393
295 Ga0097620_100601350 3300006931 Bacteria 1193
296 Ga0075435_100110597 3300007076 Bacteria 2285
297 Ga0105240_10308896 3300009093 Bacteria 1806
298 Ga0105240_10368913 3300009093 Bacteria 1624
299 Ga0105245_10005782 3300009098 Bacteria 10850
300 Ga0105245_10036801 3300009098 Bacteria 4349
301 Ga0105245_11023470 3300009098 Bacteria 871
302 Ga0105243_10061843 3300009148 Bacteria 2996
303 Ga0105243_10210075 3300009148 Bacteria 1713
304 Ga0105243_10249426 3300009148 Bacteria 1584
305 Ga0105243_10447322 3300009148 Bacteria 1211
306 Ga0105243_10541412 3300009148 Bacteria 1111
307 Ga0105241_10096026 3300009174 Bacteria 2347
308 Ga0105241_11650060 3300009174 Bacteria 621
309 Ga0105241_12276268 3300009174 Bacteria 539
310 Ga0105242_10012879 3300009176 Bacteria 6445
311 Ga0105242_10232472 3300009176 Bacteria 1653
312 Ga0105242_10531188 3300009176 Bacteria 1124
313 Ga0105248_10006139 3300009177 Bacteria 13174
314 Ga0105248_10017710 3300009177 Bacteria 7858
315 Ga0105248_10020480 3300009177 Bacteria 7328
316 Ga0105248_10041996 3300009177 Bacteria 5128
317 Ga0105248_10106452 3300009177 Bacteria 3162
318 Ga0105248_10159613 3300009177 Bacteria 2544
319 Ga0105248_10246454 3300009177 Bacteria 2011
320 Ga0105248_10305547 3300009177 Bacteria 1791
321 Ga0105248_10314744 3300009177 Bacteria 1763
322 Ga0105248_10410265 3300009177 Bacteria 1525
323 Ga0105237_10132129 3300009545 Bacteria 2490
324 Ga0105238_10027319 3300009551 Bacteria 5813
325 Ga0105238_10176529 3300009551 Bacteria 2113
326 Ga0105238_11100583 3300009551 Bacteria 817
327 Ga0105249_10001854 3300009553 Bacteria 18363
328 Ga0105249_10035963 3300009553 Bacteria 4493
329 Ga0105249_12231656 3300009553 Unclassified 620
330 Ga0105246_10218510 3300011119 Bacteria 1492
331 Ga0105246_10405954 3300011119 Bacteria 1133
332 Ga0157373_10042177 3300013100 Bacteria 3262
333 Ga0157373_10048822 3300013100 Bacteria 3017
334 Ga0157373_10078423 3300013100 Bacteria 2329
335 Ga0157373_10221276 3300013100 Bacteria 1335
336 Ga0157373_11054285 3300013100 Unclassified 608
337 Ga0157371_10035320 3300013102 Bacteria 3582
338 Ga0157371_10138206 3300013102 Bacteria 1735
339 Ga0157371_10178797 3300013102 Bacteria 1517
340 Ga0157371_10244322 3300013102 Bacteria 1292
341 Ga0157371_11231332 3300013102 Bacteria 577
342 Ga0157370_10477861 3300013104 Bacteria 1145
343 Ga0157369_10265816 3300013105 Bacteria 1788
344 Ga0157369_10934810 3300013105 Bacteria 889
345 Ga0157374_10001881 3300013296 Bacteria 17636
346 Ga0157374_10017701 3300013296 Bacteria 6280
347 Ga0157374_10582288 3300013296 Bacteria 1128
348 Ga0157374_11277858 3300013296 Bacteria 756
349 Ga0157378_10039972 3300013297 Bacteria 4160
350 Ga0157378_10236413 3300013297 Bacteria 1743
351 Ga0157378_10470030 3300013297 Bacteria 1251
352 Ga0157378_12453864 3300013297 Bacteria 573
353 Ga0163162_10000299 3300013306 Bacteria 45521
354 Ga0163162_10028542 3300013306 Bacteria 5522
355 Ga0163162_10061880 3300013306 Bacteria 3782
356 Ga0163162_10078878 3300013306 Bacteria 3359
357 Ga0163162_10102168 3300013306 Bacteria 2960
358 Ga0157372_10006237 3300013307 Bacteria 12677
359 Ga0157372_10118298 3300013307 Bacteria 3040
360 Ga0157372_10922419 3300013307 Bacteria 1013
361 Ga0157375_10002179 3300013308 Bacteria 16935
362 Ga0157375_10053868 3300013308 Bacteria 3961
363 Ga0157375_10162487 3300013308 Bacteria 2376
364 Ga0157375_10373902 3300013308 Bacteria 1591
365 Ga0163163_10001414 3300014325 Bacteria 20293
366 Ga0163163_10024998 3300014325 Bacteria 5689
367 Ga0163163_10375408 3300014325 Bacteria 1479
368 Ga0157380_10042641 3300014326 Bacteria 3547
369 Ga0157380_10341206 3300014326 Unclassified 1397
370 Ga0157377_10077986 3300014745 Bacteria 1930
371 Ga0157379_10001085 3300014968 Bacteria 22205
372 Ga0157379_10105380 3300014968 Bacteria 2530
373 Ga0157379_10930147 3300014968 Bacteria 826
374 Ga0157376_10029632 3300014969 Bacteria 4361
375 Ga0157376_10647448 3300014969 Bacteria 1057
376 Ga0163161_10703332 3300017792 Bacteria 842
377 Ga0197907_10389534 3300020069 Bacteria 796
378 Ga0206356_10690267 3300020070 Bacteria 771
379 Ga0207697_10005598 3300025315 Bacteria 5815
380 Ga0207697_10040227 3300025315 Bacteria 1920
381 Ga0207656_10125763 3300025321 Bacteria 1197
382 Ga0207656_10129349 3300025321 Bacteria 1182
383 Ga0207656_10171161 3300025321 Bacteria 1038
384 Ga0207656_10189748 3300025321 Bacteria 989
385 Ga0207656_10516913 3300025321 Bacteria 607
386 Ga0207682_10015637 3300025893 Bacteria 2955
387 Ga0207642_10034255 3300025899 Bacteria 2157
388 Ga0207642_10077221 3300025899 Bacteria 1606
389 Ga0207642_10306221 3300025899 Bacteria 923
390 Ga0207642_10609063 3300025899 Bacteria 681
391 Ga0207688_10027264 3300025901 Bacteria 3142
392 Ga0207680_10001898 3300025903 Bacteria 9803
393 Ga0207680_10007284 3300025903 Bacteria 5383
394 Ga0207680_10032511 3300025903 Bacteria 2966
395 Ga0207680_10170168 3300025903 Bacteria 1467
396 Ga0207680_10277911 3300025903 Bacteria 1163
397 Ga0207680_10317703 3300025903 Bacteria 1088
398 Ga0207680_10420622 3300025903 Bacteria 946
399 Ga0207647_10000767 3300025904 Bacteria 25053
400 Ga0207647_10005042 3300025904 Bacteria 9736
401 Ga0207647_10008681 3300025904 Bacteria 7259
402 Ga0207647_10015895 3300025904 Bacteria 5148
403 Ga0207647_10043530 3300025904 Bacteria 2809
404 Ga0207645_10050624 3300025907 Bacteria 2652
405 Ga0207645_10063810 3300025907 Bacteria 2354
406 Ga0207645_10880164 3300025907 Bacteria 609
407 Ga0207645_11095148 3300025907 Bacteria 537
408 Ga0207643_10083702 3300025908 Bacteria 1851
409 Ga0207643_10481891 3300025908 Bacteria 792
410 Ga0207705_10018728 3300025909 Bacteria 4953
411 Ga0207705_10051119 3300025909 Bacteria 2975
412 Ga0207705_10059051 3300025909 Bacteria 2767
413 Ga0207705_10376377 3300025909 Bacteria 1096
414 Ga0207705_10394388 3300025909 Bacteria 1070
415 Ga0207705_11179091 3300025909 Bacteria 588
416 Ga0207654_10170529 3300025911 Bacteria 1413
417 Ga0207707_10482941 3300025912 Unclassified 1058
418 Ga0207695_10015358 3300025913 Bacteria 9017
419 Ga0207695_10669220 3300025913 Bacteria 919
420 Ga0207671_10191486 3300025914 Bacteria 1595
421 Ga0207660_10023014 3300025917 Bacteria 4204
422 Ga0207662_10104988 3300025918 Bacteria 1755
423 Ga0207657_10009035 3300025919 Bacteria 10062
424 Ga0207657_10019760 3300025919 Bacteria 6386
425 Ga0207657_10039470 3300025919 Bacteria 4195
426 Ga0207657_10120087 3300025919 Bacteria 2163
427 Ga0207657_10120123 3300025919 Bacteria 2163
428 Ga0207657_10179369 3300025919 Bacteria 1713
429 Ga0207657_10263884 3300025919 Bacteria 1370
430 Ga0207657_10502472 3300025919 Bacteria 950
431 Ga0207657_10707448 3300025919 Bacteria 782
432 Ga0207657_11327081 3300025919 Unclassified 543
433 Ga0207649_10010601 3300025920 Bacteria 5067
434 Ga0207649_10098452 3300025920 Bacteria 1930
435 Ga0207649_10119547 3300025920 Bacteria 1774
436 Ga0207649_10129151 3300025920 Unclassified 1714
437 Ga0207649_10193785 3300025920 Bacteria 1431
438 Ga0207649_10309492 3300025920 Bacteria 1157
439 Ga0207649_10417647 3300025920 Bacteria 1007
440 Ga0207652_10314994 3300025921 Bacteria 1412
441 Ga0207681_10053148 3300025923 Bacteria 2750
442 Ga0207681_10111166 3300025923 Bacteria 1993
443 Ga0207681_10133201 3300025923 Bacteria 1841
444 Ga0207681_10172799 3300025923 Bacteria 1639
445 Ga0207681_10320006 3300025923 Bacteria 1233
446 Ga0207681_11102044 3300025923 Bacteria 667
447 Ga0207694_10036792 3300025924 Bacteria 3757
448 Ga0207650_10002596 3300025925 Bacteria 12498
449 Ga0207650_10095648 3300025925 Bacteria 2277
450 Ga0207650_10145801 3300025925 Bacteria 1864
451 Ga0207650_10174316 3300025925 Bacteria 1711
452 Ga0207650_10273280 3300025925 Bacteria 1374
453 Ga0207650_11184439 3300025925 Bacteria 650
454 Ga0207659_10025627 3300025926 Bacteria 3966
455 Ga0207659_10103835 3300025926 Bacteria 2148
456 Ga0207659_10317507 3300025926 Bacteria 1284
457 Ga0207659_10604899 3300025926 Bacteria 935
458 Ga0207659_10714051 3300025926 Bacteria 859
459 Ga0207659_10844123 3300025926 Bacteria 787
460 Ga0207687_10017725 3300025927 Bacteria 4693
461 Ga0207687_10214151 3300025927 Bacteria 1513
462 Ga0207664_10093291 3300025929 Bacteria 2472
463 Ga0207644_10001777 3300025931 Bacteria 13945
464 Ga0207644_10006220 3300025931 Bacteria 7784
465 Ga0207644_10007710 3300025931 Bacteria 7024
466 Ga0207644_10018462 3300025931 Bacteria 4719
467 Ga0207644_10109085 3300025931 Bacteria 2090
468 Ga0207644_10146332 3300025931 Bacteria 1824
469 Ga0207644_10210091 3300025931 Bacteria 1538
470 Ga0207644_11002166 3300025931 Unclassified 701
471 Ga0207690_10001613 3300025932 Bacteria 14054
472 Ga0207690_10004887 3300025932 Bacteria 7907
473 Ga0207690_10021598 3300025932 Bacteria 3994
474 Ga0207690_10024586 3300025932 Bacteria 3774
475 Ga0207690_10149315 3300025932 Bacteria 1731
476 Ga0207690_10274422 3300025932 Unclassified 1311
477 Ga0207690_10497284 3300025932 Bacteria 986
478 Ga0207706_10004448 3300025933 Bacteria 13167
479 Ga0207706_10007897 3300025933 Bacteria 9820
480 Ga0207706_10010239 3300025933 Bacteria 8573
481 Ga0207706_10010364 3300025933 Bacteria 8513
482 Ga0207706_10041751 3300025933 Bacteria 4066
483 Ga0207706_10074512 3300025933 Bacteria 2985
484 Ga0207706_10108793 3300025933 Unclassified 2439
485 Ga0207706_10138753 3300025933 Bacteria 2139
486 Ga0207706_10166649 3300025933 Bacteria 1936
487 Ga0207706_10175180 3300025933 Bacteria 1884
488 Ga0207706_10468868 3300025933 Bacteria 1088
489 Ga0207706_10841455 3300025933 Bacteria 778
490 Ga0207686_10214000 3300025934 Bacteria 1387
491 Ga0207686_10282539 3300025934 Bacteria 1226
492 Ga0207709_10101911 3300025935 Bacteria 1900
493 Ga0207709_10240592 3300025935 Bacteria 1316
494 Ga0207709_10381140 3300025935 Bacteria 1073
495 Ga0207709_10755797 3300025935 Unclassified 782
496 Ga0207670_11015748 3300025936 Bacteria 698
497 Ga0207669_10016762 3300025937 Bacteria 3735
498 Ga0207669_10184719 3300025937 Bacteria 1498
499 Ga0207669_10228433 3300025937 Bacteria 1371
500 Ga0207669_10306038 3300025937 Bacteria 1210
501 Ga0207669_10336812 3300025937 Bacteria 1160
502 Ga0207704_10022605 3300025938 Bacteria 3373
503 Ga0207704_10057635 3300025938 Bacteria 2387
504 Ga0207704_10242274 3300025938 Bacteria 1348
505 Ga0207665_10301500 3300025939 Bacteria 1198
506 Ga0207691_10001938 3300025940 Bacteria 20198
507 Ga0207691_10013272 3300025940 Bacteria 7892
508 Ga0207691_10043002 3300025940 Bacteria 4165
509 Ga0207691_10049913 3300025940 Bacteria 3832
510 Ga0207691_10057749 3300025940 Bacteria 3530
511 Ga0207691_10092324 3300025940 Bacteria 2711
512 Ga0207691_10217963 3300025940 Bacteria 1656
513 Ga0207691_10218589 3300025940 Bacteria 1653
514 Ga0207691_10373240 3300025940 Bacteria 1218
515 Ga0207711_10000639 3300025941 Bacteria 35104
516 Ga0207711_10002376 3300025941 Bacteria 16846
517 Ga0207711_10002816 3300025941 Bacteria 15278
518 Ga0207711_10019331 3300025941 Bacteria 5673
519 Ga0207711_10029677 3300025941 Bacteria 4613
520 Ga0207711_10133287 3300025941 Bacteria 2229
521 Ga0207711_10135108 3300025941 Bacteria 2215
522 Ga0207711_10244765 3300025941 Bacteria 1645
523 Ga0207711_10791144 3300025941 Bacteria 883
524 Ga0207711_10915400 3300025941 Bacteria 815
525 Ga0207689_10019500 3300025942 Bacteria 5716
526 Ga0207661_10026487 3300025944 Bacteria 4418
527 Ga0207661_10497883 3300025944 Bacteria 1113
528 Ga0207679_10004299 3300025945 Bacteria 8859
529 Ga0207679_10029163 3300025945 Bacteria 3839
530 Ga0207679_10029340 3300025945 Bacteria 3829
531 Ga0207679_10044041 3300025945 Bacteria 3218
532 Ga0207679_10049271 3300025945 Bacteria 3073
533 Ga0207679_10060517 3300025945 Bacteria 2814
534 Ga0207667_10041179 3300025949 Bacteria 4915
535 Ga0207667_10084543 3300025949 Bacteria 3285
536 Ga0207667_10234702 3300025949 Bacteria 1878
537 Ga0207667_10307519 3300025949 Bacteria 1619
538 Ga0207667_10595058 3300025949 Bacteria 1116
539 Ga0207667_11172475 3300025949 Bacteria 749
540 Ga0207651_10001758 3300025960 Bacteria 10045
541 Ga0207651_10015200 3300025960 Bacteria 4466
542 Ga0207651_10086388 3300025960 Bacteria 2279
543 Ga0207651_10100400 3300025960 Bacteria 2145
544 Ga0207651_10259317 3300025960 Bacteria 1426
545 Ga0207651_10863598 3300025960 Bacteria 805
546 Ga0207651_10983570 3300025960 Bacteria 753
547 Ga0207651_11060890 3300025960 Unclassified 725
548 Ga0207712_10000846 3300025961 Bacteria 22347
549 Ga0207712_10022768 3300025961 Bacteria 4130
550 Ga0207668_10051810 3300025972 Bacteria 2837
551 Ga0207668_10094447 3300025972 Bacteria 2205
552 Ga0207640_10026484 3300025981 Bacteria 3521
553 Ga0207640_10132388 3300025981 Bacteria 1805
554 Ga0207640_10162451 3300025981 Bacteria 1654
555 Ga0207640_10508459 3300025981 Bacteria 1004
556 Ga0207640_10624248 3300025981 Bacteria 915
557 Ga0207658_10001050 3300025986 Bacteria 22409
558 Ga0207658_10007036 3300025986 Bacteria 7657
559 Ga0207658_10011885 3300025986 Bacteria 5934
560 Ga0207658_10172642 3300025986 Bacteria 1782
561 Ga0207658_10292441 3300025986 Bacteria 1400
562 Ga0207658_10375635 3300025986 Bacteria 1244
563 Ga0207658_10424495 3300025986 Bacteria 1173
564 Ga0207658_10559937 3300025986 Bacteria 1024
565 Ga0207658_10696523 3300025986 Bacteria 918
566 Ga0207658_10880426 3300025986 Unclassified 815
567 Ga0207677_10000516 3300026023 Bacteria 24878
568 Ga0207677_10001844 3300026023 Bacteria 11193
569 Ga0207677_10044463 3300026023 Bacteria 2959
570 Ga0207677_10111908 3300026023 Bacteria 2035
571 Ga0207677_10649744 3300026023 Bacteria 931
572 Ga0207677_11263613 3300026023 Unclassified 677
573 Ga0207703_10006703 3300026035 Bacteria 9188
574 Ga0207703_10021144 3300026035 Bacteria 5093
575 Ga0207703_10042372 3300026035 Bacteria 3651
576 Ga0207703_10176349 3300026035 Bacteria 1883
577 Ga0207703_10476767 3300026035 Bacteria 1169
578 Ga0207703_11802454 3300026035 Unclassified 588
579 Ga0207639_10011835 3300026041 Bacteria 6067
580 Ga0207639_10229237 3300026041 Bacteria 1609
581 Ga0207639_11233192 3300026041 Bacteria 702
582 Ga0207678_10000680 3300026067 Bacteria 31116
583 Ga0207678_10005278 3300026067 Bacteria 11569
584 Ga0207678_10491078 3300026067 Bacteria 1070
585 Ga0207678_10524782 3300026067 Bacteria 1034
586 Ga0207678_10564125 3300026067 Unclassified 996
587 Ga0207678_10962814 3300026067 Bacteria 755
588 Ga0207678_11371349 3300026067 Bacteria 625
589 Ga0207702_10014274 3300026078 Bacteria 6597
590 Ga0207702_10027771 3300026078 Bacteria 4701
591 Ga0207641_10040174 3300026088 Bacteria 3915
592 Ga0207641_10112942 3300026088 Bacteria 2411
593 Ga0207641_10382849 3300026088 Bacteria 1347
594 Ga0207641_10390542 3300026088 Bacteria 1334
595 Ga0207641_12267034 3300026088 Bacteria 543
596 Ga0207641_12267150 3300026088 Unclassified 543
597 Ga0207648_10006402 3300026089 Bacteria 11702
598 Ga0207648_10015717 3300026089 Bacteria 6946
599 Ga0207648_10224263 3300026089 Bacteria 1671
600 Ga0207648_10717377 3300026089 Bacteria 927
601 Ga0207648_10847091 3300026089 Bacteria 853
602 Ga0207676_10002744 3300026095 Bacteria 12538
603 Ga0207676_10014886 3300026095 Bacteria 5602
604 Ga0207676_10016832 3300026095 Bacteria 5294
605 Ga0207676_10317025 3300026095 Unclassified 1430
606 Ga0207676_12445742 3300026095 Bacteria 519
607 Ga0207674_10002878 3300026116 Bacteria 21384
608 Ga0207674_10016334 3300026116 Bacteria 8131
609 Ga0207674_10030888 3300026116 Bacteria 5631
610 Ga0207674_10153268 3300026116 Bacteria 2261
611 Ga0207674_10640910 3300026116 Bacteria 1026
612 Ga0207675_100107492 3300026118 Bacteria 2631
613 Ga0207675_100321354 3300026118 Bacteria 1511
614 Ga0207683_10003383 3300026121 Bacteria 13909
615 Ga0207683_10016119 3300026121 Bacteria 6360
616 Ga0207683_10089333 3300026121 Bacteria 2742
617 Ga0207683_10145554 3300026121 Bacteria 2137
618 Ga0207683_10360678 3300026121 Bacteria 1335
619 Ga0207683_10758208 3300026121 Bacteria 900
620 Ga0207698_10001175 3300026142 Bacteria 15258
621 Ga0207698_10049330 3300026142 Bacteria 3203
622 Ga0207698_10154992 3300026142 Bacteria 1994
623 Ga0207698_10312857 3300026142 Bacteria 1467
624 Ga0207698_10453345 3300026142 Bacteria 1239
625 Ga0207698_10854857 3300026142 Bacteria 915
626 Ga0207698_11276212 3300026142 Bacteria 749
627 Ga0268266_10023127 3300028379 Bacteria 5290
628 Ga0268266_10088810 3300028379 Bacteria 2705
629 Ga0268266_10226583 3300028379 Bacteria 1720
630 Ga0268266_10414265 3300028379 Bacteria 1276
631 Ga0268266_10430657 3300028379 Bacteria 1251
632 Ga0268266_12313521 3300028379 Bacteria 509
633 Ga0268265_10011424 3300028380 Bacteria 6003
634 Ga0268265_10045492 3300028380 Bacteria 3275
635 Ga0268265_10875427 3300028380 Bacteria 880
636 Ga0268264_10000268 3300028381 Bacteria 91477
637 Ga0268264_10258159 3300028381 Bacteria 1622
638 Ga0268264_10566774 3300028381 Bacteria 1116
639 Ga0268264_10644588 3300028381 Bacteria 1048
640 Ga0307408_100510134 3300031548 Bacteria 1054
641 Ga0307408_101047029 3300031548 Bacteria 754
642 Ga0307405_10021766 3300031731 Bacteria 3610
643 Ga0307405_10181000 3300031731 Bacteria 1513
644 Ga0307405_10278386 3300031731 Bacteria 1258
645 Ga0307405_10390158 3300031731 Bacteria 1087
646 Ga0307410_10159502 3300031852 Bacteria 1688
647 Ga0307410_10185534 3300031852 Bacteria 1578
648 Ga0307406_10474882 3300031901 Bacteria 1008
649 Ga0307406_11152953 3300031901 Bacteria 671
650 Ga0307407_10093698 3300031903 Bacteria 1847
651 Ga0307407_10651629 3300031903 Bacteria 789
652 Ga0307407_10778244 3300031903 Bacteria 726
653 Ga0307412_10088658 3300031911 Bacteria 2159
654 Ga0307412_10241376 3300031911 Bacteria 1397
655 Ga0307409_100020610 3300031995 Bacteria 4498
656 Ga0307409_100164299 3300031995 Bacteria 1946
657 Ga0307409_102290920 3300031995 Bacteria 569
658 Ga0307409_102298859 3300031995 Bacteria 568
659 Ga0307416_100000426 3300032002 Bacteria 21506
660 Ga0307416_100106626 3300032002 Bacteria 2456
661 Ga0307416_100297464 3300032002 Bacteria 1602
662 Ga0307416_100429262 3300032002 Bacteria 1368
663 Ga0307416_100652698 3300032002 Bacteria 1137
664 Ga0307416_101279551 3300032002 Unclassified 839
665 Ga0307414_10293624 3300032004 Bacteria 1371
666 Ga0307411_10104711 3300032005 Bacteria 2010
667 Ga0307411_10195297 3300032005 Bacteria 1549
668 Ga0307411_10274492 3300032005 Bacteria 1338
669 Ga0307411_11859859 3300032005 Bacteria 560
670 Ga0307415_100025551 3300032126 Bacteria 3708
671 Ga0307415_100309386 3300032126 Bacteria 1312
672 Ga0373959_0065319 3300034820 Bacteria 813
673 Ga0373949_0056109 3300035090 Bacteria 1004
674 Ga0373952_0166110 3300035092 Unclassified 628
675 Ga0373941_0153007 3300035115 Bacteria 848
676 Ga0373954_0109583 3300035118 Bacteria 1335
677 Ga0373956_0091194 3300035119 Bacteria 1406
678 Ga0373942_0032224 3300035207 Bacteria 1391
679 Ga0373962_0016096 3300035242 Bacteria 1925
680 Ga0373931_0678182 3300035691 Bacteria 679
681 Ga0373935_0267629 3300035692 Bacteria 1200
682 Ga0373935_1457435 3300035692 Bacteria 512
683 Ga0373927_0970075 3300035695 Unclassified 561
684 Ga0373937_0038714 3300036401 Bacteria 4345
685 Ga0395899_0000157 3300037312 Bacteria 103574
686 Ga0395899_0006564 3300037312 Bacteria 9020
687 Ga0395899_0033565 3300037312 Bacteria 3853
688 Ga0395899_0095694 3300037312 Bacteria 2148
689 Ga0395899_0523610 3300037312 Bacteria 766
690 Ga0395899_0649068 3300037312 Bacteria 667
691 Ga0395900_0000296 3300037418 Bacteria 74995
692 Ga0395900_0001094 3300037418 Bacteria 34490
693 Ga0395900_0045787 3300037418 Bacteria 4506
694 Ga0395900_0050328 3300037418 Bacteria 4291
695 Ga0395900_0089095 3300037418 Bacteria 3172
696 Ga0395900_0127385 3300037418 Bacteria 2610
697 Ga0395900_0189370 3300037418 Bacteria 2088
698 Ga0395900_0251538 3300037418 Bacteria 1768
699 Ga0395900_0480128 3300037418 Bacteria 1195
700 Ga0395900_0555702 3300037418 Bacteria 1092
701 Ga0395900_0714069 3300037418 Bacteria 935
702 Ga0395898_0000054 3300037466 Bacteria 279561
703 Ga0395898_0034839 3300037466 Bacteria 5011
704 Ga0395898_0115557 3300037466 Bacteria 2571
705 Ga0395898_0143772 3300037466 Bacteria 2283
706 Ga0395898_0158139 3300037466 Bacteria 2167
707 Ga0395898_0167535 3300037466 Bacteria 2100
708 Ga0395898_0921044 3300037466 Bacteria 812
709 Ga0395905_0000046 3300037471 Bacteria 240463
710 Ga0395905_0000897 3300037471 Bacteria 38814
711 Ga0395905_0003152 3300037471 Bacteria 17761
712 Ga0395905_0017019 3300037471 Bacteria 6902
713 Ga0395905_0025112 3300037471 Bacteria 5620
714 Ga0395905_0040688 3300037471 Bacteria 4360
715 Ga0395905_0047208 3300037471 Bacteria 4037
716 Ga0395905_0061525 3300037471 Bacteria 3512
717 Ga0395905_0184213 3300037471 Bacteria 1960
718 Ga0395905_0382964 3300037471 Bacteria 1300
719 Ga0395905_0393305 3300037471 Bacteria 1281
720 Ga0395905_0461263 3300037471 Bacteria 1169
721 Ga0395905_0684130 3300037471 Unclassified 928
722 Ga0395905_0925479 3300037471 Bacteria 775
723 Ga0395905_1246443 3300037471 Bacteria 647
724 Ga0395901_0001633 3300038443 Bacteria 23187
725 Ga0395901_0008013 3300038443 Bacteria 10668
726 Ga0395901_0013849 3300038443 Bacteria 8204
727 Ga0395901_0087624 3300038443 Bacteria 3255
728 Ga0395901_0192262 3300038443 Bacteria 2140
729 Ga0395901_0218193 3300038443 Bacteria 1994
730 Ga0395901_0374917 3300038443 Bacteria 1465
731 Ga0395901_0397899 3300038443 Bacteria 1415
732 Ga0395901_0433960 3300038443 Bacteria 1345
733 Ga0395901_0708449 3300038443 Bacteria 1003
734 Ga0395901_0980255 3300038443 Bacteria 822
735 Ga0395901_1483709 3300038443 Bacteria 634
736 Ga0439448_0117209 3300042005 Bacteria 912
737 Ga0439458_0000052 3300042157 Bacteria 19610
738 Ga0466963_0131591 3300044694 Bacteria 1728
739 Ga0466963_0439459 3300044694 Bacteria 920
740 Ga0466971_0204833 3300044719 Bacteria 932
741 Ga0466957_0076314 3300044842 Bacteria 2081
742 Ga0466958_0147235 3300045836 Bacteria 1484
743 Ga0466967_0127645 3300045976 Bacteria 2357
744 Ga0466967_2565988 3300045976 Unclassified 504
745 Ga0495583_0152054 3300046506 Bacteria 959
746 Ga0495606_0386988 3300046507 Bacteria 732
747 Ga0495610_0247663 3300046512 Bacteria 707
748 Ga0495632_0457460 3300046519 Bacteria 553
749 Ga0495644_0312155 3300046523 Bacteria 616
750 Ga0495663_0061336 3300046525 Bacteria 1183
751 Ga0495654_0139838 3300046530 Bacteria 1080
752 Ga0495598_0012601 3300046537 Bacteria 2079
753 Ga0495621_0005885 3300046539 Bacteria 3550
754 Ga0495621_0131425 3300046539 Bacteria 974
755 Ga0495621_0208394 3300046539 Bacteria 788
756 Ga0495633_0207975 3300046558 Bacteria 897
757 Ga0495633_0504464 3300046558 Bacteria 545
758 Ga0495668_0015941 3300046616 Bacteria 4377
759 Ga0495623_0147476 3300046679 Bacteria 1394
760 Ga0495669_0000231 3300046684 Bacteria 32943
761 Ga0495669_0006775 3300046684 Bacteria 4794
762 Ga0495669_0013413 3300046684 Bacteria 3491
763 Ga0495669_0107488 3300046684 Bacteria 1300
764 Ga0495669_0569782 3300046684 Unclassified 551
765 Ga0495670_0000351 3300046691 Bacteria 22005
766 Ga0495670_0182873 3300046691 Bacteria 1107
767 Ga0495677_0052330 3300047445 Bacteria 1505
768 Ga0495677_0061519 3300047445 Bacteria 1392
769 Ga0495602_0200472 3300048088 Bacteria 1523
770 Ga0496100_0211882 3300048903 Bacteria 1417
771 Ga0496100_0299751 3300048903 Bacteria 1203
772 Ga0496100_1080799 3300048903 Unclassified 632
773 Ga0496101_0207736 3300048904 Bacteria 1516
774 Ga0496101_0399143 3300048904 Bacteria 1083
775 Ga0496101_1068138 3300048904 Bacteria 634
776 Ga0496102_0108083 3300048905 Bacteria 2591
777 Ga0496102_0279999 3300048905 Bacteria 1572
778 Ga0496102_0318984 3300048905 Bacteria 1464
779 Ga0496102_0588309 3300048905 Archaea 1036
780 Ga0496103_0027975 3300048906 Bacteria 3420
781 Ga0496103_0131321 3300048906 Bacteria 1599
782 Ga0496103_0174223 3300048906 Bacteria 1382
783 Ga0496103_0340881 3300048906 Unclassified 964
784 Ga0496104_0055866 3300048907 Bacteria 3733
785 Ga0496104_0154074 3300048907 Bacteria 2206
786 Ga0496104_1809058 3300048907 Bacteria 513
787 Ga0496105_0176813 3300048908 Bacteria 1748
788 Ga0496106_0473253 3300048909 Bacteria 1006
789 Ga0496106_1348841 3300048909 Unclassified 552
790 Ga0496107_0047672 3300048910 Bacteria 3085
791 Ga0496107_0188391 3300048910 Bacteria 1532
792 Ga0496107_0472105 3300048910 Unclassified 931
793 Ga0496107_0846677 3300048910 Unclassified 668
794 Ga0496107_1130568 3300048910 Archaea 565
795 Ga0496108_0001265 3300048911 Bacteria 19767
796 Ga0496108_0168271 3300048911 Bacteria 1895
797 Ga0496109_0003663 3300048912 Bacteria 12843
798 Ga0496109_0285169 3300048912 Bacteria 1556
799 Ga0496109_0322386 3300048912 Bacteria 1458
800 Ga0496109_0343837 3300048912 Unclassified 1409
801 Ga0496109_0458720 3300048912 Bacteria 1203
802 Ga0496109_2057334 3300048912 Unclassified 503
803 Ga0496110_0003659 3300048913 Bacteria 11829
804 Ga0496110_0010816 3300048913 Bacteria 7440
805 Ga0496110_0028268 3300048913 Bacteria 4814
806 Ga0496110_0160501 3300048913 Bacteria 2038
807 Ga0496110_1050801 3300048913 Bacteria 722
808 Ga0496111_0000518 3300048914 Bacteria 19932
809 Ga0496111_0033258 3300048914 Bacteria 3676
810 Ga0496111_0333614 3300048914 Bacteria 1123
811 Ga0496112_0001853 3300048915 Bacteria 16628
812 Ga0496112_0025190 3300048915 Bacteria 5709
813 Ga0496112_0147173 3300048915 Bacteria 2324
814 Ga0496112_0265389 3300048915 Bacteria 1666
815 Ga0496113_0005985 3300048916 Bacteria 7654
816 Ga0496113_0013384 3300048916 Bacteria 5555
817 Ga0496113_0394809 3300048916 Bacteria 1110
818 Ga0496114_0000016 3300048917 Bacteria 274656
819 Ga0496114_0752221 3300048917 Bacteria 852
820 Ga0496114_1017047 3300048917 Bacteria 712
821 Ga0501067_0253582 3300049583 Bacteria 979
822 nmdc:mga06r32_1303278_c1 3300050510 Bacteria 670
823 nmdc:mga0n895_373884_c1 3300050512 Bacteria 1442
824 nmdc:mga0rr50_144050_c1 3300050513 Bacteria 1919
825 nmdc:mga0a205_26222_c1 3300050515 Bacteria 5555
826 Ga0500627_0105086 3300053158 Bacteria 1269
827 JGI24737J22298_10178445
828 JGI24741J21665_1009536
829 JGI24752J21851_1010656
830 JGI24752J21851_1015669
831 JGI24740J21852_10001858
832 JGI24740J21852_10003302
833 JGI24739J22299_10028526
834 JGI24739J22299_10041163
835 JGI24739J22299_10050607
836 JGI24737J22298_10013689
837 JGI24737J22298_10172996
838 JGI24743J22301_10003697
839 JGI24743J22301_10026962
840 JGI24735J21928_10049420
841 JGI24738J21930_10007364
842 Ga0065704_10474278
843 Ga0065712_10085702
844 Ga0065712_10323596
845 Ga0065712_10352056
846 Ga0065715_10191339
847 Ga0065715_10350595
848 Ga0070658_10022301
849 Ga0070658_10034314
850 Ga0070658_10996407
851 Ga0070676_10025571
852 Ga0070676_10028372
853 Ga0070676_10034317
854 Ga0070676_10102611
855 Ga0070676_10282097
856 Ga0070676_10679818
857 Ga0070683_100330521
858 Ga0070683_100493296
859 Ga0070683_100936297
860 Ga0070690_100022837
861 Ga0070690_100149858
862 Ga0070670_100008911
863 Ga0070670_100056767
864 Ga0070670_100120639
865 Ga0070670_100157309
866 Ga0070670_101914838
867 Ga0070677_10180935
868 Ga0070677_10672320
869 Ga0068869_100036955
870 Ga0068869_100559789
871 Ga0070666_10000207
872 Ga0070666_10001711
873 Ga0070666_10055657
874 Ga0070666_10072348
875 Ga0070666_10143534
876 Ga0070666_10202230
877 Ga0070666_10864896
878 Ga0070666_11020708
879 Ga0070680_100131968
880 Ga0070682_100081931
881 Ga0068868_100004278
882 Ga0068868_100127610
883 Ga0068868_100163991
884 Ga0068868_100360881
885 Ga0068868_100381155
886 Ga0068868_100390634
887 Ga0068868_100403480
888 Ga0070660_100032148
889 Ga0070660_100040988
890 Ga0070660_100131159
891 Ga0070660_100250764
892 Ga0070660_100267330
893 Ga0070660_100284852
894 Ga0070660_100356050
895 Ga0070660_100598756
896 Ga0070689_100338468
897 Ga0070689_100902147
898 Ga0070691_10012259
899 Ga0070691_10415681
900 Ga0070687_100121073
901 Ga0070687_100494132
902 Ga0070687_100593020
903 Ga0070661_100004957
904 Ga0070661_100033261
905 Ga0070661_100096557
906 Ga0070661_100300382
907 Ga0070661_100397130
908 Ga0070661_100496379
909 Ga0070692_10001759
910 Ga0070668_100011746
911 Ga0070668_100443868
912 Ga0070668_101021612
913 Ga0070669_100023723
914 Ga0070669_100077434
915 Ga0070669_100188025
916 Ga0070669_100345214
917 Ga0070669_100581412
918 Ga0070669_101368387
919 Ga0070669_101906457
920 Ga0070675_100037906
921 Ga0070675_100100607
922 Ga0070675_100167292
923 Ga0070675_101565733
924 Ga0070671_100001852
925 Ga0070671_100065997
926 Ga0070671_100072548
927 Ga0070671_100083912
928 Ga0070671_100158914
929 Ga0070671_100311673
930 Ga0070671_100691179
931 Ga0070674_100043260
932 Ga0070674_100102372
933 Ga0070674_100111812
934 Ga0070674_100112251
935 Ga0070674_100180815
936 Ga0070674_100193752
937 Ga0070674_100199501
938 Ga0070674_100221699
939 Ga0070674_100431062
940 Ga0070674_102113571
941 Ga0070673_100004288
942 Ga0070673_100016808
943 Ga0070673_100016995
944 Ga0070673_100050975
945 Ga0070673_100188882
946 Ga0070673_100567370
947 Ga0070673_101281061
948 Ga0070673_101409524
949 Ga0070659_100000790
950 Ga0070659_100019869
951 Ga0070659_100149709
952 Ga0070659_100185870
953 Ga0070659_100679062
954 Ga0070659_100763375
955 Ga0070659_101495571
956 Ga0070667_100008602
957 Ga0070667_100010288
958 Ga0070667_100013410
959 Ga0070667_100021153
960 Ga0070667_100103321
961 Ga0070667_100179060
962 Ga0070667_100311690
963 Ga0070667_100519513
964 Ga0070667_100654076
965 Ga0070667_100790402
966 Ga0070667_101027821
967 Ga0070713_100024818
968 Ga0070700_100811623
969 Ga0070694_100000834
970 Ga0070663_100090984
971 Ga0070663_100291468
972 Ga0070663_100385542
973 Ga0070663_100668014
974 Ga0070663_100864386
975 Ga0070663_101374434
976 Ga0070678_100003096
977 Ga0070678_100084867
978 Ga0070678_100128028
979 Ga0070678_100151141
980 Ga0070678_100408213
981 Ga0070662_100005759
982 Ga0070662_100013376
983 Ga0070662_100023820
984 Ga0070662_100056539
985 Ga0070662_100060048
986 Ga0070662_100076729
987 Ga0070662_100089376
988 Ga0070662_100130563
989 Ga0070662_100498560
990 Ga0070662_100880158
991 Ga0070681_10468708
992 Ga0068867_100039988
993 Ga0068867_100121301
994 Ga0068867_100160102
995 Ga0068867_100540781
996 Ga0068867_100545759
997 Ga0070685_10355267
998 Ga0070685_10433274
999 Ga0070706_101373809
1000 Ga0070684_100037938
1001 Ga0068853_100061463
1002 Ga0068853_100249979
1003 Ga0068853_101465811
1004 Ga0068853_101636577
1005 Ga0070672_100007115
1006 Ga0070672_100037782
1007 Ga0070672_100099452
1008 Ga0070672_100100505
1009 Ga0070672_100267761
1010 Ga0070672_100458795
1011 Ga0070672_100699181
1012 Ga0070672_101236969
1013 Ga0070672_101690110
1014 Ga0070686_100085046
1015 Ga0070686_100839494
1016 Ga0070695_100600091
1017 Ga0070696_100376705
1018 Ga0070693_100309277
1019 Ga0070665_100113415
1020 Ga0070665_100139363
1021 Ga0070665_100160529
1022 Ga0070665_100206947
1023 Ga0070665_100343182
1024 Ga0068855_100110451
1025 Ga0068855_100143287
1026 Ga0068855_100796186
1027 Ga0068855_101655203
1028 Ga0070664_100006485
1029 Ga0070664_100033538
1030 Ga0070664_100042270
1031 Ga0070664_100048069
1032 Ga0070664_100107825
1033 Ga0070664_100134830
1034 Ga0070664_100223437
1035 Ga0070664_100535128
1036 Ga0070664_100663624
1037 Ga0068857_100021397
1038 Ga0068857_100022926
1039 Ga0068857_100055828
1040 Ga0068857_100166736
1041 Ga0068857_100313978
1042 Ga0068857_100433226
1043 Ga0068854_100015391
1044 Ga0068854_100174976
1045 Ga0068854_100298394
1046 Ga0068854_100905369
1047 Ga0068854_101021767
1048 Ga0068854_101500801
1049 Ga0068854_101756877
1050 Ga0068856_100150823
1051 Ga0068856_100196661
1052 Ga0068852_100040971
1053 Ga0068852_100200572
1054 Ga0068852_100238237
1055 Ga0068852_100368072
1056 Ga0068852_100375612
1057 Ga0068852_101267016
1058 Ga0068859_100025365
1059 Ga0068859_100044703
1060 Ga0068859_100234365
1061 Ga0068859_100444429
1062 Ga0068859_100601331
1063 Ga0068864_100024911
1064 Ga0068864_100046535
1065 Ga0068864_100091862
1066 Ga0068864_100457585
1067 Ga0068864_101460542
1068 Ga0068864_101663991
1069 Ga0068864_102281323
1070 Ga0068866_10051014
1071 Ga0068866_10052223
1072 Ga0068866_10080224
1073 Ga0068866_10402763
1074 Ga0068866_10932508
1075 Ga0068861_101154463
1076 Ga0068851_10005270
1077 Ga0068851_10102144
1078 Ga0068851_10157052
1079 Ga0068851_10832002
1080 Ga0068870_10081603
1081 Ga0068870_10746782
1082 Ga0068863_100010267
1083 Ga0068863_100056113
1084 Ga0068863_100061720
1085 Ga0068863_100457794
1086 Ga0068863_101304574
1087 Ga0068858_100000537
1088 Ga0068858_100001012
1089 Ga0068858_100045809
1090 Ga0068858_100053190
1091 Ga0068858_100107150
1092 Ga0068858_100310430
1093 Ga0068860_100000674
1094 Ga0068860_100079491
1095 Ga0068860_100243706
1096 Ga0068860_100394577
1097 Ga0068860_100972837
1098 Ga0068860_101339171
1099 Ga0068862_100019864
1100 Ga0068862_102488096
1101 Ga0070717_10002447
1102 Ga0075432_10407817
1103 Ga0070716_100043503
1104 Ga0097621_100001132
1105 Ga0097621_100094431
1106 Ga0097621_102094053
1107 Ga0068871_100009161
1108 Ga0068871_100072168
1109 Ga0068871_100549894
1110 Ga0075431_101245217
1111 Ga0075433_10034113
1112 Ga0068865_100028382
1113 Ga0068865_100154000
1114 Ga0068865_100295429
1115 Ga0068865_100453685
1116 Ga0068865_100515562
1117 Ga0097620_100025365
1118 Ga0097620_100044701
1119 Ga0097620_100234357
1120 Ga0097620_100444419
1121 Ga0097620_100601350
1122 Ga0075435_100110597
1123 Ga0105240_10308896
1124 Ga0105240_10368913
1125 Ga0105245_10005782
1126 Ga0105245_10036801
1127 Ga0105245_11023470
1128 Ga0105243_10061843
1129 Ga0105243_10210075
1130 Ga0105243_10249426
1131 Ga0105243_10447322
1132 Ga0105243_10541412
1133 Ga0105241_10096026
1134 Ga0105241_11650060
1135 Ga0105241_12276268
1136 Ga0105242_10012879
1137 Ga0105242_10232472
1138 Ga0105242_10531188
1139 Ga0105248_10006139
1140 Ga0105248_10017710
1141 Ga0105248_10020480
1142 Ga0105248_10041996
1143 Ga0105248_10106452
1144 Ga0105248_10159613
1145 Ga0105248_10246454
1146 Ga0105248_10305547
1147 Ga0105248_10314744
1148 Ga0105248_10410265
1149 Ga0105237_10132129
1150 Ga0105238_10027319
1151 Ga0105238_10176529
1152 Ga0105238_11100583
1153 Ga0105249_10001854
1154 Ga0105249_10035963
1155 Ga0105249_12231656
1156 Ga0105246_10218510
1157 Ga0105246_10405954
1158 Ga0157373_10042177
1159 Ga0157373_10048822
1160 Ga0157373_10078423
1161 Ga0157373_10221276
1162 Ga0157373_11054285
1163 Ga0157371_10035320
1164 Ga0157371_10138206
1165 Ga0157371_10178797
1166 Ga0157371_10244322
1167 Ga0157371_11231332
1168 Ga0157370_10477861
1169 Ga0157369_10265816
1170 Ga0157369_10934810
1171 Ga0157374_10001881
1172 Ga0157374_10017701
1173 Ga0157374_10582288
1174 Ga0157374_11277858
1175 Ga0157378_10039972
1176 Ga0157378_10236413
1177 Ga0157378_10470030
1178 Ga0157378_12453864
1179 Ga0163162_10000299
1180 Ga0163162_10028542
1181 Ga0163162_10061880
1182 Ga0163162_10078878
1183 Ga0163162_10102168
1184 Ga0157372_10006237
1185 Ga0157372_10118298
1186 Ga0157372_10922419
1187 Ga0157375_10002179
1188 Ga0157375_10053868
1189 Ga0157375_10162487
1190 Ga0157375_10373902
1191 Ga0163163_10001414
1192 Ga0163163_10024998
1193 Ga0163163_10375408
1194 Ga0157380_10042641
1195 Ga0157380_10341206
1196 Ga0157377_10077986
1197 Ga0157379_10001085
1198 Ga0157379_10105380
1199 Ga0157379_10930147
1200 Ga0157376_10029632
1201 Ga0157376_10647448
1202 Ga0163161_10703332
1203 Ga0197907_10389534
1204 Ga0206356_10690267
1205 Ga0207697_10005598
1206 Ga0207697_10040227
1207 Ga0207656_10125763
1208 Ga0207656_10129349
1209 Ga0207656_10171161
1210 Ga0207656_10189748
1211 Ga0207656_10516913
1212 Ga0207682_10015637
1213 Ga0207642_10034255
1214 Ga0207642_10077221
1215 Ga0207642_10306221
1216 Ga0207642_10609063
1217 Ga0207688_10027264
1218 Ga0207680_10001898
1219 Ga0207680_10007284
1220 Ga0207680_10032511
1221 Ga0207680_10170168
1222 Ga0207680_10277911
1223 Ga0207680_10317703
1224 Ga0207680_10420622
1225 Ga0207647_10000767
1226 Ga0207647_10005042
1227 Ga0207647_10008681
1228 Ga0207647_10015895
1229 Ga0207647_10043530
1230 Ga0207645_10050624
1231 Ga0207645_10063810
1232 Ga0207645_10880164
1233 Ga0207645_11095148
1234 Ga0207643_10083702
1235 Ga0207643_10481891
1236 Ga0207705_10018728
1237 Ga0207705_10051119
1238 Ga0207705_10059051
1239 Ga0207705_10376377
1240 Ga0207705_10394388
1241 Ga0207705_11179091
1242 Ga0207654_10170529
1243 Ga0207707_10482941
1244 Ga0207695_10015358
1245 Ga0207695_10669220
1246 Ga0207671_10191486
1247 Ga0207660_10023014
1248 Ga0207662_10104988
1249 Ga0207657_10009035
1250 Ga0207657_10019760
1251 Ga0207657_10039470
1252 Ga0207657_10120087
1253 Ga0207657_10120123
1254 Ga0207657_10179369
1255 Ga0207657_10263884
1256 Ga0207657_10502472
1257 Ga0207657_10707448
1258 Ga0207657_11327081
1259 Ga0207649_10010601
1260 Ga0207649_10098452
1261 Ga0207649_10119547
1262 Ga0207649_10129151
1263 Ga0207649_10193785
1264 Ga0207649_10309492
1265 Ga0207649_10417647
1266 Ga0207652_10314994
1267 Ga0207681_10053148
1268 Ga0207681_10111166
1269 Ga0207681_10133201
1270 Ga0207681_10172799
1271 Ga0207681_10320006
1272 Ga0207681_11102044
1273 Ga0207694_10036792
1274 Ga0207650_10002596
1275 Ga0207650_10095648
1276 Ga0207650_10145801
1277 Ga0207650_10174316
1278 Ga0207650_10273280
1279 Ga0207650_11184439
1280 Ga0207659_10025627
1281 Ga0207659_10103835
1282 Ga0207659_10317507
1283 Ga0207659_10604899
1284 Ga0207659_10714051
1285 Ga0207659_10844123
1286 Ga0207687_10017725
1287 Ga0207687_10214151
1288 Ga0207664_10093291
1289 Ga0207644_10001777
1290 Ga0207644_10006220
1291 Ga0207644_10007710
1292 Ga0207644_10018462
1293 Ga0207644_10109085
1294 Ga0207644_10146332
1295 Ga0207644_10210091
1296 Ga0207644_11002166
1297 Ga0207690_10001613
1298 Ga0207690_10004887
1299 Ga0207690_10021598
1300 Ga0207690_10024586
1301 Ga0207690_10149315
1302 Ga0207690_10274422
1303 Ga0207690_10497284
1304 Ga0207706_10004448
1305 Ga0207706_10007897
1306 Ga0207706_10010239
1307 Ga0207706_10010364
1308 Ga0207706_10041751
1309 Ga0207706_10074512
1310 Ga0207706_10108793
1311 Ga0207706_10138753
1312 Ga0207706_10166649
1313 Ga0207706_10175180
1314 Ga0207706_10468868
1315 Ga0207706_10841455
1316 Ga0207686_10214000
1317 Ga0207686_10282539
1318 Ga0207709_10101911
1319 Ga0207709_10240592
1320 Ga0207709_10381140
1321 Ga0207709_10755797
1322 Ga0207670_11015748
1323 Ga0207669_10016762
1324 Ga0207669_10184719
1325 Ga0207669_10228433
1326 Ga0207669_10306038
1327 Ga0207669_10336812
1328 Ga0207704_10022605
1329 Ga0207704_10057635
1330 Ga0207704_10242274
1331 Ga0207665_10301500
1332 Ga0207691_10001938
1333 Ga0207691_10013272
1334 Ga0207691_10043002
1335 Ga0207691_10049913
1336 Ga0207691_10057749
1337 Ga0207691_10092324
1338 Ga0207691_10217963
1339 Ga0207691_10218589
1340 Ga0207691_10373240
1341 Ga0207711_10000639
1342 Ga0207711_10002376
1343 Ga0207711_10002816
1344 Ga0207711_10019331
1345 Ga0207711_10029677
1346 Ga0207711_10133287
1347 Ga0207711_10135108
1348 Ga0207711_10244765
1349 Ga0207711_10791144
1350 Ga0207711_10915400
1351 Ga0207689_10019500
1352 Ga0207661_10026487
1353 Ga0207661_10497883
1354 Ga0207679_10004299
1355 Ga0207679_10029163
1356 Ga0207679_10029340
1357 Ga0207679_10044041
1358 Ga0207679_10049271
1359 Ga0207679_10060517
1360 Ga0207667_10041179
1361 Ga0207667_10084543
1362 Ga0207667_10234702
1363 Ga0207667_10307519
1364 Ga0207667_10595058
1365 Ga0207667_11172475
1366 Ga0207651_10001758
1367 Ga0207651_10015200
1368 Ga0207651_10086388
1369 Ga0207651_10100400
1370 Ga0207651_10259317
1371 Ga0207651_10863598
1372 Ga0207651_10983570
1373 Ga0207651_11060890
1374 Ga0207712_10000846
1375 Ga0207712_10022768
1376 Ga0207668_10051810
1377 Ga0207668_10094447
1378 Ga0207640_10026484
1379 Ga0207640_10132388
1380 Ga0207640_10162451
1381 Ga0207640_10508459
1382 Ga0207640_10624248
1383 Ga0207658_10001050
1384 Ga0207658_10007036
1385 Ga0207658_10011885
1386 Ga0207658_10172642
1387 Ga0207658_10292441
1388 Ga0207658_10375635
1389 Ga0207658_10424495
1390 Ga0207658_10559937
1391 Ga0207658_10696523
1392 Ga0207658_10880426
1393 Ga0207677_10000516
1394 Ga0207677_10001844
1395 Ga0207677_10044463
1396 Ga0207677_10111908
1397 Ga0207677_10649744
1398 Ga0207677_11263613
1399 Ga0207703_10006703
1400 Ga0207703_10021144
1401 Ga0207703_10042372
1402 Ga0207703_10176349
1403 Ga0207703_10476767
1404 Ga0207703_11802454
1405 Ga0207639_10011835
1406 Ga0207639_10229237
1407 Ga0207639_11233192
1408 Ga0207678_10000680
1409 Ga0207678_10005278
1410 Ga0207678_10491078
1411 Ga0207678_10524782
1412 Ga0207678_10564125
1413 Ga0207678_10962814
1414 Ga0207678_11371349
1415 Ga0207702_10014274
1416 Ga0207702_10027771
1417 Ga0207641_10040174
1418 Ga0207641_10112942
1419 Ga0207641_10382849
1420 Ga0207641_10390542
1421 Ga0207641_12267034
1422 Ga0207641_12267150
1423 Ga0207648_10006402
1424 Ga0207648_10015717
1425 Ga0207648_10224263
1426 Ga0207648_10717377
1427 Ga0207648_10847091
1428 Ga0207676_10002744
1429 Ga0207676_10014886
1430 Ga0207676_10016832
1431 Ga0207676_10317025
1432 Ga0207676_12445742
1433 Ga0207674_10002878
1434 Ga0207674_10016334
1435 Ga0207674_10030888
1436 Ga0207674_10153268
1437 Ga0207674_10640910
1438 Ga0207675_100107492
1439 Ga0207675_100321354
1440 Ga0207683_10003383
1441 Ga0207683_10016119
1442 Ga0207683_10089333
1443 Ga0207683_10145554
1444 Ga0207683_10360678
1445 Ga0207683_10758208
1446 Ga0207698_10001175
1447 Ga0207698_10049330
1448 Ga0207698_10154992
1449 Ga0207698_10312857
1450 Ga0207698_10453345
1451 Ga0207698_10854857
1452 Ga0207698_11276212
1453 Ga0268266_10023127
1454 Ga0268266_10088810
1455 Ga0268266_10226583
1456 Ga0268266_10414265
1457 Ga0268266_10430657
1458 Ga0268266_12313521
1459 Ga0268265_10011424
1460 Ga0268265_10045492
1461 Ga0268265_10875427
1462 Ga0268264_10000268
1463 Ga0268264_10258159
1464 Ga0268264_10566774
1465 Ga0268264_10644588
1466 Ga0307408_100510134
1467 Ga0307408_101047029
1468 Ga0307405_10021766
1469 Ga0307405_10181000
1470 Ga0307405_10278386
1471 Ga0307405_10390158
1472 Ga0307410_10159502
1473 Ga0307410_10185534
1474 Ga0307406_10474882
1475 Ga0307406_11152953
1476 Ga0307407_10093698
1477 Ga0307407_10651629
1478 Ga0307407_10778244
1479 Ga0307412_10088658
1480 Ga0307412_10241376
1481 Ga0307409_100020610
1482 Ga0307409_100164299
1483 Ga0307409_102290920
1484 Ga0307409_102298859
1485 Ga0307416_100000426
1486 Ga0307416_100106626
1487 Ga0307416_100297464
1488 Ga0307416_100429262
1489 Ga0307416_100652698
1490 Ga0307416_101279551
1491 Ga0307414_10293624
1492 Ga0307411_10104711
1493 Ga0307411_10195297
1494 Ga0307411_10274492
1495 Ga0307411_11859859
1496 Ga0307415_100025551
1497 Ga0307415_100309386
1498 Ga0373959_0065319
1499 Ga0373949_0056109
1500 Ga0373952_0166110
1501 Ga0373941_0153007
1502 Ga0373954_0109583
1503 Ga0373956_0091194
1504 Ga0373942_0032224
1505 Ga0373962_0016096
1506 Ga0373931_0678182
1507 Ga0373935_0267629
1508 Ga0373935_1457435
1509 Ga0373927_0970075
1510 Ga0373937_0038714
1511 Ga0395899_0000157
1512 Ga0395899_0006564
1513 Ga0395899_0033565
1514 Ga0395899_0095694
1515 Ga0395899_0523610
1516 Ga0395899_0649068
1517 Ga0395900_0000296
1518 Ga0395900_0001094
1519 Ga0395900_0045787
1520 Ga0395900_0050328
1521 Ga0395900_0089095
1522 Ga0395900_0127385
1523 Ga0395900_0189370
1524 Ga0395900_0251538
1525 Ga0395900_0480128
1526 Ga0395900_0555702
1527 Ga0395900_0714069
1528 Ga0395898_0000054
1529 Ga0395898_0034839
1530 Ga0395898_0115557
1531 Ga0395898_0143772
1532 Ga0395898_0158139
1533 Ga0395898_0167535
1534 Ga0395898_0921044
1535 Ga0395905_0000046
1536 Ga0395905_0000897
1537 Ga0395905_0003152
1538 Ga0395905_0017019
1539 Ga0395905_0025112
1540 Ga0395905_0040688
1541 Ga0395905_0047208
1542 Ga0395905_0061525
1543 Ga0395905_0184213
1544 Ga0395905_0382964
1545 Ga0395905_0393305
1546 Ga0395905_0461263
1547 Ga0395905_0684130
1548 Ga0395905_0925479
1549 Ga0395905_1246443
1550 Ga0395901_0001633
1551 Ga0395901_0008013
1552 Ga0395901_0013849
1553 Ga0395901_0087624
1554 Ga0395901_0192262
1555 Ga0395901_0218193
1556 Ga0395901_0374917
1557 Ga0395901_0397899
1558 Ga0395901_0433960
1559 Ga0395901_0708449
1560 Ga0395901_0980255
1561 Ga0395901_1483709
1562 Ga0439448_0117209
1563 Ga0439458_0000052
1564 Ga0466963_0131591
1565 Ga0466963_0439459
1566 Ga0466971_0204833
1567 Ga0466957_0076314
1568 Ga0466958_0147235
1569 Ga0466967_0127645
1570 Ga0466967_2565988
1571 Ga0495583_0152054
1572 Ga0495606_0386988
1573 Ga0495610_0247663
1574 Ga0495632_0457460
1575 Ga0495644_0312155
1576 Ga0495663_0061336
1577 Ga0495654_0139838
1578 Ga0495598_0012601
1579 Ga0495621_0005885
1580 Ga0495621_0131425
1581 Ga0495621_0208394
1582 Ga0495633_0207975
1583 Ga0495633_0504464
1584 Ga0495668_0015941
1585 Ga0495623_0147476
1586 Ga0495669_0000231
1587 Ga0495669_0006775
1588 Ga0495669_0013413
1589 Ga0495669_0107488
1590 Ga0495669_0569782
1591 Ga0495670_0000351
1592 Ga0495670_0182873
1593 Ga0495677_0052330
1594 Ga0495677_0061519
1595 Ga0495602_0200472
1596 Ga0496100_0211882
1597 Ga0496100_0299751
1598 Ga0496100_1080799
1599 Ga0496101_0207736
1600 Ga0496101_0399143
1601 Ga0496101_1068138
1602 Ga0496102_0108083
1603 Ga0496102_0279999
1604 Ga0496102_0318984
1605 Ga0496102_0588309
1606 Ga0496103_0027975
1607 Ga0496103_0131321
1608 Ga0496103_0174223
1609 Ga0496103_0340881
1610 Ga0496104_0055866
1611 Ga0496104_0154074
1612 Ga0496104_1809058
1613 Ga0496105_0176813
1614 Ga0496106_0473253
1615 Ga0496106_1348841
1616 Ga0496107_0047672
1617 Ga0496107_0188391
1618 Ga0496107_0472105
1619 Ga0496107_0846677
1620 Ga0496107_1130568
1621 Ga0496108_0001265
1622 Ga0496108_0168271
1623 Ga0496109_0003663
1624 Ga0496109_0285169
1625 Ga0496109_0322386
1626 Ga0496109_0343837
1627 Ga0496109_0458720
1628 Ga0496109_2057334
1629 Ga0496110_0003659
1630 Ga0496110_0010816
1631 Ga0496110_0028268
1632 Ga0496110_0160501
1633 Ga0496110_1050801
1634 Ga0496111_0000518
1635 Ga0496111_0033258
1636 Ga0496111_0333614
1637 Ga0496112_0001853
1638 Ga0496112_0025190
1639 Ga0496112_0147173
1640 Ga0496112_0265389
1641 Ga0496113_0005985
1642 Ga0496113_0013384
1643 Ga0496113_0394809
1644 Ga0496114_0000016
1645 Ga0496114_0752221
1646 Ga0496114_1017047
1647 Ga0501067_0253582
1648 nmdc:mga06r32_1303278_c1
1649 nmdc:mga0n895_373884_c1
1650 nmdc:mga0rr50_144050_c1
1651 nmdc:mga0a205_26222_c1
1652 Ga0500627_0105086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

10

134

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.7656 2 129
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.7654 2 129
4j7t-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.7472 4 129
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.7451 2 129
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.7449 2 129
ID Description Score Start End Superfamily
af_B0R1E9_1_152_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8173 4 129 1.20.120.550
af_Q9JHF3_7_153_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7891 2 128 1.20.120.550
af_P64515_1_129_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7838 3 131 1.20.120.550
af_B0R1E9_1_152_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7833 4 129 1.20.120.550
af_P64515_1_129_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7726 3 131 1.20.120.550
ID Description Score Start End GO Terms
AF-M5CKQ2-F1-model_v4 deleted 0.974 1 129
AF-A0A149QFF4-F1-model_v4 Membrane protein 0.9733 1 129 GO:0016020
AF-A0A836P0J2-F1-model_v4 Membrane protein 0.9722 46 129 GO:0016020
AF-A0A246HHW7-F1-model_v4 MAPEG family protein 0.9684 1 129 GO:0016020
AF-G7TKU0-F1-model_v4 Inner membrane protein 0.9678 1 129 GO:0016020

Map